2QC1A

Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Alpha-bungarotoxin
publication title Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.
pubmed doi rcsb
source organism Mus musculus
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qc1A00
1L4WA 4RUDA 2MJYA 2HLRA 1ZADA 1ES7B 1W6BA 2QJ9C 1CDRA 1F8UB 1CXOA 4LFTA 1FFJA 1KL8A 2H8UA 2MJ0A 2PJYB 2HLQA 3LAQU 1KTZB 1QKDA 2MHYA 1ABTA 2CTXA 1FF4A 3PLCA 1LX5B 6EBXA 2K3GA 1MR6A 1JBDA 1ERGA 1IJCA 1NORA 2PJYC 3QB4B 2LCRA 1NYSA 5DZ5A 1CDQA 1G6MA 1PLOA 1TFSA 4DO8A 1HAJA 3KFDI 2JVEA 1NYUA 1RL5A 2H64C 2I9BE 4IYEA 2J8BA 3U73U 2H7ZA 1MAHF 1M9ZA 1CCQA 1HC9B 3EVSC 5IMTD 2L5SA 1CDSA 1KBSA 2MJ4A 5DU1A 4EY8B 1IDHA 1TXAA 1HOYA 2QJBC 3BT1U 2QJAC 3VTSA 4BIKB 1CVOA 4UY2C 3U74U 1FRAA 1FSSB 4HQPF 1KC4A 2QC1A 1KU6B 4XJJA 4FAOE 1IDGA 1FASA 2UWRA 1QM7A 3NH7A 1LXGA 1NXBA 2N99A 1LXHA 1ERAA 1IDIA 1KXIA 1CREA 4ZQYA 1LSIA 5EBXA 2ERAA 1QKEA 1DRSA 4FAOC 2LA1A 1V6PA 1FSCA 1TGXA 2L03A 2BTXA 2CRSA 2MFAA 1NTXA 2H62D 2JQPA 4OM4A 5IMYC 1I02A 1KBTA 1ONJA 2ABXA 3NEQA 4OM5A 3HH7A 2CCXA 1UG4A 1NEAA 2H7ZB 1JGKA 1F94A 2OFSA 1REWC 2H5FA 4BDTB 1KFHA 2GOOB 1IDLA 1IQ9A 2VLWA 2NBTA 1YWHA 2FD6U 2CRTA 2GOOC 2BHIA 4AEAA 1RGJA 3NDSA 2H62C 1B41B 1JE9A 1CXNA 3EBXA 2MUPA 1CHVS 1H0JA 1CRFA 1KS6A 1CB9A 3FEVA 1CODA 1XT3A 2CDXA 4P7UA 1IKCA 1LJZA 1COEA 4QTIU 1CTXA 1BTEA 1IK8A 1TXBA 1VB0A 1CDTA 2X8BB 5DO6A 1BXPA 1HAAA 3KFDE 1HC9A 2H64B 2MUOA 2UX2A 1NTNA 1KBAA 1S4YA 3BT2U 3ERAA
chains in the Genus database with same CATH superfamily
1L4WA 4RUDA 2MJYA 2HLRA 1ZADA 1ES7B 1W6BA 2QJ9C 1CDRA 1F8UB 1CXOA 4LFTA 1FFJA 1KL8A 2H8UA 2MJ0A 2PJYB 2HLQA 3LAQU 1KTZB 1QKDA 2MHYA 1ABTA 2CTXA 1FF4A 3PLCA 1LX5B 6EBXA 2K3GA 1MR6A 1JBDA 1ERGA 1IJCA 1NORA 2PJYC 3QB4B 2LCRA 1NYSA 5DZ5A 1CDQA 1G6MA 1PLOA 1TFSA 4DO8A 1HAJA 3KFDI 2JVEA 1NYUA 1RL5A 2H64C 2I9BE 4IYEA 2J8BA 3U73U 2H7ZA 1MAHF 1M9ZA 1CCQA 1HC9B 3EVSC 5IMTD 2L5SA 1CDSA 1KBSA 2MJ4A 5DU1A 4EY8B 1IDHA 1TXAA 1HOYA 2QJBC 3BT1U 2QJAC 3VTSA 4BIKB 1CVOA 4UY2C 3U74U 1FRAA 1FSSB 4HQPF 1KC4A 2QC1A 1KU6B 4XJJA 4FAOE 1IDGA 1FASA 2UWRA 1QM7A 3NH7A 1LXGA 1NXBA 2N99A 1LXHA 1ERAA 1IDIA 1KXIA 1CREA 4ZQYA 1LSIA 5EBXA 2ERAA 1QKEA 1DRSA 4FAOC 2LA1A 1V6PA 1FSCA 1TGXA 2L03A 2BTXA 2CRSA 2MFAA 1NTXA 2H62D 2JQPA 4OM4A 5IMYC 1I02A 1KBTA 1ONJA 2ABXA 3NEQA 4OM5A 3HH7A 2CCXA 1UG4A 1NEAA 2H7ZB 1JGKA 1F94A 2OFSA 1REWC 2H5FA 4BDTB 1KFHA 2GOOB 1IDLA 1IQ9A 2VLWA 4KSNA 2NBTA 1YWHA 2FD6U 2CRTA 2GOOC 2BHIA 4AEAA 1RGJA 3NDSA 2H62C 1B41B 1JE9A 1CXNA 3EBXA 2MUPA 1CHVS 1H0JA 1CRFA 1KS6A 1CB9A 3FEVA 1CODA 1XT3A 2CDXA 4P7UA 1IKCA 1LJZA 1COEA 4QTIU 1CTXA 1BTEA 1IK8A 1TXBA 1VB0A 1CDTA 2X8BB 5DO6A 1BXPA 1HAAA 3KFDE 1HC9A 2H64B 2MUOA 2UX2A 1NTNA 1KBAA 1S4YA 3BT2U 3ERAA
