2UX2A

High resolution structure of human cd59
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CD59 GLYCOPROTEIN
publication title High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 20
structure length 78
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ux2A00
1HC9B 5DU1A 3U74U 2BTXA 4EY8B 2H64C 2MUOA 3EVSC 1KFHA 2MHYA 2X8BB 2CTXA 1NEAA 2OFSA 2QJ9C 4QTIU 3U73U 1BXPA 1COEA 1LJZA 2H62D 1CDSA 1FASA 1FSSB 3NDSA 2QJAC 1IDGA 3EBXA 1IK8A 1B41B 1TXAA 2CRSA 1BTEA 4XJJA 5EBXA 1XT3A 4DO8A 1KBSA 1LXHA 2HLQA 1QKDA 1CVOA 2GOOB 2MJYA 4UY2C 1ONJA 5DO6A 1NTNA 4BIKB 1KTZB 3BT1U 1CTXA 1KU6B 1REWC 1ES7B 4HQPF 3FEVA 5IMTD 1NTXA 1JGKA 4FAOC 1CCQA 2CRTA 1ERGA 1TGXA 2NBTA 1IDHA 1ABTA 1CXNA 2N99A 1RGJA 1HC9A 2VLWA 2BHIA 4OM5A 4LFTA 2LCRA 3BT2U 1S4YA 1MR6A 2CDXA 3KFDI 1HAJA 3QB4B 1KS6A 2I9BE 1JBDA 1FSCA 1H0JA 1CDTA 2PJYB 1IJCA 1G6MA 1NXBA 1CDRA 2L5SA 1JE9A 1RL5A 1HAAA 1ERAA 1L4WA 1V6PA 1UG4A 4ZQYA 2CCXA 1PLOA 3NH7A 1IDLA 1VB0A 2H64B 2H7ZB 4RUDA 2QJBC 3ERAA 1ZADA 2FD6U 1IKCA 1QM7A 1F8UB 1FFJA 1FRAA 1CXOA 1CB9A 2JVEA 4AEAA 1DRSA 1CODA 2JQPA 2GOOC 2UWRA 3LAQU 2L03A 3KFDE 4P7UA 1NYSA 3PLCA 2H5FA 2UX2A 2LA1A 2MJ4A 1KBAA 2QC1A 1F94A 2H8UA 1CRFA 5DZ5A 1TXBA 1FF4A 2ERAA 1LX5B 2H62C 1NYUA 1TFSA 2HLRA 1CREA 1LXGA 1CHVS 1CDQA 1LSIA 1IDIA 2MUPA 1HOYA 2MFAA 1KC4A 1YWHA 1IQ9A 4IYEA 1KL8A 4BDTB 2ABXA 2K3GA 2PJYC 3HH7A 1NORA 1KBTA 1M9ZA 1W6BA 2MJ0A 2H7ZA 3NEQA 6EBXA 2J8BA 1QKEA 3VTSA 5IMYC 1MAHF 4OM4A 1KXIA 4FAOE 1I02A
chains in the Genus database with same CATH superfamily
1HC9B 5DU1A 3U74U 2BTXA 4EY8B 2H64C 2MUOA 3EVSC 1KFHA 2MHYA 2X8BB 2CTXA 1NEAA 2OFSA 2QJ9C 4QTIU 3U73U 1BXPA 1COEA 1LJZA 2H62D 1CDSA 1FASA 1FSSB 3NDSA 2QJAC 1IDGA 3EBXA 1IK8A 1B41B 1TXAA 2CRSA 1BTEA 4XJJA 5EBXA 1XT3A 4DO8A 1KBSA 1LXHA 2HLQA 1QKDA 1CVOA 2GOOB 2MJYA 4UY2C 1ONJA 5DO6A 1NTNA 4BIKB 1KTZB 3BT1U 1CTXA 1KU6B 1REWC 1ES7B 4HQPF 3FEVA 5IMTD 1NTXA 1JGKA 