2UX2A

High resolution structure of human cd59
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
78
structure length
78
Chain Sequence
MLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CD59 GLYCOPROTEIN
publication title High-Resolution Structures of Bacterially Expressed Soluble Human Cd59.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 78
sequence length 78
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ux2A00
1KS6A 2I9BE 1IK8A 1ONJA 3NH7A 1CB9A 1NORA 2QJBC 4UY2C 1MAHF 2BTXA 3PLCA 3U74U 1HAJA 1ABTA 4XJJA 2H5FA 1BTEA 1V6PA 2H62C 4HQPF 4OM5A 2BHIA 2MUPA 2LA1A 1FASA 1CCQA 2UX2A 2N99A 1NTXA 1I02A 1CTXA 4LFTA 2X8BB 1FRAA 2QJAC 3HH7A 2J8BA 4EY8B 4ZQYA 4OM4A 1KC4A 1BXPA 2JVEA 4IYEA 4P7UA 2GOOC 1HOYA 2CRTA 1HC9A 1B41B 1KBAA 1F94A 1CREA 2UWRA 1TXBA 2ERAA 1M9ZA 1IDIA 1NYSA 1ERAA 3ERAA 2ABXA 1LX5B 3KFDI 2MUOA 5IMYC 1FF4A 1PLOA 1RL5A 2HLRA 1IDLA 1LXHA 1CDRA 4DO8A 1JBDA 1IKCA 3EVSC 5DU1A 1HAAA 2GOOB 1CXNA 1F8UB 1H0JA 1IJCA 4FAOC 1CDSA 2H62D 5DZ5A 2MJYA 1KBSA 1RGJA 2NBTA 3EBXA 5IMTD 2H8UA 3NDSA 1QKDA 2JQPA 1JE9A 2LCRA 4FAOE 1LXGA 2MHYA 1KL8A 1LJZA 1TXAA 1KU6B 1CODA 1S4YA 3U73U 3KFDE 2CDXA 4BIKB 1YWHA 1CDQA 1HC9B 2CTXA 2PJYC 1NTNA 2H7ZA 1FFJA 2QC1A 5EBXA 3LAQU 2CCXA 2H64C 1LSIA 2MJ4A 2HLQA 1ES7B 2K3GA 2L5SA 3QB4B 2QJ9C 2MFAA 1IDGA 1CDTA 3NEQA 1QKEA 2CRSA 1IQ9A 1REWC 4BDTB 1CRFA 2FD6U 1G6MA 1CXOA 2L03A 1MR6A 3VTSA 1KBTA 2H64B 6EBXA 1COEA 3FEVA 1ERGA 2MJ0A 2OFSA 1NYUA 1FSCA 1NXBA 2VLWA 4AEAA 1KFHA 4RUDA 1TGXA 1L4WA 2H7ZB 1TFSA 3BT2U 1UG4A 1KTZB 5DO6A 1JGKA 1W6BA 1CHVS 4QTIU 1DRSA 1QM7A 1FSSB 1IDHA 1ZADA 1VB0A 1CVOA 3BT1U 2PJYB 1XT3A 1KXIA 1NEAA
chains in the Genus database with same CATH superfamily
