2I9BE

Crystal structure of atf-urokinase receptor complex
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
278
structure length
265
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNQDTFHFLKCCQTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKQQSYMVRGCATASAHLGDAFSMNHIDVSCCTKSGCNHPDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Urokinase-type plasminogen activator
publication title Structural basis of interaction between urokinase-type plasminogen activator and its receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 265
sequence length 278
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2006-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2i9bE02
2MHYA 4XJJA 1ZADA 1HAAA 2MUOA 1B41B 1JGKA 1IKCA 3U73U 2H62C 3LAQU 1LX5B 1W6BA 3NEQA 3HH7A 1DRSA 1IQ9A 1F8UB 2H5FA 2UX2A 1BXPA 3U74U 2MJ4A 1IDGA 3VTSA 3FEVA 1QKDA 2QJBC 2ABXA 3PLCA 2PJYC 2CDXA 1HOYA 1NTXA 1LJZA 6EBXA 1CDSA 1HC9A 2CRSA 1ERAA 1CREA 4RUDA 1RL5A 1MR6A 2H64C 2L5SA 4DO8A 1CVOA 2H8UA 2QJAC 1NORA 1QM7A 4OM4A 3EBXA 5DZ5A 1IDHA 2MFAA 3QB4B 5DU1A 2H64B 2CTXA 3EVSC 2QC1A 1KL8A 2JVEA 2H62D 2H7ZB 2JQPA 3NH7A 1IDLA 2VLWA 1ABTA 4OM5A 1HC9B 1LXGA 4HQPF 1CHVS 1KBTA 1IK8A 3KFDI 1KXIA 1LXHA 1NTNA 1CB9A 2K3GA 1QKEA 2BHIA 4LFTA 4IYEA 1IJCA 1FFJA 1ES7B 2MJYA 2OFSA 4QTIU 1F94A 1KU6B 1BTEA 2H7ZA 1KS6A 1PLOA 1COEA 1NYUA 2I9BE 2PJYB 5DO6A 5EBXA 2LA1A 1ERGA 4FAOC 3NDSA 1L4WA 1HAJA 1KC4A 1KTZB 4UY2C 1KFHA 1NEAA 2NBTA 2CCXA 1KBAA 4AEAA 1FRAA 2L03A 2FD6U 2BTXA 2MJ0A 1UG4A 1S4YA 1CTXA 1CXNA 2J8BA 1VB0A 1G6MA 1CDTA 1FSSB 5IMYC 4FAOE 1CODA 1TGXA 1YWHA 1H0JA 1FF4A 4EY8B 2X8BB 4BIKB 1RGJA 4ZQYA 2ERAA 4P7UA 1TXBA 1M9ZA 1TXAA 2N99A 3ERAA 3BT2U 2HLRA 4BDTB 1CDRA 1XT3A 1ONJA 2HLQA 3BT1U 2GOOC 1CCQA 1NXBA 1JE9A 1FSCA 1NYSA 1IDIA 2CRTA 1I02A 1REWC 1V6PA 1MAHF 2GOOB 2LCRA 1JBDA 1KBSA 2QJ9C 1CRFA 3KFDE 1CDQA 1TFSA 2MUPA 1CXOA 1FASA 5IMTD 1LSIA 2UWRA
chains in the Genus database with same CATH superfamily
