2QC1A

Crystal structure of the extracellular domain of the nicotinic acetylcholine receptor 1 subunit bound to alpha-bungarotoxin at 1.9 a resolution
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
b'IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-bungarotoxin
publication title Crystal structure of the extracellular domain of nAChR alpha1 bound to alpha-bungarotoxin at 1.94 A resolution.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2007-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qc1A00
4QTIU 1CDTA 3KFDI 1FRAA 2MJ4A 5DZ5A 1F94A 1KBAA 2GOOC 4OM4A 1I02A 1B41B 2JVEA 2J8BA 1IDHA 1KBSA 1CHVS 2CRTA 1QM7A 1FF4A 1CB9A 5DU1A 1IJCA 1NTNA 4IYEA 1NORA 1W6BA 3BT2U 1HC9B 5IMTD 1LXHA 1CDRA 4ZQYA 4UY2C 3EBXA 1DRSA 1BXPA 1CXOA 1IDGA 1G6MA 2NBTA 1IDIA 2CRSA 2MFAA 2HLRA 1REWC 3U73U 2H8UA 2OFSA 2GOOB 1KS6A 2CCXA 4EY8B 1COEA 4OM5A 3VTSA 1JE9A 2ABXA 1HC9A 1LXGA 2ERAA 1HOYA 2VLWA 1YWHA 3BT1U 2LCRA 2PJYC 2CDXA 1ONJA 2MJ0A 1ERGA 1CXNA 1CDQA 1BTEA 3EVSC 1MAHF 2H7ZA 2HLQA 2UX2A 2JQPA 1JBDA 2L5SA 4P7UA 1CREA 1CCQA 1KXIA 4BIKB 1FFJA 1ABTA 2QJAC 5DO6A 2K3GA 1NYUA 4DO8A 6EBXA 1JGKA 1TFSA 3KFDE 2H7ZB 2BTXA 3HH7A 1LJZA 1V6PA 2QJBC 2CTXA 2H5FA 1CTXA 2PJYB 1QKDA 2MJYA 1H0JA 1CVOA 1FSCA 1KTZB 1VB0A 1ERAA 4AEAA 1M9ZA 2FD6U 3QB4B 1IDLA 1RL5A 1IKCA 3NH7A 1QKEA 1HAJA 4FAOE 3PLCA 1L4WA 3LAQU 1NTXA 2N99A 1F8UB 2H64C 3U74U 1IQ9A 1FSSB 1KC4A 2X8BB 1CDSA 1UG4A 3ERAA 1NXBA 3NDSA 2UWRA 1S4YA 2BHIA 1KU6B 2H62D 1MR6A 1KFHA 2H62C 1CRFA 1LSIA 4FAOC 2MUOA 1IK8A 1XT3A 2QJ9C 4LFTA 2QC1A 1NEAA 1PLOA 5IMYC 2LA1A 1ZADA 1ES7B 1HAAA 1TGXA 4BDTB 2I9BE 1CODA 4HQPF 1TXAA 2H64B 1KBTA 4RUDA 1TXBA 1KL8A 5EBXA 2MHYA 3FEVA 4XJJA 2MUPA 1LX5B 3NEQA 1FASA 1NYSA 2L03A 1RGJA
chains in the Genus database with same CATH superfamily