1KS6A 2I9BE 1IK8A 1ONJA 3NH7A 1CB9A 1NORA 2QJBC 4UY2C 1MAHF 2BTXA 3PLCA 3U74U 1HAJA 1ABTA 4XJJA 2H5FA 1BTEA 1V6PA 2H62C 4HQPF 4OM5A 2BHIA 2MUPA 2LA1A 1FASA 1CCQA 2UX2A 2N99A 1NTXA 1I02A 1CTXA 4LFTA 2X8BB 1FRAA 2QJAC 3HH7A 2J8BA 4EY8B 4ZQYA 4OM4A 1KC4A 1BXPA 2JVEA 4IYEA 4P7UA 2GOOC 1HOYA 2CRTA 1HC9A 1B41B 1KBAA 1F94A 1CREA 2UWRA 1TXBA 2ERAA 1M9ZA 1IDIA 1NYSA 1ERAA 3ERAA 2ABXA 1LX5B 3KFDI 2MUOA 5IMYC 1FF4A 1PLOA 1RL5A 2HLRA 1IDLA 1LXHA 1CDRA 4DO8A 1JBDA 1IKCA 3EVSC 5DU1A 1HAAA 2GOOB 1CXNA 1F8UB 1H0JA 1IJCA 4FAOC 1CDSA 2H62D 5DZ5A 2MJYA 1KBSA 1RGJA 2NBTA 3EBXA 5IMTD 2H8UA 3NDSA 1QKDA 2JQPA 1JE9A 2LCRA 4FAOE 1LXGA 2MHYA 1KL8A 1LJZA 1TXAA 1KU6B 1CODA 1S4YA 3U73U 3KFDE 2CDXA 4BIKB 1YWHA 1CDQA 4KSNA 1HC9B 2CTXA 2PJYC 1NTNA 2H7ZA 1FFJA 2QC1A 5EBXA 3LAQU 2CCXA 2H64C 1LSIA 2MJ4A 2HLQA 1ES7B 2K3GA 2L5SA 3QB4B 2QJ9C 2MFAA 1IDGA 1CDTA 3NEQA 1QKEA 2CRSA 1IQ9A 1REWC 4BDTB 1CRFA 2FD6U 1G6MA 1CXOA 2L03A 1MR6A 3VTSA 1KBTA 2H64B 6EBXA 1COEA 3FEVA 1ERGA 2MJ0A 2OFSA 1NYUA 1FSCA 1NXBA 2VLWA 4AEAA 1KFHA 4RUDA 1TGXA 1L4WA 2H7ZB 1TFSA 3BT2U 1UG4A 1KTZB 5DO6A 1JGKA 1W6BA 1CHVS 4QTIU 1DRSA 1QM7A 1FSSB 1IDHA 1ZADA 1VB0A 1CVOA 3BT1U 2PJYB 1XT3A 1KXIA 1NEAA
chains in the Genus database with same CATH topology
1KS6A 2I9BE 1IK8A 1ONJA 3NH7A 1CB9A 1NORA 2QJBC 4UY2C 1MAHF 2BTXA 3PLCA 3U74U 1HAJA 1ABTA 4XJJA 2H5FA 1BTEA 1V6PA 2H62C 4HQPF 4OM5A 2BHIA 2MUPA 2LA1A 1FASA 1CCQA 2UX2A 2N99A 1NTXA 1I02A 1CTXA 4LFTA 2X8BB 1FRAA 2QJAC 3HH7A 2J8BA 4EY8B 4ZQYA 4OM4A 1KC4A 1BXPA 2JVEA 4IYEA 4P7UA 2GOOC 1HOYA 2CRTA 1HC9A 1B41B 1KBAA 1F94A 1CREA 2UWRA 1TXBA 2ERAA 1M9ZA 1IDIA 1NYSA 1ERAA 3ERAA 2ABXA 1LX5B 3KFDI 2MUOA 5IMYC 1FF4A 1PLOA 1RL5A 2HLRA 1IDLA 1LXHA 1CDRA 4DO8A 1JBDA 1IKCA 3EVSC 5DU1A 1HAAA 2GOOB 1CXNA 1F8UB 1H0JA 1IJCA 4FAOC 1CDSA 2H62D 5DZ5A 2MJYA 1KBSA 1RGJA 2NBTA 3EBXA 5IMTD 2H8UA 3NDSA 1QKDA 2JQPA 1JE9A 2LCRA 4FAOE 1LXGA 2MHYA 1KL8A 1LJZA 1TXAA 1KU6B 1CODA 1S4YA 3U73U 3KFDE 2CDXA 4BIKB 1YWHA 1CDQA 4KSNA 1HC9B 2CTXA 2PJYC 1NTNA 2H7ZA 1FFJA 2QC1A 5EBXA 3LAQU 2CCXA 2H64C 1LSIA 2MJ4A 2HLQA 1ES7B 2K3GA 2L5SA 3QB4B 2QJ9C 2MFAA 1IDGA 1CDTA 3NEQA 1QKEA 2CRSA 1IQ9A 1REWC 4BDTB 1CRFA 2FD6U 1G6MA 1CXOA 2L03A 