2MHYA 4XJJA 1ZADA 1HAAA 2MUOA 4KSNA 1B41B 1JGKA 1IKCA 3U73U 2H62C 3LAQU 1LX5B 1W6BA 3NEQA 3HH7A 1DRSA 1IQ9A 1F8UB 2H5FA 2UX2A 1BXPA 3U74U 2MJ4A 1IDGA 3VTSA 3FEVA 1QKDA 2QJBC 2ABXA 3PLCA 2PJYC 2CDXA 1HOYA 1NTXA 1LJZA 6EBXA 1CDSA 1HC9A 2CRSA 1ERAA 1CREA 4RUDA 1RL5A 1MR6A 2H64C 2L5SA 4DO8A 1CVOA 2H8UA 2QJAC 1NORA 1QM7A 4OM4A 3EBXA 5DZ5A 1IDHA 2MFAA 3QB4B 5DU1A 2H64B 2CTXA 3EVSC 2QC1A 1KL8A 2JVEA 2H62D 2H7ZB 2JQPA 3NH7A 1IDLA 2VLWA 1ABTA 4OM5A 1HC9B 1LXGA 4HQPF 1CHVS 1KBTA 1IK8A 3KFDI 1KXIA 1LXHA 1NTNA 1CB9A 2K3GA 1QKEA 2BHIA 4LFTA 4IYEA 1IJCA 1FFJA 1ES7B 2MJYA 2OFSA 4QTIU 1F94A 1KU6B 1BTEA 2H7ZA 1KS6A 1PLOA 1COEA 1NYUA 2I9BE 2PJYB 5DO6A 5EBXA 2LA1A 1ERGA 4FAOC 3NDSA 1L4WA 1HAJA 1KC4A 1KTZB 4UY2C 1KFHA 1NEAA 2NBTA 2CCXA 1KBAA 4AEAA 1FRAA 2L03A 2FD6U 2BTXA 2MJ0A 1UG4A 1S4YA 1CTXA 1CXNA 2J8BA 1VB0A 1G6MA 1CDTA 1FSSB 5IMYC 4FAOE 1CODA 1TGXA 1YWHA 1H0JA 1FF4A 4EY8B 2X8BB 4BIKB 1RGJA 4ZQYA 2ERAA 4P7UA 1TXBA 1M9ZA 1TXAA 2N99A 3ERAA 3BT2U 2HLRA 4BDTB 1CDRA 1XT3A 1ONJA 2HLQA 3BT1U 2GOOC 1CCQA 1NXBA 1JE9A 1FSCA 1NYSA 1IDIA 2CRTA 1I02A 1REWC 1V6PA 1MAHF 2GOOB 2LCRA 1JBDA 1KBSA 2QJ9C 1CRFA 3KFDE 1CDQA 1TFSA 2MUPA 1CXOA 1FASA 5IMTD 1LSIA 2UWRA
chains in the Genus database with same CATH topology
2MHYA 4XJJA 1ZADA 1HAAA 2MUOA 4KSNA 1B41B 1JGKA 1IKCA 3U73U 2H62C 3LAQU 1LX5B 1W6BA 3NEQA 3HH7A 1DRSA 1IQ9A 1F8UB 2H5FA 2UX2A 1BXPA 3U74U 2MJ4A 1IDGA 3VTSA 3FEVA 1QKDA 2QJBC 2ABXA 3PLCA 2PJYC 2CDXA 1HOYA 1NTXA 1LJZA 6EBXA 1CDSA 1HC9A 2CRSA 1ERAA 1CREA 4RUDA 1RL5A 1MR6A 2H64C 2L5SA 4DO8A 1CVOA 2H8UA 2QJAC 1NORA 1QM7A 4OM4A 3EBXA 5DZ5A 1IDHA 2MFAA 3QB4B 5DU1A 2H64B 2CTXA 3EVSC 2QC1A 1KL8A 2JVEA 2H62D 2H7ZB 2JQPA 3NH7A 1IDLA 2VLWA 1ABTA 4OM5A 1HC9B 1LXGA 4HQPF 1CHVS 1KBTA 1IK8A 3KFDI 1KXIA 1LXHA 1NTNA 1CB9A 2K3GA 1QKEA 2BHIA 4LFTA 4IYEA 1IJCA 1FFJA 1ES7B 2MJYA 2OFSA 4QTIU 1F94A 1KU6B 1BTEA 2H7ZA 1KS6A 1PLOA 1COEA 1NYUA 2I9BE 2PJYB 5DO6A 5EBXA 2LA1A 1ERGA 4FAOC 3NDSA 1L4WA 1HAJA 1KC4A 1KTZB 4UY2C 1KFHA 1NEAA 2NBTA 2CCXA 1KBAA 4AEAA 1FRAA 2L03A 