2I9BE

Crystal structure of atf-urokinase receptor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
b'SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMNHIDVSCCTKSGCNHPDLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 51
structure length 265
sequence length 278
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE02
3FEVA 4P7UA 3EVSC 1JGKA 2H62D 3VTSA 1KFHA 6EBXA 1NEAA 1NTXA 1KTZB 1IDGA 1ERGA 4BDTB 1CVOA 4UY2C 1L4WA 3HH7A 1FFJA 2BHIA 1W6BA 3BT1U 1S4YA 3NH7A 5IMYC 1CODA 2CDXA 4IYEA 1IJCA 2H8UA 4XJJA 2MUOA 4EY8B 1JE9A 3U74U 1BXPA 1KU6B 1QKEA 2J8BA 1KBAA 1IQ9A 4BIKB 2QJBC 1KBTA 2NBTA 1BTEA 3ERAA 2H64C 2L5SA 2QJ9C 1FRAA 1G6MA 2FD6U 1RL5A 3QB4B 3U73U 4OM4A 1UG4A 1CRFA 1HAJA 2HLQA 1TXBA 1ZADA 1LXHA 1HOYA 1QKDA 5EBXA 1DRSA 2K3GA 2MJYA 2MUPA 4DO8A 1VB0A 1V6PA 3PLCA 3LAQU 2L03A 1KL8A 1IDLA 2BTXA 1B41B 1F8UB 1IDIA 2LCRA 1TFSA 4AEAA 1FSCA 1CB9A 1FASA 1LSIA 1PLOA 2H64B 4OM5A 1XT3A 2CTXA 2CRTA 2QC1A 2UX2A 1JBDA 1MAHF 2CRSA 1LJZA 2UWRA 1RGJA 4ZQYA 2PJYC 1FSSB 4HQPF 1H0JA 1KC4A 1REWC 2H62C 3BT2U 1CDTA 1KXIA 3EBXA 1HAAA 2H7ZA 1M9ZA 3KFDE 1CDRA 1KBSA 1CXNA 1NYSA 2OFSA 5DO6A 1KS6A 1NTNA 1ABTA 2X8BB 4FAOE 1LX5B 1ONJA 2ERAA 1CXOA 1CREA 2MHYA 3KFDI 1QM7A 2GOOC 2PJYB 1CDSA 1IDHA 4FAOC 1FF4A 2CCXA 5IMTD 4LFTA 1ERAA 2I9BE 1IKCA 2MJ4A 1YWHA 4RUDA 2LA1A 1F94A 2JQPA 1HC9A 1MR6A 1CCQA 1CDQA 1COEA 1TGXA 2N99A 2MJ0A 1CHVS 2VLWA 1I02A 1IK8A 5DZ5A 5DU1A 1TXAA 2GOOB 1NYUA 1ES7B 1CTXA 2QJAC 1NORA 1LXGA 2H5FA 4QTIU 1HC9B 3NEQA 1NXBA 3NDSA 2H7ZB 2HLRA 2JVEA 2ABXA 2MFAA
chains in the Genus database with same CATH superfamily
3FEVA 4P7UA 3EVSC 1JGKA 2H62D 3VTSA 1KFHA 6EBXA 1NEAA 1NTXA 1KTZB 1IDGA 1ERGA 4BDTB 1CVOA 4UY2C 1L4WA 3HH7A 1FFJA 2BHIA 1W6BA 3BT1U 1S4YA 3NH7A 5IMYC 1CODA 2CDXA 4IYEA 1IJCA 2H8UA 4XJJA 2MUOA 4EY8B 1JE9A 3U74U 1BXPA 1KU6B 1QKEA 2J8BA 1KBAA 1IQ9A 4BIKB 2QJBC 1KBTA 2NBTA 1BTEA 3ERAA 2H64C 2L5SA 2QJ9C 1FRAA 1G6MA 2FD6U 