4QTIU 4KSNA 1CDTA 3KFDI 1FRAA 2MJ4A 5DZ5A 1F94A 1KBAA 2GOOC 4OM4A 1I02A 1B41B 2JVEA 2J8BA 1IDHA 1KBSA 1CHVS 2CRTA 1QM7A 1FF4A 1CB9A 5DU1A 1IJCA 1NTNA 4IYEA 1NORA 1W6BA 3BT2U 1HC9B 5IMTD 1LXHA 1CDRA 4ZQYA 4UY2C 3EBXA 1DRSA 1BXPA 1CXOA 1IDGA 1G6MA 2NBTA 1IDIA 2CRSA 2MFAA 2HLRA 1REWC 3U73U 2H8UA 2OFSA 2GOOB 1KS6A 2CCXA 4EY8B 1COEA 4OM5A 3VTSA 1JE9A 2ABXA 1HC9A 1LXGA 2ERAA 1HOYA 2VLWA 1YWHA 3BT1U 2LCRA 2PJYC 2CDXA 1ONJA 2MJ0A 1ERGA 1CXNA 1CDQA 1BTEA 3EVSC 1MAHF 2H7ZA 2HLQA 2UX2A 2JQPA 1JBDA 2L5SA 4P7UA 1CREA 1CCQA 1KXIA 4BIKB 1FFJA 1ABTA 2QJAC 5DO6A 2K3GA 1NYUA 4DO8A 6EBXA 1JGKA 1TFSA 3KFDE 2H7ZB 2BTXA 3HH7A 1LJZA 1V6PA 2QJBC 2CTXA 2H5FA 1CTXA 2PJYB 1QKDA 2MJYA 1H0JA 1CVOA 1FSCA 1KTZB 1VB0A 1ERAA 4AEAA 1M9ZA 2FD6U 3QB4B 1IDLA 1RL5A 1IKCA 3NH7A 1QKEA 1HAJA 4FAOE 3PLCA 1L4WA 3LAQU 1NTXA 2N99A 1F8UB 2H64C 3U74U 1IQ9A 1FSSB 1KC4A 2X8BB 1CDSA 1UG4A 3ERAA 1NXBA 3NDSA 2UWRA 1S4YA 2BHIA 1KU6B 2H62D 1MR6A 1KFHA 2H62C 1CRFA 1LSIA 4FAOC 2MUOA 1IK8A 1XT3A 2QJ9C 4LFTA 2QC1A 1NEAA 1PLOA 5IMYC 2LA1A 1ZADA 1ES7B 1HAAA 1TGXA 4BDTB 2I9BE 1CODA 4HQPF 1TXAA 2H64B 1KBTA 4RUDA 1TXBA 1KL8A 5EBXA 2MHYA 3FEVA 4XJJA 2MUPA 1LX5B 3NEQA 1FASA 1NYSA 2L03A 1RGJA
chains in the Genus database with same CATH topology
4QTIU 4KSNA 1CDTA 3KFDI 1FRAA 2MJ4A 5DZ5A 1F94A 1KBAA 2GOOC 4OM4A 1I02A 1B41B 2JVEA 2J8BA 1IDHA 1KBSA 1CHVS 2CRTA 1QM7A 1FF4A 1CB9A 5DU1A 1IJCA 1NTNA 4IYEA 1NORA 1W6BA 3BT2U 1HC9B 5IMTD 1LXHA 1CDRA 4ZQYA 4UY2C 3EBXA 1DRSA 1BXPA 1CXOA 1IDGA 1G6MA 2NBTA 1IDIA 2CRSA 2MFAA 2HLRA 1REWC 3U73U 2H8UA 2OFSA 2GOOB 1KS6A 2CCXA 4EY8B 1COEA 4OM5A 3VTSA 1JE9A 2ABXA 1HC9A 1LXGA 2ERAA 1HOYA 2VLWA 1YWHA 3BT1U 2LCRA 2PJYC 2CDXA 1ONJA 2MJ0A 1ERGA 1CXNA 1CDQA 1BTEA 3EVSC 1MAHF 2H7ZA 2HLQA 2UX2A 2JQPA 1JBDA 2L5SA 4P7UA 1CREA 1CCQA 1KXIA 4BIKB 1FFJA 1ABTA 2QJAC 5DO6A 2K3GA 1NYUA 4DO8A 6EBXA 1JGKA 1TFSA 3KFDE 2H7ZB 2BTXA 3HH7A 1LJZA 1V6PA 2QJBC 2CTXA 2H5FA 1CTXA 2PJYB 1QKDA 2MJYA 1H0JA 1CVOA 1FSCA 1KTZB 1VB0A 1ERAA 4AEAA 1M9ZA 2FD6U 3QB4B 1IDLA 1RL5A 1IKCA 3NH7A 1QKEA 1HAJA 4FAOE 3PLCA 1L4WA 3LAQU 1NTXA 2N99A 1F8UB 2H64C 3U74U 1IQ9A 1FSSB 1KC4A 2X8BB 1CDSA 1UG4A 