4FAOC 1CCQA 2CRTA 1ERGA 1TGXA 2NBTA 1IDHA 1ABTA 1CXNA 2N99A 1RGJA 1HC9A 2VLWA 2BHIA 4OM5A 4LFTA 2LCRA 3BT2U 1S4YA 1MR6A 2CDXA 3KFDI 1HAJA 3QB4B 1KS6A 2I9BE 1JBDA 1FSCA 1H0JA 1CDTA 2PJYB 1IJCA 1G6MA 1NXBA 1CDRA 2L5SA 1JE9A 1RL5A 1HAAA 1ERAA 1L4WA 1V6PA 1UG4A 4ZQYA 2CCXA 1PLOA 3NH7A 1IDLA 1VB0A 2H64B 2H7ZB 4RUDA 2QJBC 3ERAA 1ZADA 2FD6U 1IKCA 1QM7A 1F8UB 1FFJA 1FRAA 1CXOA 1CB9A 2JVEA 4AEAA 1DRSA 1CODA 2JQPA 2GOOC 2UWRA 3LAQU 2L03A 3KFDE 4P7UA 1NYSA 3PLCA 2H5FA 2UX2A 2LA1A 2MJ4A 1KBAA 2QC1A 1F94A 2H8UA 1CRFA 5DZ5A 1TXBA 1FF4A 2ERAA 1LX5B 2H62C 1NYUA 1TFSA 2HLRA 1CREA 1LXGA 1CHVS 1CDQA 1LSIA 1IDIA 2MUPA 4KSNA 1HOYA 2MFAA 1KC4A 1YWHA 1IQ9A 4IYEA 1KL8A 4BDTB 2ABXA 2K3GA 2PJYC 3HH7A 1NORA 1KBTA 1M9ZA 1W6BA 2MJ0A 2H7ZA 3NEQA 6EBXA 2J8BA 1QKEA 3VTSA 5IMYC 1MAHF 4OM4A 1KXIA 4FAOE 1I02A
chains in the Genus database with same CATH topology
1HC9B 5DU1A 3U74U 2BTXA 4EY8B 2H64C 2MUOA 3EVSC 1KFHA 2MHYA 2X8BB 2CTXA 1NEAA 2OFSA 2QJ9C 4QTIU 3U73U 1BXPA 1COEA 1LJZA 2H62D 1CDSA 1FASA 1FSSB 3NDSA 2QJAC 1IDGA 3EBXA 1IK8A 1B41B 1TXAA 2CRSA 1BTEA 4XJJA 5EBXA 1XT3A 4DO8A 1KBSA 1LXHA 2HLQA 1QKDA 1CVOA 2GOOB 2MJYA 4UY2C 1ONJA 5DO6A 1NTNA 4BIKB 1KTZB 3BT1U 1CTXA 1KU6B 1REWC 1ES7B 4HQPF 3FEVA 5IMTD 1NTXA 1JGKA 4FAOC 1CCQA 2CRTA 1ERGA 1TGXA 2NBTA 1IDHA 1ABTA 1CXNA 2N99A 1RGJA 1HC9A 2VLWA 2BHIA 4OM5A 4LFTA 2LCRA 3BT2U 1S4YA 1MR6A 2CDXA 3KFDI 1HAJA 3QB4B 1KS6A 2I9BE 1JBDA 1FSCA 1H0JA 1CDTA 2PJYB 1IJCA 1G6MA 1NXBA 1CDRA 2L5SA 1JE9A 1RL5A 1HAAA 1ERAA 1L4WA 1V6PA 1UG4A 4ZQYA 2CCXA 1PLOA 3NH7A 1IDLA 1VB0A 2H64B 2H7ZB 4RUDA 2QJBC 3ERAA 1ZADA 2FD6U 1IKCA 1QM7A 1F8UB 1FFJA 1FRAA 1CXOA 1CB9A 2JVEA 4AEAA 1DRSA 1CODA 2JQPA 2GOOC 2UWRA 3LAQU 2L03A 3KFDE 4P7UA 1NYSA 3PLCA 2H5FA 2UX2A 2LA1A 2MJ4A 1KBAA 2QC1A 1F94A 2H8UA 1CRFA 5DZ5A 1TXBA 1FF4A 2ERAA 1LX5B 2H62C 1NYUA 1TFSA 2HLRA 1CREA 1LXGA 1CHVS 1CDQA 1LSIA 1IDIA 2MUPA 4KSNA 1HOYA 2MFAA 1KC4A 1YWHA 