2I9BE

Crystal structure of atf-urokinase receptor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMNHIDVSCCTKSGCNHPDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 51
structure length 265
sequence length 278
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE02
3BT2U 2H64B 1B41B 4BDTB 2N99A 2I9BE 1NYUA 1MAHF 2PJYC 3U73U 1F94A 1H0JA 3HH7A 1IJCA 2BTXA 1CXOA 1IDGA 1CVOA 1CCQA 1IDIA 1TFSA 1JE9A 1BTEA 1NXBA 1KC4A 1CXNA 2CCXA 2JQPA 1KTZB 1I02A 1NTNA 1VB0A 2QJBC 1ONJA 4XJJA 1LJZA 1KS6A 1KL8A 1PLOA 1FRAA 4LFTA 2HLRA 4EY8B 1IKCA 4P7UA 1KBSA 1KU6B 1W6BA 1ABTA 2ABXA 3EVSC 1ZADA 2X8BB 3U74U 1MR6A 2GOOB 1KBTA 2OFSA 1CDQA 1M9ZA 2H64C 2J8BA 4OM4A 2FD6U 5DZ5A 1HOYA 3KFDE 1IDLA 1CHVS 3NDSA 2H62D 1CTXA 2H7ZB 1L4WA 1CODA 1ERAA 2LCRA 1HAAA 4OM5A 5IMTD 1TGXA 1TXAA 1V6PA 4IYEA 1CB9A 2ERAA 2H7ZA 2MFAA 3EBXA 4AEAA 4FAOC 1LX5B 1KFHA 2VLWA 6EBXA 1CRFA 1IDHA 1UG4A 2CRTA 5EBXA 2UX2A 1FSSB 5DU1A 1LXHA 2H8UA 2CTXA 1LXGA 2GOOC 3LAQU 2MUPA 1CDSA 1G6MA 1XT3A 2QC1A 1NTXA 2L5SA 3VTSA 1CDRA 1FF4A 2H5FA 1QM7A 1CREA 2MHYA 1LSIA 1KBAA 1ERGA 1RL5A 1IQ9A 4RUDA 2QJ9C 2CDXA 1KXIA 4QTIU 2NBTA 4FAOE 1JGKA 3NH7A 5DO6A 1HC9B 1QKEA 1JBDA 2CRSA 1NYSA 5IMYC 1NORA 1NEAA 1DRSA 2PJYB 3BT1U 2JVEA 2L03A 3ERAA 3NEQA 1TXBA 4UY2C 1REWC 1S4YA 1QKDA 1FFJA 1ES7B 1RGJA 1YWHA 2MJ4A 3QB4B 1IK8A 1CDTA 1HC9A 1FSCA 2UWRA 3FEVA 4BIKB 2QJAC 2K3GA 4ZQYA 2HLQA 3KFDI 1BXPA 2H62C 1COEA 1F8UB 2MJ0A 3PLCA 2BHIA 2MUOA 4HQPF 2MJYA 4DO8A 1HAJA 1FASA 2LA1A
chains in the Genus database with same CATH superfamily
3BT2U 2H64B 1B41B 4BDTB 2N99A 2I9BE 1NYUA 1MAHF 2PJYC 3U73U 1F94A 1H0JA 3HH7A 1IJCA 2BTXA 1CXOA 1IDGA 1CVOA 1CCQA 1IDIA 1TFSA 1JE9A 1BTEA 1NXBA 1KC4A 1CXNA 2CCXA 2JQPA 1KTZB 1I02A 1NTNA 1VB0A 2QJBC 1ONJA 4XJJA 1LJZA 1KS6A 1KL8A 1PLOA 1FRAA 4LFTA 2HLRA 4EY8B 1IKCA 4P7UA 1KBSA 1KU6B 1W6BA 1ABTA 2ABXA 3EVSC 1ZADA 2X8BB 3U74U 1MR6A 2GOOB 1KBTA 2OFSA 1CDQA 1M9ZA 