3ERAA 1NXBA 3NDSA 2UWRA 1S4YA 2BHIA 1KU6B 2H62D 1MR6A 1KFHA 2H62C 1CRFA 1LSIA 4FAOC 2MUOA 1IK8A 1XT3A 2QJ9C 4LFTA 2QC1A 1NEAA 1PLOA 5IMYC 2LA1A 1ZADA 1ES7B 1HAAA 1TGXA 4BDTB 2I9BE 1CODA 4HQPF 1TXAA 2H64B 1KBTA 4RUDA 1TXBA 1KL8A 5EBXA 2MHYA 3FEVA 4XJJA 2MUPA 1LX5B 3NEQA 1FASA 1NYSA 2L03A 1RGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QTI U;  1CDT A;  3KFD I;  1FRA A;  2MJ4 A;  5DZ5 A;  1F94 A;  1KBA A;  2GOO C;  4OM4 A;  1I02 A;  1B41 B;  2JVE A;  2J8B A;  1IDH A;  1KBS A;  1CHV S;  2CRT A;  1QM7 A;  1FF4 A;  1CB9 A;  5DU1 A;  1IJC A;  1NTN A;  4IYE A;  1NOR A;  1W6B A;  3BT2 U;  1HC9 B;  5IMT D;  1LXH A;  1CDR A;  4ZQY A;  4UY2 C;  3EBX A;  1DRS A;  1BXP A;  1CXO A;  1IDG A;  1G6M A;  2NBT A;  1IDI A;  2CRS A;  2MFA A;  2HLR A;  1REW C;  3U73 U;  2H8U A;  2OFS A;  2GOO B;  1KS6 A;  2CCX A;  4EY8 B;  1COE A;  4OM5 A;  3VTS A;  1JE9 A;  2ABX A;  1HC9 A;  1LXG A;  2ERA A;  1HOY A;  2VLW A;  1YWH A;  3BT1 U;  2LCR A;  2PJY C;  2CDX A;  1ONJ A;  2MJ0 A;  1ERG A;  1CXN A;  1CDQ A;  1BTE A;  3EVS C;  1MAH F;  2H7Z A;  2HLQ A;  2UX2 A;  2JQP A;  1JBD A;  2L5S A;  4P7U A;  1CRE A;  1CCQ A;  1KXI A;  4BIK B;  1FFJ A;  1ABT A;  2QJA C;  5DO6 A;  2K3G A;  1NYU A;  4DO8 A;  6EBX A;  1JGK A;  1TFS A;  3KFD E;  2H7Z B;  2BTX A;  3HH7 A;  1LJZ A;  1V6P A;  2QJB C;  2CTX A;  2H5F A;  1CTX A;  2PJY B;  1QKD A;  2MJY A;  1H0J A;  1CVO A;  1FSC A;  1KTZ B;  1VB0 A;  1ERA A;  4AEA A;  1M9Z A;  2FD6 U;  3QB4 B;  1IDL A;  1RL5 A;  1IKC A;  3NH7 A;  1QKE A;  1HAJ A;  4FAO E;  3PLC A;  1L4W A;  3LAQ U;  1NTX A;  2N99 A;  1F8U B;  2H64 C;  3U74 U;  1IQ9 A;  1FSS B;  1KC4 A;  2X8B B;  1CDS A;  1UG4 A;  3ERA A;  1NXB A;  3NDS A;  2UWR A;  1S4Y A;  2BHI A;  1KU6 B;  2H62 D;  1MR6 A;  1KFH A;  2H62 C;  1CRF A;  1LSI A;  4FAO C;  2MUO A;  1IK8 A;  1XT3 A;  2QJ9 C;  4LFT A;  2QC1 A;  1NEA A;  1PLO A;  5IMY C;  2LA1 A;  1ZAD A;  1ES7 B;  1HAA A;  1TGX A;  4BDT B;  2I9B E;  1COD A;  4HQP F;  1TXA A;  2H64 B;  1KBT A;  4RUD A;  1TXB A;  1KL8 A;  5EBX A;  2MHY A;  3FEV A;  4XJJ A;  2MUP A;  1LX5 B;  3NEQ A;  1FAS A;  1NYS A;  2L03 A;  1RGJ A; 