1IQ9A 4IYEA 1KL8A 4BDTB 2ABXA 2K3GA 2PJYC 3HH7A 1NORA 1KBTA 1M9ZA 1W6BA 2MJ0A 2H7ZA 3NEQA 6EBXA 2J8BA 1QKEA 3VTSA 5IMYC 1MAHF 4OM4A 1KXIA 4FAOE 1I02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HC9 B;  5DU1 A;  3U74 U;  2BTX A;  4EY8 B;  2H64 C;  2MUO A;  3EVS C;  1KFH A;  2MHY A;  2X8B B;  2CTX A;  1NEA A;  2OFS A;  2QJ9 C;  4QTI U;  3U73 U;  1BXP A;  1COE A;  1LJZ A;  2H62 D;  1CDS A;  1FAS A;  1FSS B;  3NDS A;  2QJA C;  1IDG A;  3EBX A;  1IK8 A;  1B41 B;  1TXA A;  2CRS A;  1BTE A;  4XJJ A;  5EBX A;  1XT3 A;  4DO8 A;  1KBS A;  1LXH A;  2HLQ A;  1QKD A;  1CVO A;  2GOO B;  2MJY A;  4UY2 C;  1ONJ A;  5DO6 A;  1NTN A;  4BIK B;  1KTZ B;  3BT1 U;  1CTX A;  1KU6 B;  1REW C;  1ES7 B;  4HQP F;  3FEV A;  5IMT D;  1NTX A;  1JGK A;  4FAO C;  1CCQ A;  2CRT A;  1ERG A;  1TGX A;  2NBT A;  1IDH A;  1ABT A;  1CXN A;  2N99 A;  1RGJ A;  1HC9 A;  2VLW A;  2BHI A;  4OM5 A;  4LFT A;  2LCR A;  3BT2 U;  1S4Y A;  1MR6 A;  2CDX A;  3KFD I;  1HAJ A;  3QB4 B;  1KS6 A;  2I9B E;  1JBD A;  1FSC A;  1H0J A;  1CDT A;  2PJY B;  1IJC A;  1G6M A;  1NXB A;  1CDR A;  2L5S A;  1JE9 A;  1RL5 A;  1HAA A;  1ERA A;  1L4W A;  1V6P A;  1UG4 A;  4ZQY A;  2CCX A;  1PLO A;  3NH7 A;  1IDL A;  1VB0 A;  2H64 B;  2H7Z B;  4RUD A;  2QJB C;  3ERA A;  1ZAD A;  2FD6 U;  1IKC A;  1QM7 A;  1F8U B;  1FFJ A;  1FRA A;  1CXO A;  1CB9 A;  2JVE A;  4AEA A;  1DRS A;  1COD A;  2JQP A;  2GOO C;  2UWR A;  3LAQ U;  2L03 A;  3KFD E;  4P7U A;  1NYS A;  3PLC A;  2H5F A;  2UX2 A;  2LA1 A;  2MJ4 A;  1KBA A;  2QC1 A;  1F94 A;  2H8U A;  1CRF A;  5DZ5 A;  1TXB A;  1FF4 A;  2ERA A;  1LX5 B;  2H62 C;  1NYU A;  1TFS A;  2HLR A;  1CRE A;  1LXG A;  1CHV S;  1CDQ A;  1LSI A;  1IDI A;  2MUP A;  1HOY A;  2MFA A;  1KC4 A;  1YWH A;  1IQ9 A;  4IYE A;  1KL8 A;  4BDT B;  2ABX A;  2K3G A;  2PJY C;  3HH7 A;  1NOR A;  1KBT A;  1M9Z A;  1W6B A;  2MJ0 A;  2H7Z A;  3NEQ A;  6EBX A;  2J8B A;  1QKE A;  3VTS A;  5IMY C;  1MAH F;  4OM4 A;  1KXI A;  4FAO E;  1I02 A; 