1RL5A 3QB4B 3U73U 4OM4A 1UG4A 1CRFA 1HAJA 2HLQA 1TXBA 1ZADA 1LXHA 1HOYA 1QKDA 5EBXA 1DRSA 2K3GA 2MJYA 2MUPA 4DO8A 1VB0A 1V6PA 3PLCA 3LAQU 2L03A 1KL8A 1IDLA 2BTXA 1B41B 1F8UB 1IDIA 2LCRA 1TFSA 4AEAA 1FSCA 1CB9A 1FASA 1LSIA 1PLOA 2H64B 4OM5A 1XT3A 2CTXA 2CRTA 2QC1A 2UX2A 1JBDA 1MAHF 2CRSA 1LJZA 2UWRA 1RGJA 4ZQYA 2PJYC 1FSSB 4HQPF 1H0JA 1KC4A 1REWC 2H62C 3BT2U 1CDTA 1KXIA 3EBXA 1HAAA 2H7ZA 1M9ZA 3KFDE 1CDRA 1KBSA 4KSNA 1CXNA 1NYSA 2OFSA 5DO6A 1KS6A 1NTNA 1ABTA 2X8BB 4FAOE 1LX5B 1ONJA 2ERAA 1CXOA 1CREA 2MHYA 3KFDI 1QM7A 2GOOC 2PJYB 1CDSA 1IDHA 4FAOC 1FF4A 2CCXA 5IMTD 4LFTA 1ERAA 2I9BE 1IKCA 2MJ4A 1YWHA 4RUDA 2LA1A 1F94A 2JQPA 1HC9A 1MR6A 1CCQA 1CDQA 1COEA 1TGXA 2N99A 2MJ0A 1CHVS 2VLWA 1I02A 1IK8A 5DZ5A 5DU1A 1TXAA 2GOOB 1NYUA 1ES7B 1CTXA 2QJAC 1NORA 1LXGA 2H5FA 4QTIU 1HC9B 3NEQA 1NXBA 3NDSA 2H7ZB 2HLRA 2JVEA 2ABXA 2MFAA
chains in the Genus database with same CATH topology
3FEVA 4P7UA 3EVSC 1JGKA 2H62D 3VTSA 1KFHA 6EBXA 1NEAA 1NTXA 1KTZB 1IDGA 1ERGA 4BDTB 1CVOA 4UY2C 1L4WA 3HH7A 1FFJA 2BHIA 1W6BA 3BT1U 1S4YA 3NH7A 5IMYC 1CODA 2CDXA 4IYEA 1IJCA 2H8UA 4XJJA 2MUOA 4EY8B 1JE9A 3U74U 1BXPA 1KU6B 1QKEA 2J8BA 1KBAA 1IQ9A 4BIKB 2QJBC 1KBTA 2NBTA 1BTEA 3ERAA 2H64C 2L5SA 2QJ9C 1FRAA 1G6MA 2FD6U 1RL5A 3QB4B 3U73U 4OM4A 1UG4A 1CRFA 1HAJA 2HLQA 1TXBA 1ZADA 1LXHA 1HOYA 1QKDA 5EBXA 1DRSA 2K3GA 2MJYA 2MUPA 4DO8A 1VB0A 1V6PA 3PLCA 3LAQU 2L03A 1KL8A 1IDLA 2BTXA 1B41B 1F8UB 1IDIA 2LCRA 1TFSA 4AEAA 1FSCA 1CB9A 1FASA 1LSIA 1PLOA 2H64B 4OM5A 1XT3A 2CTXA 2CRTA 2QC1A 2UX2A 1JBDA 1MAHF 2CRSA 1LJZA 2UWRA 1RGJA 4ZQYA 2PJYC 1FSSB 4HQPF 1H0JA 1KC4A 1REWC 2H62C 3BT2U 1CDTA 1KXIA 3EBXA 1HAAA 2H7ZA 1M9ZA 3KFDE 1CDRA 1KBSA 4KSNA 1CXNA 1NYSA 2OFSA 5DO6A 1KS6A 1NTNA 1ABTA 2X8BB 4FAOE 1LX5B 1ONJA 2ERAA 1CXOA 1CREA 2MHYA 3KFDI 1QM7A 2GOOC 2PJYB 1CDSA 1IDHA 4FAOC 1FF4A 2CCXA 5IMTD 4LFTA 1ERAA 2I9BE 1IKCA 2MJ4A 1YWHA 4RUDA 2LA1A 1F94A 2JQPA 1HC9A 1MR6A 1CCQA 