2H64C 2J8BA 4OM4A 2FD6U 5DZ5A 1HOYA 3KFDE 1IDLA 1CHVS 3NDSA 2H62D 1CTXA 2H7ZB 1L4WA 1CODA 1ERAA 2LCRA 1HAAA 4OM5A 5IMTD 1TGXA 1TXAA 1V6PA 4IYEA 1CB9A 2ERAA 2H7ZA 2MFAA 3EBXA 4AEAA 4FAOC 1LX5B 1KFHA 2VLWA 6EBXA 1CRFA 1IDHA 1UG4A 2CRTA 5EBXA 2UX2A 1FSSB 5DU1A 1LXHA 2H8UA 2CTXA 1LXGA 2GOOC 3LAQU 2MUPA 1CDSA 1G6MA 1XT3A 2QC1A 1NTXA 2L5SA 3VTSA 1CDRA 1FF4A 2H5FA 1QM7A 4KSNA 1CREA 2MHYA 1LSIA 1KBAA 1ERGA 1RL5A 1IQ9A 4RUDA 2QJ9C 2CDXA 1KXIA 4QTIU 2NBTA 4FAOE 1JGKA 3NH7A 5DO6A 1HC9B 1QKEA 1JBDA 2CRSA 1NYSA 5IMYC 1NORA 1NEAA 1DRSA 2PJYB 3BT1U 2JVEA 2L03A 3ERAA 3NEQA 1TXBA 4UY2C 1REWC 1S4YA 1QKDA 1FFJA 1ES7B 1RGJA 1YWHA 2MJ4A 3QB4B 1IK8A 1CDTA 1HC9A 1FSCA 2UWRA 3FEVA 4BIKB 2QJAC 2K3GA 4ZQYA 2HLQA 3KFDI 1BXPA 2H62C 1COEA 1F8UB 2MJ0A 3PLCA 2BHIA 2MUOA 4HQPF 2MJYA 4DO8A 1HAJA 1FASA 2LA1A
chains in the Genus database with same CATH topology
3BT2U 2H64B 1B41B 4BDTB 2N99A 2I9BE 1NYUA 1MAHF 2PJYC 3U73U 1F94A 1H0JA 3HH7A 1IJCA 2BTXA 1CXOA 1IDGA 1CVOA 1CCQA 1IDIA 1TFSA 1JE9A 1BTEA 1NXBA 1KC4A 1CXNA 2CCXA 2JQPA 1KTZB 1I02A 1NTNA 1VB0A 2QJBC 1ONJA 4XJJA 1LJZA 1KS6A 1KL8A 1PLOA 1FRAA 4LFTA 2HLRA 4EY8B 1IKCA 4P7UA 1KBSA 1KU6B 1W6BA 1ABTA 2ABXA 3EVSC 1ZADA 2X8BB 3U74U 1MR6A 2GOOB 1KBTA 2OFSA 1CDQA 1M9ZA 2H64C 2J8BA 4OM4A 2FD6U 5DZ5A 1HOYA 3KFDE 1IDLA 1CHVS 3NDSA 2H62D 1CTXA 2H7ZB 1L4WA 1CODA 1ERAA 2LCRA 1HAAA 4OM5A 5IMTD 1TGXA 1TXAA 1V6PA 4IYEA 1CB9A 2ERAA 2H7ZA 2MFAA 3EBXA 4AEAA 4FAOC 1LX5B 1KFHA 2VLWA 6EBXA 1CRFA 1IDHA 1UG4A 2CRTA 5EBXA 2UX2A 1FSSB 5DU1A 1LXHA 2H8UA 2CTXA 1LXGA 2GOOC 3LAQU 2MUPA 1CDSA 1G6MA 1XT3A 2QC1A 1NTXA 2L5SA 3VTSA 1CDRA 1FF4A 2H5FA 1QM7A 4KSNA 1CREA 2MHYA 1LSIA 1KBAA 1ERGA 1RL5A 1IQ9A 4RUDA 2QJ9C 2CDXA 1KXIA 4QTIU 2NBTA 4FAOE 1JGKA 3NH7A 5DO6A 1HC9B 1QKEA 1JBDA 2CRSA 1NYSA 5IMYC 1NORA 1NEAA 1DRSA 2PJYB 3BT1U 2JVEA 2L03A 3ERAA 3NEQA 1TXBA 4UY2C 1REWC 1S4YA 1QKDA 1FFJA 1ES7B 1RGJA 1YWHA 2MJ4A 3QB4B 1IK8A 