1MR6A 3VTSA 1KBTA 2H64B 6EBXA 1COEA 3FEVA 1ERGA 2MJ0A 2OFSA 1NYUA 1FSCA 1NXBA 2VLWA 4AEAA 1KFHA 4RUDA 1TGXA 1L4WA 2H7ZB 1TFSA 3BT2U 1UG4A 1KTZB 5DO6A 1JGKA 1W6BA 1CHVS 4QTIU 1DRSA 1QM7A 1FSSB 1IDHA 1ZADA 1VB0A 1CVOA 3BT1U 2PJYB 1XT3A 1KXIA 1NEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KS6 A;  2I9B E;  1IK8 A;  1ONJ A;  3NH7 A;  1CB9 A;  1NOR A;  2QJB C;  4UY2 C;  1MAH F;  2BTX A;  3PLC A;  3U74 U;  1HAJ A;  1ABT A;  4XJJ A;  2H5F A;  1BTE A;  1V6P A;  2H62 C;  4HQP F;  4OM5 A;  2BHI A;  2MUP A;  2LA1 A;  1FAS A;  1CCQ A;  2UX2 A;  2N99 A;  1NTX A;  1I02 A;  1CTX A;  4LFT A;  2X8B B;  1FRA A;  2QJA C;  3HH7 A;  2J8B A;  4EY8 B;  4ZQY A;  4OM4 A;  1KC4 A;  1BXP A;  2JVE A;  4IYE A;  4P7U A;  2GOO C;  1HOY A;  2CRT A;  1HC9 A;  1B41 B;  1KBA A;  1F94 A;  1CRE A;  2UWR A;  1TXB A;  2ERA A;  1M9Z A;  1IDI A;  1NYS A;  1ERA A;  3ERA A;  2ABX A;  1LX5 B;  3KFD I;  2MUO A;  5IMY C;  1FF4 A;  1PLO A;  1RL5 A;  2HLR A;  1IDL A;  1LXH A;  1CDR A;  4DO8 A;  1JBD A;  1IKC A;  3EVS C;  5DU1 A;  1HAA A;  2GOO B;  1CXN A;  1F8U B;  1H0J A;  1IJC A;  4FAO C;  1CDS A;  2H62 D;  5DZ5 A;  2MJY A;  1KBS A;  1RGJ A;  2NBT A;  3EBX A;  5IMT D;  2H8U A;  3NDS A;  1QKD A;  2JQP A;  1JE9 A;  2LCR A;  4FAO E;  1LXG A;  2MHY A;  1KL8 A;  1LJZ A;  1TXA A;  1KU6 B;  1COD A;  1S4Y A;  3U73 U;  3KFD E;  2CDX A;  4BIK B;  1YWH A;  1CDQ A;  1HC9 B;  2CTX A;  2PJY C;  1NTN A;  2H7Z A;  1FFJ A;  2QC1 A;  5EBX A;  3LAQ U;  2CCX A;  2H64 C;  1LSI A;  2MJ4 A;  2HLQ A;  1ES7 B;  2K3G A;  2L5S A;  3QB4 B;  2QJ9 C;  2MFA A;  1IDG A;  1CDT A;  3NEQ A;  1QKE A;  2CRS A;  1IQ9 A;  1REW C;  4BDT B;  1CRF A;  2FD6 U;  1G6M A;  1CXO A;  2L03 A;  1MR6 A;  3VTS A;  1KBT A;  2H64 B;  6EBX A;  1COE A;  3FEV A;  1ERG A;  2MJ0 A;  2OFS A;  1NYU A;  1FSC A;  1NXB A;  2VLW A;  4AEA A;  1KFH A;  4RUD A;  1TGX A;  1L4W A;  2H7Z B;  1TFS A;  3BT2 U;  1UG4 A;  1KTZ B;  5DO6 A;  1JGK A;  1W6B A;  1CHV S;  4QTI U;  1DRS A;  1QM7 A;  1FSS B;  1IDH A;  1ZAD A;  1VB0 A;  1CVO A;  3BT1 U;  2PJY B;  1XT3 A;  1KXI A;  1NEA A; 