#chains in the Genus database with same CATH topology
 1HC9 B;  5DU1 A;  3U74 U;  2BTX A;  4EY8 B;  2H64 C;  2MUO A;  3EVS C;  1KFH A;  2MHY A;  2X8B B;  2CTX A;  1NEA A;  2OFS A;  2QJ9 C;  4QTI U;  3U73 U;  1BXP A;  1COE A;  1LJZ A;  2H62 D;  1CDS A;  1FAS A;  1FSS B;  3NDS A;  2QJA C;  1IDG A;  3EBX A;  1IK8 A;  1B41 B;  1TXA A;  2CRS A;  1BTE A;  4XJJ A;  5EBX A;  1XT3 A;  4DO8 A;  1KBS A;  1LXH A;  2HLQ A;  1QKD A;  1CVO A;  2GOO B;  2MJY A;  4UY2 C;  1ONJ A;  5DO6 A;  1NTN A;  4BIK B;  1KTZ B;  3BT1 U;  1CTX A;  1KU6 B;  1REW C;  1ES7 B;  4HQP F;  3FEV A;  5IMT D;  1NTX A;  1JGK A;  4FAO C;  1CCQ A;  2CRT A;  1ERG A;  1TGX A;  2NBT A;  1IDH A;  1ABT A;  1CXN A;  2N99 A;  1RGJ A;  1HC9 A;  2VLW A;  2BHI A;  4OM5 A;  4LFT A;  2LCR A;  3BT2 U;  1S4Y A;  1MR6 A;  2CDX A;  3KFD I;  1HAJ A;  3QB4 B;  1KS6 A;  2I9B E;  1JBD A;  1FSC A;  1H0J A;  1CDT A;  2PJY B;  1IJC A;  1G6M A;  1NXB A;  1CDR A;  2L5S A;  1JE9 A;  1RL5 A;  1HAA A;  1ERA A;  1L4W A;  1V6P A;  1UG4 A;  4ZQY A;  2CCX A;  1PLO A;  3NH7 A;  1IDL A;  1VB0 A;  2H64 B;  2H7Z B;  4RUD A;  2QJB C;  3ERA A;  1ZAD A;  2FD6 U;  1IKC A;  1QM7 A;  1F8U B;  1FFJ A;  1FRA A;  1CXO A;  1CB9 A;  2JVE A;  4AEA A;  1DRS A;  1COD A;  2JQP A;  2GOO C;  2UWR A;  3LAQ U;  2L03 A;  3KFD E;  4P7U A;  1NYS A;  3PLC A;  2H5F A;  2UX2 A;  2LA1 A;  2MJ4 A;  1KBA A;  2QC1 A;  1F94 A;  2H8U A;  1CRF A;  5DZ5 A;  1TXB A;  1FF4 A;  2ERA A;  1LX5 B;  2H62 C;  1NYU A;  1TFS A;  2HLR A;  1CRE A;  1LXG A;  1CHV S;  1CDQ A;  1LSI A;  1IDI A;  2MUP A;  4KSN A;  1HOY A;  2MFA A;  1KC4 A;  1YWH A;  1IQ9 A;  4IYE A;  1KL8 A;  4BDT B;  2ABX A;  2K3G A;  2PJY C;  3HH7 A;  1NOR A;  1KBT A;  1M9Z A;  1W6B A;  2MJ0 A;  2H7Z A;  3NEQ A;  6EBX A;  2J8B A;  1QKE A;  3VTS A;  5IMY C;  1MAH F;  4OM4 A;  1KXI A;  4FAO E;  1I02 A; 