1CDTA 1HC9A 1FSCA 2UWRA 3FEVA 4BIKB 2QJAC 2K3GA 4ZQYA 2HLQA 3KFDI 1BXPA 2H62C 1COEA 1F8UB 2MJ0A 3PLCA 2BHIA 2MUOA 4HQPF 2MJYA 4DO8A 1HAJA 1FASA 2LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT2 U;  2H64 B;  1B41 B;  4BDT B;  2N99 A;  2I9B E;  1NYU A;  1MAH F;  2PJY C;  3U73 U;  1F94 A;  1H0J A;  3HH7 A;  1IJC A;  2BTX A;  1CXO A;  1IDG A;  1CVO A;  1CCQ A;  1IDI A;  1TFS A;  1JE9 A;  1BTE A;  1NXB A;  1KC4 A;  1CXN A;  2CCX A;  2JQP A;  1KTZ B;  1I02 A;  1NTN A;  1VB0 A;  2QJB C;  1ONJ A;  4XJJ A;  1LJZ A;  1KS6 A;  1KL8 A;  1PLO A;  1FRA A;  4LFT A;  2HLR A;  4EY8 B;  1IKC A;  4P7U A;  1KBS A;  1KU6 B;  1W6B A;  1ABT A;  2ABX A;  3EVS C;  1ZAD A;  2X8B B;  3U74 U;  1MR6 A;  2GOO B;  1KBT A;  2OFS A;  1CDQ A;  1M9Z A;  2H64 C;  2J8B A;  4OM4 A;  2FD6 U;  5DZ5 A;  1HOY A;  3KFD E;  1IDL A;  1CHV S;  3NDS A;  2H62 D;  1CTX A;  2H7Z B;  1L4W A;  1COD A;  1ERA A;  2LCR A;  1HAA A;  4OM5 A;  5IMT D;  1TGX A;  1TXA A;  1V6P A;  4IYE A;  1CB9 A;  2ERA A;  2H7Z A;  2MFA A;  3EBX A;  4AEA A;  4FAO C;  1LX5 B;  1KFH A;  2VLW A;  6EBX A;  1CRF A;  1IDH A;  1UG4 A;  2CRT A;  5EBX A;  2UX2 A;  1FSS B;  5DU1 A;  1LXH A;  2H8U A;  2CTX A;  1LXG A;  2GOO C;  3LAQ U;  2MUP A;  1CDS A;  1G6M A;  1XT3 A;  2QC1 A;  1NTX A;  2L5S A;  3VTS A;  1CDR A;  1FF4 A;  2H5F A;  1QM7 A;  1CRE A;  2MHY A;  1LSI A;  1KBA A;  1ERG A;  1RL5 A;  1IQ9 A;  4RUD A;  2QJ9 C;  2CDX A;  1KXI A;  4QTI U;  2NBT A;  4FAO E;  1JGK A;  3NH7 A;  5DO6 A;  1HC9 B;  1QKE A;  1JBD A;  2CRS A;  1NYS A;  5IMY C;  1NOR A;  1NEA A;  1DRS A;  2PJY B;  3BT1 U;  2JVE A;  2L03 A;  3ERA A;  3NEQ A;  1TXB A;  4UY2 C;  1REW C;  1S4Y A;  1QKD A;  1FFJ A;  1ES7 B;  1RGJ A;  1YWH A;  2MJ4 A;  3QB4 B;  1IK8 A;  1CDT A;  1HC9 A;  1FSC A;  2UWR A;  3FEV A;  4BIK B;  2QJA C;  2K3G A;  4ZQY A;  2HLQ A;  3KFD I;  1BXP A;  2H62 C;  1COE A;  1F8U B;  2MJ0 A;  3PLC A;  2BHI A;  2MUO A;  4HQP F;  2MJY A;  4DO8 A;  1HAJ A;  1FAS A;  2LA1 A; 