chains in the Genus database with same CATH topology
1L4WA 4RUDA 2MJYA 2HLRA 1ZADA 1ES7B 1W6BA 2QJ9C 1CDRA 1F8UB 1CXOA 4LFTA 1FFJA 1KL8A 2H8UA 2MJ0A 2PJYB 2HLQA 3LAQU 1KTZB 1QKDA 2MHYA 1ABTA 2CTXA 1FF4A 3PLCA 1LX5B 6EBXA 2K3GA 1MR6A 1JBDA 1ERGA 1IJCA 1NORA 2PJYC 3QB4B 2LCRA 1NYSA 5DZ5A 1CDQA 1G6MA 1PLOA 1TFSA 4DO8A 1HAJA 3KFDI 2JVEA 1NYUA 1RL5A 2H64C 2I9BE 4IYEA 2J8BA 3U73U 2H7ZA 1MAHF 1M9ZA 1CCQA 1HC9B 3EVSC 5IMTD 2L5SA 1CDSA 1KBSA 2MJ4A 5DU1A 4EY8B 1IDHA 1TXAA 1HOYA 2QJBC 3BT1U 2QJAC 3VTSA 4BIKB 1CVOA 4UY2C 3U74U 1FRAA 1FSSB 4HQPF 1KC4A 2QC1A 1KU6B 4XJJA 4FAOE 1IDGA 1FASA 2UWRA 1QM7A 3NH7A 1LXGA 1NXBA 2N99A 1LXHA 1ERAA 1IDIA 1KXIA 1CREA 4ZQYA 1LSIA 5EBXA 2ERAA 1QKEA 1DRSA 4FAOC 2LA1A 1V6PA 1FSCA 1TGXA 2L03A 2BTXA 2CRSA 2MFAA 1NTXA 2H62D 2JQPA 4OM4A 5IMYC 1I02A 1KBTA 1ONJA 2ABXA 3NEQA 4OM5A 3HH7A 2CCXA 1UG4A 1NEAA 2H7ZB 1JGKA 1F94A 2OFSA 1REWC 2H5FA 4BDTB 1KFHA 2GOOB 1IDLA 1IQ9A 2VLWA 4KSNA 2NBTA 1YWHA 2FD6U 2CRTA 2GOOC 2BHIA 4AEAA 1RGJA 3NDSA 2H62C 1B41B 1JE9A 1CXNA 3EBXA 2MUPA 1CHVS 1H0JA 1CRFA 1KS6A 1CB9A 3FEVA 1CODA 1XT3A 2CDXA 4P7UA 1IKCA 1LJZA 1COEA 4QTIU 1CTXA 1BTEA 1IK8A 1TXBA 1VB0A 1CDTA 2X8BB 5DO6A 1BXPA 1HAAA 3KFDE 1HC9A 2H64B 2MUOA 2UX2A 1NTNA 1KBAA 1S4YA 3BT2U 3ERAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L4W A;  4RUD A;  2MJY A;  2HLR A;  1ZAD A;  1ES7 B;  1W6B A;  2QJ9 C;  1CDR A;  1F8U B;  1CXO A;  4LFT A;  1FFJ A;  1KL8 A;  2H8U A;  2MJ0 A;  2PJY B;  2HLQ A;  3LAQ U;  1KTZ B;  1QKD A;  2MHY A;  1ABT A;  2CTX A;  1FF4 A;  3PLC A;  1LX5 B;  6EBX A;  2K3G A;  1MR6 A;  1JBD A;  1ERG A;  1IJC A;  1NOR A;  2PJY C;  3QB4 B;  2LCR A;  1NYS A;  5DZ5 A;  1CDQ A;  1G6M A;  1PLO A;  1TFS A;  4DO8 A;  1HAJ A;  3KFD I;  2JVE A;  1NYU A;  1RL5 A;  2H64 C;  2I9B E;  4IYE A;  2J8B A;  3U73 U;  2H7Z A;  1MAH F;  1M9Z A;  1CCQ A;  1HC9 B;  3EVS C;  5IMT D;  2L5S A;  1CDS A;  1KBS A;  2MJ4 A;  5DU1 A;  4EY8 B;  1IDH A;  1TXA A;  1HOY A;  2QJB C;  3BT1 U;  2QJA C;  3VTS A;  4BIK B;  1CVO A;  4UY2 C;  3U74 U;  1FRA A;  1FSS B;  4HQP F;  1KC4 