2FD6U 2BTXA 2MJ0A 1UG4A 1S4YA 1CTXA 1CXNA 2J8BA 1VB0A 1G6MA 1CDTA 1FSSB 5IMYC 4FAOE 1CODA 1TGXA 1YWHA 1H0JA 1FF4A 4EY8B 2X8BB 4BIKB 1RGJA 4ZQYA 2ERAA 4P7UA 1TXBA 1M9ZA 1TXAA 2N99A 3ERAA 3BT2U 2HLRA 4BDTB 1CDRA 1XT3A 1ONJA 2HLQA 3BT1U 2GOOC 1CCQA 1NXBA 1JE9A 1FSCA 1NYSA 1IDIA 2CRTA 1I02A 1REWC 1V6PA 1MAHF 2GOOB 2LCRA 1JBDA 1KBSA 2QJ9C 1CRFA 3KFDE 1CDQA 1TFSA 2MUPA 1CXOA 1FASA 5IMTD 1LSIA 2UWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MHY A;  4XJJ A;  1ZAD A;  1HAA A;  2MUO A;  1B41 B;  1JGK A;  1IKC A;  3U73 U;  2H62 C;  3LAQ U;  1LX5 B;  1W6B A;  3NEQ A;  3HH7 A;  1DRS A;  1IQ9 A;  1F8U B;  2H5F A;  2UX2 A;  1BXP A;  3U74 U;  2MJ4 A;  1IDG A;  3VTS A;  3FEV A;  1QKD A;  2QJB C;  2ABX A;  3PLC A;  2PJY C;  2CDX A;  1HOY A;  1NTX A;  1LJZ A;  6EBX A;  1CDS A;  1HC9 A;  2CRS A;  1ERA A;  1CRE A;  4RUD A;  1RL5 A;  1MR6 A;  2H64 C;  2L5S A;  4DO8 A;  1CVO A;  2H8U A;  2QJA C;  1NOR A;  1QM7 A;  4OM4 A;  3EBX A;  5DZ5 A;  1IDH A;  2MFA A;  3QB4 B;  5DU1 A;  2H64 B;  2CTX A;  3EVS C;  2QC1 A;  1KL8 A;  2JVE A;  2H62 D;  2H7Z B;  2JQP A;  3NH7 A;  1IDL A;  2VLW A;  1ABT A;  4OM5 A;  1HC9 B;  1LXG A;  4HQP F;  1CHV S;  1KBT A;  1IK8 A;  3KFD I;  1KXI A;  1LXH A;  1NTN A;  1CB9 A;  2K3G A;  1QKE A;  2BHI A;  4LFT A;  4IYE A;  1IJC A;  1FFJ A;  1ES7 B;  2MJY A;  2OFS A;  4QTI U;  1F94 A;  1KU6 B;  1BTE A;  2H7Z A;  1KS6 A;  1PLO A;  1COE A;  1NYU A;  2I9B E;  2PJY B;  5DO6 A;  5EBX A;  2LA1 A;  1ERG A;  4FAO C;  3NDS A;  1L4W A;  1HAJ A;  1KC4 A;  1KTZ B;  4UY2 C;  1KFH A;  1NEA A;  2NBT A;  2CCX A;  1KBA A;  4AEA A;  1FRA A;  2L03 A;  2FD6 U;  2BTX A;  2MJ0 A;  1UG4 A;  1S4Y A;  1CTX A;  1CXN A;  2J8B A;  1VB0 A;  1G6M A;  1CDT A;  1FSS B;  5IMY C;  4FAO E;  1COD A;  1TGX A;  1YWH A;  1H0J A;  1FF4 A;  4EY8 B;  2X8B B;  4BIK B;  1RGJ A;  4ZQY A;  2ERA A;  4P7U A;  1TXB A;  1M9Z A;  1TXA A;  2N99 A;  3ERA A;  3BT2 U;  2HLR A;  4BDT B;  1CDR A;  1XT3 A;  1ONJ A;  2HLQ A;  3BT1 U;  2GOO C;  1CCQ A;  1NXB A;  1JE9 A;  1FSC A;  1NYS A;  1IDI A;  2CRT A;  1I02 A;  1REW C;  1V6P A;  1MAH F;  2GOO B;  2LCR A;  1JBD A;  1KBS A;  2QJ9 C;  1CRF A;  3KFD E;  1CDQ A;  1TFS A;  2MUP A;  1CXO A;  1FAS A;  5IMT D;  1LSI A;  2UWR A; 