1CDQA 1COEA 1TGXA 2N99A 2MJ0A 1CHVS 2VLWA 1I02A 1IK8A 5DZ5A 5DU1A 1TXAA 2GOOB 1NYUA 1ES7B 1CTXA 2QJAC 1NORA 1LXGA 2H5FA 4QTIU 1HC9B 3NEQA 1NXBA 3NDSA 2H7ZB 2HLRA 2JVEA 2ABXA 2MFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEV A;  4P7U A;  3EVS C;  1JGK A;  2H62 D;  3VTS A;  1KFH A;  6EBX A;  1NEA A;  1NTX A;  1KTZ B;  1IDG A;  1ERG A;  4BDT B;  1CVO A;  4UY2 C;  1L4W A;  3HH7 A;  1FFJ A;  2BHI A;  1W6B A;  3BT1 U;  1S4Y A;  3NH7 A;  5IMY C;  1COD A;  2CDX A;  4IYE A;  1IJC A;  2H8U A;  4XJJ A;  2MUO A;  4EY8 B;  1JE9 A;  3U74 U;  1BXP A;  1KU6 B;  1QKE A;  2J8B A;  1KBA A;  1IQ9 A;  4BIK B;  2QJB C;  1KBT A;  2NBT A;  1BTE A;  3ERA A;  2H64 C;  2L5S A;  2QJ9 C;  1FRA A;  1G6M A;  2FD6 U;  1RL5 A;  3QB4 B;  3U73 U;  4OM4 A;  1UG4 A;  1CRF A;  1HAJ A;  2HLQ A;  1TXB A;  1ZAD A;  1LXH A;  1HOY A;  1QKD A;  5EBX A;  1DRS A;  2K3G A;  2MJY A;  2MUP A;  4DO8 A;  1VB0 A;  1V6P A;  3PLC A;  3LAQ U;  2L03 A;  1KL8 A;  1IDL A;  2BTX A;  1B41 B;  1F8U B;  1IDI A;  2LCR A;  1TFS A;  4AEA A;  1FSC A;  1CB9 A;  1FAS A;  1LSI A;  1PLO A;  2H64 B;  4OM5 A;  1XT3 A;  2CTX A;  2CRT A;  2QC1 A;  2UX2 A;  1JBD A;  1MAH F;  2CRS A;  1LJZ A;  2UWR A;  1RGJ A;  4ZQY A;  2PJY C;  1FSS B;  4HQP F;  1H0J A;  1KC4 A;  1REW C;  2H62 C;  3BT2 U;  1CDT A;  1KXI A;  3EBX A;  1HAA A;  2H7Z A;  1M9Z A;  3KFD E;  1CDR A;  1KBS A;  1CXN A;  1NYS A;  2OFS A;  5DO6 A;  1KS6 A;  1NTN A;  1ABT A;  2X8B B;  4FAO E;  1LX5 B;  1ONJ A;  2ERA A;  1CXO A;  1CRE A;  2MHY A;  3KFD I;  1QM7 A;  2GOO C;  2PJY B;  1CDS A;  1IDH A;  4FAO C;  1FF4 A;  2CCX A;  5IMT D;  4LFT A;  1ERA A;  2I9B E;  1IKC A;  2MJ4 A;  1YWH A;  4RUD A;  2LA1 A;  1F94 A;  2JQP A;  1HC9 A;  1MR6 A;  1CCQ A;  1CDQ A;  1COE A;  1TGX A;  2N99 A;  2MJ0 A;  1CHV S;  2VLW A;  1I02 A;  1IK8 A;  5DZ5 A;  5DU1 A;  1TXA A;  2GOO B;  1NYU A;  1ES7 B;  1CTX A;  2QJA C;  1NOR A;  1LXG A;  2H5F A;  4QTI U;  1HC9 B;  3NEQ A;  1NXB A;  3NDS A;  2H7Z B;  2HLR A;  2JVE A;  2ABX A;  2MFA A; 