#chains in the Genus database with same CATH topology
 4QTI U;  4KSN A;  1CDT A;  3KFD I;  1FRA A;  2MJ4 A;  5DZ5 A;  1F94 A;  1KBA A;  2GOO C;  4OM4 A;  1I02 A;  1B41 B;  2JVE A;  2J8B A;  1IDH A;  1KBS A;  1CHV S;  2CRT A;  1QM7 A;  1FF4 A;  1CB9 A;  5DU1 A;  1IJC A;  1NTN A;  4IYE A;  1NOR A;  1W6B A;  3BT2 U;  1HC9 B;  5IMT D;  1LXH A;  1CDR A;  4ZQY A;  4UY2 C;  3EBX A;  1DRS A;  1BXP A;  1CXO A;  1IDG A;  1G6M A;  2NBT A;  1IDI A;  2CRS A;  2MFA A;  2HLR A;  1REW C;  3U73 U;  2H8U A;  2OFS A;  2GOO B;  1KS6 A;  2CCX A;  4EY8 B;  1COE A;  4OM5 A;  3VTS A;  1JE9 A;  2ABX A;  1HC9 A;  1LXG A;  2ERA A;  1HOY A;  2VLW A;  1YWH A;  3BT1 U;  2LCR A;  2PJY C;  2CDX A;  1ONJ A;  2MJ0 A;  1ERG A;  1CXN A;  1CDQ A;  1BTE A;  3EVS C;  1MAH F;  2H7Z A;  2HLQ A;  2UX2 A;  2JQP A;  1JBD A;  2L5S A;  4P7U A;  1CRE A;  1CCQ A;  1KXI A;  4BIK B;  1FFJ A;  1ABT A;  2QJA C;  5DO6 A;  2K3G A;  1NYU A;  4DO8 A;  6EBX A;  1JGK A;  1TFS A;  3KFD E;  2H7Z B;  2BTX A;  3HH7 A;  1LJZ A;  1V6P A;  2QJB C;  2CTX A;  2H5F A;  1CTX A;  2PJY B;  1QKD A;  2MJY A;  1H0J A;  1CVO A;  1FSC A;  1KTZ B;  1VB0 A;  1ERA A;  4AEA A;  1M9Z A;  2FD6 U;  3QB4 B;  1IDL A;  1RL5 A;  1IKC A;  3NH7 A;  1QKE A;  1HAJ A;  4FAO E;  3PLC A;  1L4W A;  3LAQ U;  1NTX A;  2N99 A;  1F8U B;  2H64 C;  3U74 U;  1IQ9 A;  1FSS B;  1KC4 A;  2X8B B;  1CDS A;  1UG4 A;  3ERA A;  1NXB A;  3NDS A;  2UWR A;  1S4Y A;  2BHI A;  1KU6 B;  2H62 D;  1MR6 A;  1KFH A;  2H62 C;  1CRF A;  1LSI A;  4FAO C;  2MUO A;  1IK8 A;  1XT3 A;  2QJ9 C;  4LFT A;  2QC1 A;  1NEA A;  1PLO A;  5IMY C;  2LA1 A;  1ZAD A;  1ES7 B;  1HAA A;  1TGX A;  4BDT B;  2I9B E;  1COD A;  4HQP F;  1TXA A;  2H64 B;  1KBT A;  4RUD A;  1TXB A;  1KL8 A;  5EBX A;  2MHY A;  3FEV A;  4XJJ A;  2MUP A;  1LX5 B;  3NEQ A;  1FAS A;  1NYS A;  2L03 A;  1RGJ A; 