#chains in the Genus database with same CATH topology
 2MHY A;  4XJJ A;  1ZAD A;  1HAA A;  2MUO A;  4KSN A;  1B41 B;  1JGK A;  1IKC A;  3U73 U;  2H62 C;  3LAQ U;  1LX5 B;  1W6B A;  3NEQ A;  3HH7 A;  1DRS A;  1IQ9 A;  1F8U B;  2H5F A;  2UX2 A;  1BXP A;  3U74 U;  2MJ4 A;  1IDG A;  3VTS A;  3FEV A;  1QKD A;  2QJB C;  2ABX A;  3PLC A;  2PJY C;  2CDX A;  1HOY A;  1NTX A;  1LJZ A;  6EBX A;  1CDS A;  1HC9 A;  2CRS A;  1ERA A;  1CRE A;  4RUD A;  1RL5 A;  1MR6 A;  2H64 C;  2L5S A;  4DO8 A;  1CVO A;  2H8U A;  2QJA C;  1NOR A;  1QM7 A;  4OM4 A;  3EBX A;  5DZ5 A;  1IDH A;  2MFA A;  3QB4 B;  5DU1 A;  2H64 B;  2CTX A;  3EVS C;  2QC1 A;  1KL8 A;  2JVE A;  2H62 D;  2H7Z B;  2JQP A;  3NH7 A;  1IDL A;  2VLW A;  1ABT A;  4OM5 A;  1HC9 B;  1LXG A;  4HQP F;  1CHV S;  1KBT A;  1IK8 A;  3KFD I;  1KXI A;  1LXH A;  1NTN A;  1CB9 A;  2K3G A;  1QKE A;  2BHI A;  4LFT A;  4IYE A;  1IJC A;  1FFJ A;  1ES7 B;  2MJY A;  2OFS A;  4QTI U;  1F94 A;  1KU6 B;  1BTE A;  2H7Z A;  1KS6 A;  1PLO A;  1COE A;  1NYU A;  2I9B E;  2PJY B;  5DO6 A;  5EBX A;  2LA1 A;  1ERG A;  4FAO C;  3NDS A;  1L4W A;  1HAJ A;  1KC4 A;  1KTZ B;  4UY2 C;  1KFH A;  1NEA A;  2NBT A;  2CCX A;  1KBA A;  4AEA A;  1FRA A;  2L03 A;  2FD6 U;  2BTX A;  2MJ0 A;  1UG4 A;  1S4Y A;  1CTX A;  1CXN A;  2J8B A;  1VB0 A;  1G6M A;  1CDT A;  1FSS B;  5IMY C;  4FAO E;  1COD A;  1TGX A;  1YWH A;  1H0J A;  1FF4 A;  4EY8 B;  2X8B B;  4BIK B;  1RGJ A;  4ZQY A;  2ERA A;  4P7U A;  1TXB A;  1M9Z A;  1TXA A;  2N99 A;  3ERA A;  3BT2 U;  2HLR A;  4BDT B;  1CDR A;  1XT3 A;  1ONJ A;  2HLQ A;  3BT1 U;  2GOO C;  1CCQ A;  1NXB A;  1JE9 A;  1FSC A;  1NYS A;  1IDI A;  2CRT A;  1I02 A;  1REW C;  1V6P A;  1MAH F;  2GOO B;  2LCR A;  1JBD A;  1KBS A;  2QJ9 C;  1CRF A;  3KFD E;  1CDQ A;  1TFS A;  2MUP A;  1CXO A;  1FAS A;  5IMT D;  1LSI A;  2UWR A; 