#chains in the Genus database with same CATH topology
 3FEV A;  4P7U A;  3EVS C;  1JGK A;  2H62 D;  3VTS A;  1KFH A;  6EBX A;  1NEA A;  1NTX A;  1KTZ B;  1IDG A;  1ERG A;  4BDT B;  1CVO A;  4UY2 C;  1L4W A;  3HH7 A;  1FFJ A;  2BHI A;  1W6B A;  3BT1 U;  1S4Y A;  3NH7 A;  5IMY C;  1COD A;  2CDX A;  4IYE A;  1IJC A;  2H8U A;  4XJJ A;  2MUO A;  4EY8 B;  1JE9 A;  3U74 U;  1BXP A;  1KU6 B;  1QKE A;  2J8B A;  1KBA A;  1IQ9 A;  4BIK B;  2QJB C;  1KBT A;  2NBT A;  1BTE A;  3ERA A;  2H64 C;  2L5S A;  2QJ9 C;  1FRA A;  1G6M A;  2FD6 U;  1RL5 A;  3QB4 B;  3U73 U;  4OM4 A;  1UG4 A;  1CRF A;  1HAJ A;  2HLQ A;  1TXB A;  1ZAD A;  1LXH A;  1HOY A;  1QKD A;  5EBX A;  1DRS A;  2K3G A;  2MJY A;  2MUP A;  4DO8 A;  1VB0 A;  1V6P A;  3PLC A;  3LAQ U;  2L03 A;  1KL8 A;  1IDL A;  2BTX A;  1B41 B;  1F8U B;  1IDI A;  2LCR A;  1TFS A;  4AEA A;  1FSC A;  1CB9 A;  1FAS A;  1LSI A;  1PLO A;  2H64 B;  4OM5 A;  1XT3 A;  2CTX A;  2CRT A;  2QC1 A;  2UX2 A;  1JBD A;  1MAH F;  2CRS A;  1LJZ A;  2UWR A;  1RGJ A;  4ZQY A;  2PJY C;  1FSS B;  4HQP F;  1H0J A;  1KC4 A;  1REW C;  2H62 C;  3BT2 U;  1CDT A;  1KXI A;  3EBX A;  1HAA A;  2H7Z A;  1M9Z A;  3KFD E;  1CDR A;  1KBS A;  4KSN A;  1CXN A;  1NYS A;  2OFS A;  5DO6 A;  1KS6 A;  1NTN A;  1ABT A;  2X8B B;  4FAO E;  1LX5 B;  1ONJ A;  2ERA A;  1CXO A;  1CRE A;  2MHY A;  3KFD I;  1QM7 A;  2GOO C;  2PJY B;  1CDS A;  1IDH A;  4FAO C;  1FF4 A;  2CCX A;  5IMT D;  4LFT A;  1ERA A;  2I9B E;  1IKC A;  2MJ4 A;  1YWH A;  4RUD A;  2LA1 A;  1F94 A;  2JQP A;  1HC9 A;  1MR6 A;  1CCQ A;  1CDQ A;  1COE A;  1TGX A;  2N99 A;  2MJ0 A;  1CHV S;  2VLW A;  1I02 A;  1IK8 A;  5DZ5 A;  5DU1 A;  1TXA A;  2GOO B;  1NYU A;  1ES7 B;  1CTX A;  2QJA C;  1NOR A;  1LXG A;  2H5F A;  4QTI U;  1HC9 B;  3NEQ A;  1NXB A;  3NDS A;  2H7Z B;  2HLR A;  2JVE A;  2ABX A;  2MFA A; 