A;  2QC1 A;  1KU6 B;  4XJJ A;  4FAO E;  1IDG A;  1FAS A;  2UWR A;  1QM7 A;  3NH7 A;  1LXG A;  1NXB A;  2N99 A;  1LXH A;  1ERA A;  1IDI A;  1KXI A;  1CRE A;  4ZQY A;  1LSI A;  5EBX A;  2ERA A;  1QKE A;  1DRS A;  4FAO C;  2LA1 A;  1V6P A;  1FSC A;  1TGX A;  2L03 A;  2BTX A;  2CRS A;  2MFA A;  1NTX A;  2H62 D;  2JQP A;  4OM4 A;  5IMY C;  1I02 A;  1KBT A;  1ONJ A;  2ABX A;  3NEQ A;  4OM5 A;  3HH7 A;  2CCX A;  1UG4 A;  1NEA A;  2H7Z B;  1JGK A;  1F94 A;  2OFS A;  1REW C;  2H5F A;  4BDT B;  1KFH A;  2GOO B;  1IDL A;  1IQ9 A;  2VLW A;  2NBT A;  1YWH A;  2FD6 U;  2CRT A;  2GOO C;  2BHI A;  4AEA A;  1RGJ A;  3NDS A;  2H62 C;  1B41 B;  1JE9 A;  1CXN A;  3EBX A;  2MUP A;  1CHV S;  1H0J A;  1CRF A;  1KS6 A;  1CB9 A;  3FEV A;  1COD A;  1XT3 A;  2CDX A;  4P7U A;  1IKC A;  1LJZ A;  1COE A;  4QTI U;  1CTX A;  1BTE A;  1IK8 A;  1TXB A;  1VB0 A;  1CDT A;  2X8B B;  5DO6 A;  1BXP A;  1HAA A;  3KFD E;  1HC9 A;  2H64 B;  2MUO A;  2UX2 A;  1NTN A;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A; 
#chains in the Genus database with same CATH topology
 1L4W A;  4RUD A;  2MJY A;  2HLR A;  1ZAD A;  1ES7 B;  1W6B A;  2QJ9 C;  1CDR A;  1F8U B;  1CXO A;  4LFT A;  1FFJ A;  1KL8 A;  2H8U A;  2MJ0 A;  2PJY B;  2HLQ A;  3LAQ U;  1KTZ B;  1QKD A;  2MHY A;  1ABT A;  2CTX A;  1FF4 A;  3PLC A;  1LX5 B;  6EBX A;  2K3G A;  1MR6 A;  1JBD A;  1ERG A;  1IJC A;  1NOR A;  2PJY C;  3QB4 B;  2LCR A;  1NYS A;  5DZ5 A;  1CDQ A;  1G6M A;  1PLO A;  1TFS A;  4DO8 A;  1HAJ A;  3KFD I;  2JVE A;  1NYU A;  1RL5 A;  2H64 C;  2I9B E;  4IYE A;  2J8B A;  3U73 U;  2H7Z A;  1MAH F;  1M9Z A;  1CCQ A;  1HC9 B;  3EVS C;  5IMT D;  2L5S A;  1CDS A;  1KBS A;  2MJ4 A;  5DU1 A;  4EY8 B;  1IDH A;  1TXA A;  1HOY A;  2QJB C;  3BT1 U;  2QJA C;  3VTS A;  4BIK B;  1CVO A;  4UY2 C;  3U74 U;  1FRA A;  1FSS B;  4HQP F;  1KC4 A;  2QC1 A;  1KU6 B;  4XJJ A;  4FAO E;  1IDG A;  1FAS A;  2UWR A;  1QM7 A;  3NH7 A;  1LXG A;  1NXB A;  2N99 A;  1LXH A;  1ERA A;  1IDI A;  1KXI A;  1CRE A;  4ZQY A;  1LSI A;  5EBX A;  2ERA A;  1QKE A;  1DRS A;  4FAO C;  2LA1 A;  1V6P A;  1FSC A;  1TGX A;  2L03 A;  2BTX A;  2CRS A;  2MFA A;  1NTX A;  2H62 D;  2JQP A;  4OM4 A;  5IMY C;  1I02 A;  1KBT A;  1ONJ A;  2ABX A;  3NEQ A;  4OM5 A;  3HH7 A;  2CCX A;  1UG4 A;  1NEA A;  2H7Z B;  1JGK A;  1F94 A;  2OFS A;  1REW C;  2H5F A;  4BDT B;  1KFH A;  2GOO