#chains in the Genus database with same CATH homology
 4QTI U;  4KSN A;  1CDT A;  3KFD I;  1FRA A;  2MJ4 A;  5DZ5 A;  1F94 A;  1KBA A;  2GOO C;  4OM4 A;  1I02 A;  1B41 B;  2JVE A;  2J8B A;  1IDH A;  1KBS A;  1CHV S;  2CRT A;  1QM7 A;  1FF4 A;  1CB9 A;  5DU1 A;  1IJC A;  1NTN A;  4IYE A;  1NOR A;  1W6B A;  3BT2 U;  1HC9 B;  5IMT D;  1LXH A;  1CDR A;  4ZQY A;  4UY2 C;  3EBX A;  1DRS A;  1BXP A;  1CXO A;  1IDG A;  1G6M A;  2NBT A;  1IDI A;  2CRS A;  2MFA A;  2HLR A;  1REW C;  3U73 U;  2H8U A;  2OFS A;  2GOO B;  1KS6 A;  2CCX A;  4EY8 B;  1COE A;  4OM5 A;  3VTS A;  1JE9 A;  2ABX A;  1HC9 A;  1LXG A;  2ERA A;  1HOY A;  2VLW A;  1YWH A;  3BT1 U;  2LCR A;  2PJY C;  2CDX A;  1ONJ A;  2MJ0 A;  1ERG A;  1CXN A;  1CDQ A;  1BTE A;  3EVS C;  1MAH F;  2H7Z A;  2HLQ A;  2UX2 A;  2JQP A;  1JBD A;  2L5S A;  4P7U A;  1CRE A;  1CCQ A;  1KXI A;  4BIK B;  1FFJ A;  1ABT A;  2QJA C;  5DO6 A;  2K3G A;  1NYU A;  4DO8 A;  6EBX A;  1JGK A;  1TFS A;  3KFD E;  2H7Z B;  2BTX A;  3HH7 A;  1LJZ A;  1V6P A;  2QJB C;  2CTX A;  2H5F A;  1CTX A;  2PJY B;  1QKD A;  2MJY A;  1H0J A;  1CVO A;  1FSC A;  1KTZ B;  1VB0 A;  1ERA A;  4AEA A;  1M9Z A;  2FD6 U;  3QB4 B;  1IDL A;  1RL5 A;  1IKC A;  3NH7 A;  1QKE A;  1HAJ A;  4FAO E;  3PLC A;  1L4W A;  3LAQ U;  1NTX A;  2N99 A;  1F8U B;  2H64 C;  3U74 U;  1IQ9 A;  1FSS B;  1KC4 A;  2X8B B;  1CDS A;  1UG4 A;  3ERA A;  1NXB A;  3NDS A;  2UWR A;  1S4Y A;  2BHI A;  1KU6 B;  2H62 D;  1MR6 A;  1KFH A;  2H62 C;  1CRF A;  1LSI A;  4FAO C;  2MUO A;  1IK8 A;  1XT3 A;  2QJ9 C;  4LFT A;  2QC1 A;  1NEA A;  1PLO A;  5IMY C;  2LA1 A;  1ZAD A;  1ES7 B;  1HAA A;  1TGX A;  4BDT B;  2I9B E;  1COD A;  4HQP F;  1TXA A;  2H64 B;  1KBT A;  4RUD A;  1TXB A;  1KL8 A;  5EBX A;  2MHY A;  3FEV A;  4XJJ A;  2MUP A;  1LX5 B;  3NEQ A;  1FAS A;  1NYS A;  2L03 A;  1RGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...