#chains in the Genus database with same CATH homology
 2MHY A;  4XJJ A;  1ZAD A;  1HAA A;  2MUO A;  4KSN A;  1B41 B;  1JGK A;  1IKC A;  3U73 U;  2H62 C;  3LAQ U;  1LX5 B;  1W6B A;  3NEQ A;  3HH7 A;  1DRS A;  1IQ9 A;  1F8U B;  2H5F A;  2UX2 A;  1BXP A;  3U74 U;  2MJ4 A;  1IDG A;  3VTS A;  3FEV A;  1QKD A;  2QJB C;  2ABX A;  3PLC A;  2PJY C;  2CDX A;  1HOY A;  1NTX A;  1LJZ A;  6EBX A;  1CDS A;  1HC9 A;  2CRS A;  1ERA A;  1CRE A;  4RUD A;  1RL5 A;  1MR6 A;  2H64 C;  2L5S A;  4DO8 A;  1CVO A;  2H8U A;  2QJA C;  1NOR A;  1QM7 A;  4OM4 A;  3EBX A;  5DZ5 A;  1IDH A;  2MFA A;  3QB4 B;  5DU1 A;  2H64 B;  2CTX A;  3EVS C;  2QC1 A;  1KL8 A;  2JVE A;  2H62 D;  2H7Z B;  2JQP A;  3NH7 A;  1IDL A;  2VLW A;  1ABT A;  4OM5 A;  1HC9 B;  1LXG A;  4HQP F;  1CHV S;  1KBT A;  1IK8 A;  3KFD I;  1KXI A;  1LXH A;  1NTN A;  1CB9 A;  2K3G A;  1QKE A;  2BHI A;  4LFT A;  4IYE A;  1IJC A;  1FFJ A;  1ES7 B;  2MJY A;  2OFS A;  4QTI U;  1F94 A;  1KU6 B;  1BTE A;  2H7Z A;  1KS6 A;  1PLO A;  1COE A;  1NYU A;  2I9B E;  2PJY B;  5DO6 A;  5EBX A;  2LA1 A;  1ERG A;  4FAO C;  3NDS A;  1L4W A;  1HAJ A;  1KC4 A;  1KTZ B;  4UY2 C;  1KFH A;  1NEA A;  2NBT A;  2CCX A;  1KBA A;  4AEA A;  1FRA A;  2L03 A;  2FD6 U;  2BTX A;  2MJ0 A;  1UG4 A;  1S4Y A;  1CTX A;  1CXN A;  2J8B A;  1VB0 A;  1G6M A;  1CDT A;  1FSS B;  5IMY C;  4FAO E;  1COD A;  1TGX A;  1YWH A;  1H0J A;  1FF4 A;  4EY8 B;  2X8B B;  4BIK B;  1RGJ A;  4ZQY A;  2ERA A;  4P7U A;  1TXB A;  1M9Z A;  1TXA A;  2N99 A;  3ERA A;  3BT2 U;  2HLR A;  4BDT B;  1CDR A;  1XT3 A;  1ONJ A;  2HLQ A;  3BT1 U;  2GOO C;  1CCQ A;  1NXB A;  1JE9 A;  1FSC A;  1NYS A;  1IDI A;  2CRT A;  1I02 A;  1REW C;  1V6P A;  1MAH F;  2GOO B;  2LCR A;  1JBD A;  1KBS A;  2QJ9 C;  1CRF A;  3KFD E;  1CDQ A;  1TFS A;  2MUP A;  1CXO A;  1FAS A;  5IMT D;  1LSI A;  2UWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...