#chains in the Genus database with same CATH homology
 1HC9 B;  5DU1 A;  3U74 U;  2BTX A;  4EY8 B;  2H64 C;  2MUO A;  3EVS C;  1KFH A;  2MHY A;  2X8B B;  2CTX A;  1NEA A;  2OFS A;  2QJ9 C;  4QTI U;  3U73 U;  1BXP A;  1COE A;  1LJZ A;  2H62 D;  1CDS A;  1FAS A;  1FSS B;  3NDS A;  2QJA C;  1IDG A;  3EBX A;  1IK8 A;  1B41 B;  1TXA A;  2CRS A;  1BTE A;  4XJJ A;  5EBX A;  1XT3 A;  4DO8 A;  1KBS A;  1LXH A;  2HLQ A;  1QKD A;  1CVO A;  2GOO B;  2MJY A;  4UY2 C;  1ONJ A;  5DO6 A;  1NTN A;  4BIK B;  1KTZ B;  3BT1 U;  1CTX A;  1KU6 B;  1REW C;  1ES7 B;  4HQP F;  3FEV A;  5IMT D;  1NTX A;  1JGK A;  4FAO C;  1CCQ A;  2CRT A;  1ERG A;  1TGX A;  2NBT A;  1IDH A;  1ABT A;  1CXN A;  2N99 A;  1RGJ A;  1HC9 A;  2VLW A;  2BHI A;  4OM5 A;  4LFT A;  2LCR A;  3BT2 U;  1S4Y A;  1MR6 A;  2CDX A;  3KFD I;  1HAJ A;  3QB4 B;  1KS6 A;  2I9B E;  1JBD A;  1FSC A;  1H0J A;  1CDT A;  2PJY B;  1IJC A;  1G6M A;  1NXB A;  1CDR A;  2L5S A;  1JE9 A;  1RL5 A;  1HAA A;  1ERA A;  1L4W A;  1V6P A;  1UG4 A;  4ZQY A;  2CCX A;  1PLO A;  3NH7 A;  1IDL A;  1VB0 A;  2H64 B;  2H7Z B;  4RUD A;  2QJB C;  3ERA A;  1ZAD A;  2FD6 U;  1IKC A;  1QM7 A;  1F8U B;  1FFJ A;  1FRA A;  1CXO A;  1CB9 A;  2JVE A;  4AEA A;  1DRS A;  1COD A;  2JQP A;  2GOO C;  2UWR A;  3LAQ U;  2L03 A;  3KFD E;  4P7U A;  1NYS A;  3PLC A;  2H5F A;  2UX2 A;  2LA1 A;  2MJ4 A;  1KBA A;  2QC1 A;  1F94 A;  2H8U A;  1CRF A;  5DZ5 A;  1TXB A;  1FF4 A;  2ERA A;  1LX5 B;  2H62 C;  1NYU A;  1TFS A;  2HLR A;  1CRE A;  1LXG A;  1CHV S;  1CDQ A;  1LSI A;  1IDI A;  2MUP A;  4KSN A;  1HOY A;  2MFA A;  1KC4 A;  1YWH A;  1IQ9 A;  4IYE A;  1KL8 A;  4BDT B;  2ABX A;  2K3G A;  2PJY C;  3HH7 A;  1NOR A;  1KBT A;  1M9Z A;  1W6B A;  2MJ0 A;  2H7Z A;  3NEQ A;  6EBX A;  2J8B A;  1QKE A;  3VTS A;  5IMY C;  1MAH F;  4OM4 A;  1KXI A;  4FAO E;  1I02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...