#chains in the Genus database with same CATH topology
 3BT2 U;  2H64 B;  1B41 B;  4BDT B;  2N99 A;  2I9B E;  1NYU A;  1MAH F;  2PJY C;  3U73 U;  1F94 A;  1H0J A;  3HH7 A;  1IJC A;  2BTX A;  1CXO A;  1IDG A;  1CVO A;  1CCQ A;  1IDI A;  1TFS A;  1JE9 A;  1BTE A;  1NXB A;  1KC4 A;  1CXN A;  2CCX A;  2JQP A;  1KTZ B;  1I02 A;  1NTN A;  1VB0 A;  2QJB C;  1ONJ A;  4XJJ A;  1LJZ A;  1KS6 A;  1KL8 A;  1PLO A;  1FRA A;  4LFT A;  2HLR A;  4EY8 B;  1IKC A;  4P7U A;  1KBS A;  1KU6 B;  1W6B A;  1ABT A;  2ABX A;  3EVS C;  1ZAD A;  2X8B B;  3U74 U;  1MR6 A;  2GOO B;  1KBT A;  2OFS A;  1CDQ A;  1M9Z A;  2H64 C;  2J8B A;  4OM4 A;  2FD6 U;  5DZ5 A;  1HOY A;  3KFD E;  1IDL A;  1CHV S;  3NDS A;  2H62 D;  1CTX A;  2H7Z B;  1L4W A;  1COD A;  1ERA A;  2LCR A;  1HAA A;  4OM5 A;  5IMT D;  1TGX A;  1TXA A;  1V6P A;  4IYE A;  1CB9 A;  2ERA A;  2H7Z A;  2MFA A;  3EBX A;  4AEA A;  4FAO C;  1LX5 B;  1KFH A;  2VLW A;  6EBX A;  1CRF A;  1IDH A;  1UG4 A;  2CRT A;  5EBX A;  2UX2 A;  1FSS B;  5DU1 A;  1LXH A;  2H8U A;  2CTX A;  1LXG A;  2GOO C;  3LAQ U;  2MUP A;  1CDS A;  1G6M A;  1XT3 A;  2QC1 A;  1NTX A;  2L5S A;  3VTS A;  1CDR A;  1FF4 A;  2H5F A;  1QM7 A;  4KSN A;  1CRE A;  2MHY A;  1LSI A;  1KBA A;  1ERG A;  1RL5 A;  1IQ9 A;  4RUD A;  2QJ9 C;  2CDX A;  1KXI A;  4QTI U;  2NBT A;  4FAO E;  1JGK A;  3NH7 A;  5DO6 A;  1HC9 B;  1QKE A;  1JBD A;  2CRS A;  1NYS A;  5IMY C;  1NOR A;  1NEA A;  1DRS A;  2PJY B;  3BT1 U;  2JVE A;  2L03 A;  3ERA A;  3NEQ A;  1TXB A;  4UY2 C;  1REW C;  1S4Y A;  1QKD A;  1FFJ A;  1ES7 B;  1RGJ A;  1YWH A;  2MJ4 A;  3QB4 B;  1IK8 A;  1CDT A;  1HC9 A;  1FSC A;  2UWR A;  3FEV A;  4BIK B;  2QJA C;  2K3G A;  4ZQY A;  2HLQ A;  3KFD I;  1BXP A;  2H62 C;  1COE A;  1F8U B;  2MJ0 A;  3PLC A;  2BHI A;  2MUO A;  4HQP F;  2MJY A;  4DO8 A;  1HAJ A;  1FAS A;  2LA1 A; 