B;  1IDL A;  1IQ9 A;  2VLW A;  4KSN A;  2NBT A;  1YWH A;  2FD6 U;  2CRT A;  2GOO C;  2BHI A;  4AEA A;  1RGJ A;  3NDS A;  2H62 C;  1B41 B;  1JE9 A;  1CXN A;  3EBX A;  2MUP A;  1CHV S;  1H0J A;  1CRF A;  1KS6 A;  1CB9 A;  3FEV A;  1COD A;  1XT3 A;  2CDX A;  4P7U A;  1IKC A;  1LJZ A;  1COE A;  4QTI U;  1CTX A;  1BTE A;  1IK8 A;  1TXB A;  1VB0 A;  1CDT A;  2X8B B;  5DO6 A;  1BXP A;  1HAA A;  3KFD E;  1HC9 A;  2H64 B;  2MUO A;  2UX2 A;  1NTN A;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A; 
#chains in the Genus database with same CATH homology
 1L4W A;  4RUD A;  2MJY A;  2HLR A;  1ZAD A;  1ES7 B;  1W6B A;  2QJ9 C;  1CDR A;  1F8U B;  1CXO A;  4LFT A;  1FFJ A;  1KL8 A;  2H8U A;  2MJ0 A;  2PJY B;  2HLQ A;  3LAQ U;  1KTZ B;  1QKD A;  2MHY A;  1ABT A;  2CTX A;  1FF4 A;  3PLC A;  1LX5 B;  6EBX A;  2K3G A;  1MR6 A;  1JBD A;  1ERG A;  1IJC A;  1NOR A;  2PJY C;  3QB4 B;  2LCR A;  1NYS A;  5DZ5 A;  1CDQ A;  1G6M A;  1PLO A;  1TFS A;  4DO8 A;  1HAJ A;  3KFD I;  2JVE A;  1NYU A;  1RL5 A;  2H64 C;  2I9B E;  4IYE A;  2J8B A;  3U73 U;  2H7Z A;  1MAH F;  1M9Z A;  1CCQ A;  1HC9 B;  3EVS C;  5IMT D;  2L5S A;  1CDS A;  1KBS A;  2MJ4 A;  5DU1 A;  4EY8 B;  1IDH A;  1TXA A;  1HOY A;  2QJB C;  3BT1 U;  2QJA C;  3VTS A;  4BIK B;  1CVO A;  4UY2 C;  3U74 U;  1FRA A;  1FSS B;  4HQP F;  1KC4 A;  2QC1 A;  1KU6 B;  4XJJ A;  4FAO E;  1IDG A;  1FAS A;  2UWR A;  1QM7 A;  3NH7 A;  1LXG A;  1NXB A;  2N99 A;  1LXH A;  1ERA A;  1IDI A;  1KXI A;  1CRE A;  4ZQY A;  1LSI A;  5EBX A;  2ERA A;  1QKE A;  1DRS A;  4FAO C;  2LA1 A;  1V6P A;  1FSC A;  1TGX A;  2L03 A;  2BTX A;  2CRS A;  2MFA A;  1NTX A;  2H62 D;  2JQP A;  4OM4 A;  5IMY C;  1I02 A;  1KBT A;  1ONJ A;  2ABX A;  3NEQ A;  4OM5 A;  3HH7 A;  2CCX A;  1UG4 A;  1NEA A;  2H7Z B;  1JGK A;  1F94 A;  2OFS A;  1REW C;  2H5F A;  4BDT B;  1KFH A;  2GOO B;  1IDL A;  1IQ9 A;  2VLW A;  4KSN A;  2NBT A;  1YWH A;  2FD6 U;  2CRT A;  2GOO C;  2BHI A;  4AEA A;  1RGJ A;  3NDS A;  2H62 C;  1B41 B;  1JE9 A;  1CXN A;  3EBX A;  2MUP A;  1CHV S;  1H0J A;  1CRF A;  1KS6 A;  1CB9 A;  3FEV A;  1COD A;  1XT3 A;  2CDX A;  4P7U A;  1IKC A;  1LJZ A;  1COE A;  4QTI U;  1CTX A;  1BTE A;  1IK8 A;  1TXB A;  1VB0 A;  1CDT A;  2X8B B;  5DO6 A;  1BXP A;  1HAA A;  3KFD E;  1HC9 A;  2H64 B;  2MUO A;  2UX2 A;  1NTN A;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...