#chains in the Genus database with same CATH topology
 1KS6 A;  2I9B E;  1IK8 A;  1ONJ A;  3NH7 A;  1CB9 A;  1NOR A;  2QJB C;  4UY2 C;  1MAH F;  2BTX A;  3PLC A;  3U74 U;  1HAJ A;  1ABT A;  4XJJ A;  2H5F A;  1BTE A;  1V6P A;  2H62 C;  4HQP F;  4OM5 A;  2BHI A;  2MUP A;  2LA1 A;  1FAS A;  1CCQ A;  2UX2 A;  2N99 A;  1NTX A;  1I02 A;  1CTX A;  4LFT A;  2X8B B;  1FRA A;  2QJA C;  3HH7 A;  2J8B A;  4EY8 B;  4ZQY A;  4OM4 A;  1KC4 A;  1BXP A;  2JVE A;  4IYE A;  4P7U A;  2GOO C;  1HOY A;  2CRT A;  1HC9 A;  1B41 B;  1KBA A;  1F94 A;  1CRE A;  2UWR A;  1TXB A;  2ERA A;  1M9Z A;  1IDI A;  1NYS A;  1ERA A;  3ERA A;  2ABX A;  1LX5 B;  3KFD I;  2MUO A;  5IMY C;  1FF4 A;  1PLO A;  1RL5 A;  2HLR A;  1IDL A;  1LXH A;  1CDR A;  4DO8 A;  1JBD A;  1IKC A;  3EVS C;  5DU1 A;  1HAA A;  2GOO B;  1CXN A;  1F8U B;  1H0J A;  1IJC A;  4FAO C;  1CDS A;  2H62 D;  5DZ5 A;  2MJY A;  1KBS A;  1RGJ A;  2NBT A;  3EBX A;  5IMT D;  2H8U A;  3NDS A;  1QKD A;  2JQP A;  1JE9 A;  2LCR A;  4FAO E;  1LXG A;  2MHY A;  1KL8 A;  1LJZ A;  1TXA A;  1KU6 B;  1COD A;  1S4Y A;  3U73 U;  3KFD E;  2CDX A;  4BIK B;  1YWH A;  1CDQ A;  4KSN A;  1HC9 B;  2CTX A;  2PJY C;  1NTN A;  2H7Z A;  1FFJ A;  2QC1 A;  5EBX A;  3LAQ U;  2CCX A;  2H64 C;  1LSI A;  2MJ4 A;  2HLQ A;  1ES7 B;  2K3G A;  2L5S A;  3QB4 B;  2QJ9 C;  2MFA A;  1IDG A;  1CDT A;  3NEQ A;  1QKE A;  2CRS A;  1IQ9 A;  1REW C;  4BDT B;  1CRF A;  2FD6 U;  1G6M A;  1CXO A;  2L03 A;  1MR6 A;  3VTS A;  1KBT A;  2H64 B;  6EBX A;  1COE A;  3FEV A;  1ERG A;  2MJ0 A;  2OFS A;  1NYU A;  1FSC A;  1NXB A;  2VLW A;  4AEA A;  1KFH A;  4RUD A;  1TGX A;  1L4W A;  2H7Z B;  1TFS A;  3BT2 U;  1UG4 A;  1KTZ B;  5DO6 A;  1JGK A;  1W6B A;  1CHV S;  4QTI U;  1DRS A;  1QM7 A;  1FSS B;  1IDH A;  1ZAD A;  1VB0 A;  1CVO A;  3BT1 U;  2PJY B;  1XT3 A;  1KXI A;  1NEA A; 