#chains in the Genus database with same CATH homology
 3BT2 U;  2H64 B;  1B41 B;  4BDT B;  2N99 A;  2I9B E;  1NYU A;  1MAH F;  2PJY C;  3U73 U;  1F94 A;  1H0J A;  3HH7 A;  1IJC A;  2BTX A;  1CXO A;  1IDG A;  1CVO A;  1CCQ A;  1IDI A;  1TFS A;  1JE9 A;  1BTE A;  1NXB A;  1KC4 A;  1CXN A;  2CCX A;  2JQP A;  1KTZ B;  1I02 A;  1NTN A;  1VB0 A;  2QJB C;  1ONJ A;  4XJJ A;  1LJZ A;  1KS6 A;  1KL8 A;  1PLO A;  1FRA A;  4LFT A;  2HLR A;  4EY8 B;  1IKC A;  4P7U A;  1KBS A;  1KU6 B;  1W6B A;  1ABT A;  2ABX A;  3EVS C;  1ZAD A;  2X8B B;  3U74 U;  1MR6 A;  2GOO B;  1KBT A;  2OFS A;  1CDQ A;  1M9Z A;  2H64 C;  2J8B A;  4OM4 A;  2FD6 U;  5DZ5 A;  1HOY A;  3KFD E;  1IDL A;  1CHV S;  3NDS A;  2H62 D;  1CTX A;  2H7Z B;  1L4W A;  1COD A;  1ERA A;  2LCR A;  1HAA A;  4OM5 A;  5IMT D;  1TGX A;  1TXA A;  1V6P A;  4IYE A;  1CB9 A;  2ERA A;  2H7Z A;  2MFA A;  3EBX A;  4AEA A;  4FAO C;  1LX5 B;  1KFH A;  2VLW A;  6EBX A;  1CRF A;  1IDH A;  1UG4 A;  2CRT A;  5EBX A;  2UX2 A;  1FSS B;  5DU1 A;  1LXH A;  2H8U A;  2CTX A;  1LXG A;  2GOO C;  3LAQ U;  2MUP A;  1CDS A;  1G6M A;  1XT3 A;  2QC1 A;  1NTX A;  2L5S A;  3VTS A;  1CDR A;  1FF4 A;  2H5F A;  1QM7 A;  4KSN A;  1CRE A;  2MHY A;  1LSI A;  1KBA A;  1ERG A;  1RL5 A;  1IQ9 A;  4RUD A;  2QJ9 C;  2CDX A;  1KXI A;  4QTI U;  2NBT A;  4FAO E;  1JGK A;  3NH7 A;  5DO6 A;  1HC9 B;  1QKE A;  1JBD A;  2CRS A;  1NYS A;  5IMY C;  1NOR A;  1NEA A;  1DRS A;  2PJY B;  3BT1 U;  2JVE A;  2L03 A;  3ERA A;  3NEQ A;  1TXB A;  4UY2 C;  1REW C;  1S4Y A;  1QKD A;  1FFJ A;  1ES7 B;  1RGJ A;  1YWH A;  2MJ4 A;  3QB4 B;  1IK8 A;  1CDT A;  1HC9 A;  1FSC A;  2UWR A;  3FEV A;  4BIK B;  2QJA C;  2K3G A;  4ZQY A;  2HLQ A;  3KFD I;  1BXP A;  2H62 C;  1COE A;  1F8U B;  2MJ0 A;  3PLC A;  2BHI A;  2MUO A;  4HQP F;  2MJY A;  4DO8 A;  1HAJ A;  1FAS A;  2LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...