#chains in the Genus database with same CATH homology
 3FEV A;  4P7U A;  3EVS C;  1JGK A;  2H62 D;  3VTS A;  1KFH A;  6EBX A;  1NEA A;  1NTX A;  1KTZ B;  1IDG A;  1ERG A;  4BDT B;  1CVO A;  4UY2 C;  1L4W A;  3HH7 A;  1FFJ A;  2BHI A;  1W6B A;  3BT1 U;  1S4Y A;  3NH7 A;  5IMY C;  1COD A;  2CDX A;  4IYE A;  1IJC A;  2H8U A;  4XJJ A;  2MUO A;  4EY8 B;  1JE9 A;  3U74 U;  1BXP A;  1KU6 B;  1QKE A;  2J8B A;  1KBA A;  1IQ9 A;  4BIK B;  2QJB C;  1KBT A;  2NBT A;  1BTE A;  3ERA A;  2H64 C;  2L5S A;  2QJ9 C;  1FRA A;  1G6M A;  2FD6 U;  1RL5 A;  3QB4 B;  3U73 U;  4OM4 A;  1UG4 A;  1CRF A;  1HAJ A;  2HLQ A;  1TXB A;  1ZAD A;  1LXH A;  1HOY A;  1QKD A;  5EBX A;  1DRS A;  2K3G A;  2MJY A;  2MUP A;  4DO8 A;  1VB0 A;  1V6P A;  3PLC A;  3LAQ U;  2L03 A;  1KL8 A;  1IDL A;  2BTX A;  1B41 B;  1F8U B;  1IDI A;  2LCR A;  1TFS A;  4AEA A;  1FSC A;  1CB9 A;  1FAS A;  1LSI A;  1PLO A;  2H64 B;  4OM5 A;  1XT3 A;  2CTX A;  2CRT A;  2QC1 A;  2UX2 A;  1JBD A;  1MAH F;  2CRS A;  1LJZ A;  2UWR A;  1RGJ A;  4ZQY A;  2PJY C;  1FSS B;  4HQP F;  1H0J A;  1KC4 A;  1REW C;  2H62 C;  3BT2 U;  1CDT A;  1KXI A;  3EBX A;  1HAA A;  2H7Z A;  1M9Z A;  3KFD E;  1CDR A;  1KBS A;  4KSN A;  1CXN A;  1NYS A;  2OFS A;  5DO6 A;  1KS6 A;  1NTN A;  1ABT A;  2X8B B;  4FAO E;  1LX5 B;  1ONJ A;  2ERA A;  1CXO A;  1CRE A;  2MHY A;  3KFD I;  1QM7 A;  2GOO C;  2PJY B;  1CDS A;  1IDH A;  4FAO C;  1FF4 A;  2CCX A;  5IMT D;  4LFT A;  1ERA A;  2I9B E;  1IKC A;  2MJ4 A;  1YWH A;  4RUD A;  2LA1 A;  1F94 A;  2JQP A;  1HC9 A;  1MR6 A;  1CCQ A;  1CDQ A;  1COE A;  1TGX A;  2N99 A;  2MJ0 A;  1CHV S;  2VLW A;  1I02 A;  1IK8 A;  5DZ5 A;  5DU1 A;  1TXA A;  2GOO B;  1NYU A;  1ES7 B;  1CTX A;  2QJA C;  1NOR A;  1LXG A;  2H5F A;  4QTI U;  1HC9 B;  3NEQ A;  1NXB A;  3NDS A;  2H7Z B;  2HLR A;  2JVE A;  2ABX A;  2MFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...