#chains in the Genus database with same CATH homology
 1KS6 A;  2I9B E;  1IK8 A;  1ONJ A;  3NH7 A;  1CB9 A;  1NOR A;  2QJB C;  4UY2 C;  1MAH F;  2BTX A;  3PLC A;  3U74 U;  1HAJ A;  1ABT A;  4XJJ A;  2H5F A;  1BTE A;  1V6P A;  2H62 C;  4HQP F;  4OM5 A;  2BHI A;  2MUP A;  2LA1 A;  1FAS A;  1CCQ A;  2UX2 A;  2N99 A;  1NTX A;  1I02 A;  1CTX A;  4LFT A;  2X8B B;  1FRA A;  2QJA C;  3HH7 A;  2J8B A;  4EY8 B;  4ZQY A;  4OM4 A;  1KC4 A;  1BXP A;  2JVE A;  4IYE A;  4P7U A;  2GOO C;  1HOY A;  2CRT A;  1HC9 A;  1B41 B;  1KBA A;  1F94 A;  1CRE A;  2UWR A;  1TXB A;  2ERA A;  1M9Z A;  1IDI A;  1NYS A;  1ERA A;  3ERA A;  2ABX A;  1LX5 B;  3KFD I;  2MUO A;  5IMY C;  1FF4 A;  1PLO A;  1RL5 A;  2HLR A;  1IDL A;  1LXH A;  1CDR A;  4DO8 A;  1JBD A;  1IKC A;  3EVS C;  5DU1 A;  1HAA A;  2GOO B;  1CXN A;  1F8U B;  1H0J A;  1IJC A;  4FAO C;  1CDS A;  2H62 D;  5DZ5 A;  2MJY A;  1KBS A;  1RGJ A;  2NBT A;  3EBX A;  5IMT D;  2H8U A;  3NDS A;  1QKD A;  2JQP A;  1JE9 A;  2LCR A;  4FAO E;  1LXG A;  2MHY A;  1KL8 A;  1LJZ A;  1TXA A;  1KU6 B;  1COD A;  1S4Y A;  3U73 U;  3KFD E;  2CDX A;  4BIK B;  1YWH A;  1CDQ A;  4KSN A;  1HC9 B;  2CTX A;  2PJY C;  1NTN A;  2H7Z A;  1FFJ A;  2QC1 A;  5EBX A;  3LAQ U;  2CCX A;  2H64 C;  1LSI A;  2MJ4 A;  2HLQ A;  1ES7 B;  2K3G A;  2L5S A;  3QB4 B;  2QJ9 C;  2MFA A;  1IDG A;  1CDT A;  3NEQ A;  1QKE A;  2CRS A;  1IQ9 A;  1REW C;  4BDT B;  1CRF A;  2FD6 U;  1G6M A;  1CXO A;  2L03 A;  1MR6 A;  3VTS A;  1KBT A;  2H64 B;  6EBX A;  1COE A;  3FEV A;  1ERG A;  2MJ0 A;  2OFS A;  1NYU A;  1FSC A;  1NXB A;  2VLW A;  4AEA A;  1KFH A;  4RUD A;  1TGX A;  1L4W A;  2H7Z B;  1TFS A;  3BT2 U;  1UG4 A;  1KTZ B;  5DO6 A;  1JGK A;  1W6B A;  1CHV S;  4QTI U;  1DRS A;  1QM7 A;  1FSS B;  1IDH A;  1ZAD A;  1VB0 A;  1CVO A;  3BT1 U;  2PJY B;  1XT3 A;  1KXI A;  1NEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...