1NYSA

Crystal structure of activin a bound to the ecd of actriib p41
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
91
Chain Sequence
ETRECIYYNANWELERTNQSGLERCEGDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords activin receptor
publication title Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein/hormone/growth factor
total genus 15
structure length 91
sequence length 93
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1nysA00
1LSIA 4BDTB 1LXHA 1DRSA 2LCRA 2OFSA 1IDLA 1KBTA 4XJJA 3NH7A 1NTNA 1IDGA 2QC1A 1KU6B 1G6MA 1REWC 3ERAA 2K3GA 1CTXA 1IK8A 4IYEA 1LXGA 5DU1A 1KC4A 1CREA 3NEQA 1QM7A 3PLCA 1FASA 1RGJA 1TXBA 4OM5A 5DZ5A 1NEAA 2ABXA 1F94A 4FAOE 2HLRA 1CXOA 1KFHA 1L4WA 1FF4A 2QJAC 3U73U 2CRSA 2GOOC 2H62C 1NXBA 1ONJA 2GOOB 3NDSA 2MUPA 2MJ0A 2CRTA 5DO6A 1IKCA 2X8BB 2J8BA 2QJ9C 3LAQU 4FAOC 1BXPA 4P7UA 2I9BE 1KS6A 2MUOA 2MHYA 1BTEA 2CDXA 1FFJA 1JBDA 1LJZA 1KBAA 4ZQYA 1H0JA 2JVEA 2H7ZA 3HH7A 6EBXA 1IJCA 2NBTA 5IMTD 4RUDA 3U74U 1CXNA 2H64C 2MJ4A 1YWHA 1CHVS 1JE9A 1HC9A 1F8UB 2L03A 1NYUA 1XT3A 1KL8A 1ERAA 1TXAA 2LA1A 4DO8A 1IDHA 2VLWA 1NTXA 2FD6U 2BHIA 1HOYA 2CCXA 1S4YA 2PJYC 1QKEA 1ERGA 1TGXA 5IMYC 2PJYB 3EVSC 2ERAA 1CCQA 2UWRA 4QTIU 2H8UA 2H7ZB 1MR6A 1CRFA 1JGKA 4HQPF 4LFTA 2BTXA 1IQ9A 2CTXA 1QKDA 1V6PA 1M9ZA 2QJBC 4AEAA 1CDSA 1CB9A 1FRAA 2MFAA 1CDRA 1HC9B 1B41B 1VB0A 1ZADA 2JQPA 3EBXA 1W6BA 2H64B 3KFDI 1KBSA 2N99A 4OM4A 1RL5A 1CVOA 1COEA 3QB4B 1MAHF 1FSCA 1NORA 1IDIA 2HLQA 2H62D 1KTZB 3KFDE 1FSSB 4UY2C 1CDQA 1ABTA 1KXIA 1CDTA 1CODA 4EY8B 1NYSA 3VTSA 5EBXA 1HAJA 1UG4A 1PLOA 1TFSA 2H5FA 1HAAA 3FEVA 2MJYA 2L5SA 1I02A 4BIKB 3BT1U 1ES7B 3BT2U 2UX2A 1LX5B
chains in the Genus database with same CATH superfamily
1LSIA 4BDTB 1LXHA 1DRSA 2LCRA 2OFSA 1IDLA 1KBTA 4XJJA 3NH7A 1NTNA 1IDGA 2QC1A 1KU6B 1G6MA 1REWC 3ERAA 2K3GA 1CTXA 1IK8A 4IYEA 1LXGA 5DU1A 1KC4A 1CREA 3NEQA 1QM7A 3PLCA 1FASA 1RGJA 1TXBA 4OM5A 5DZ5A 1NEAA 2ABXA 1F94A 4FAOE 2HLRA 1CXOA 1KFHA 1L4WA 1FF4A 2QJAC 3U73U 2CRSA 2GOOC 2H62C 1NXBA 1ONJA 2GOOB 3NDSA 2MUPA 2MJ0A 2CRTA 5DO6A 1IKCA 2X8BB 2J8BA 2QJ9C 3LAQU 4FAOC 1BXPA 4P7UA 2I9BE 1KS6A 2MUOA 2MHYA 1BTEA 2CDXA 1FFJA 1JBDA 1LJZA 1KBAA 4ZQYA 1H0JA 2JVEA 2H7ZA 3HH7A 6EBXA 1IJCA 2NBTA 5IMTD 4RUDA 3U74U 1CXNA 2H64C 4KSNA 2MJ4A 1YWHA 1CHVS 1JE9A 1HC9A 1F8UB 2L03A 1NYUA 1XT3A 1KL8A 1ERAA 1TXAA 2LA1A 4DO8A 1IDHA 2VLWA 1NTXA 2FD6U 2BHIA 1HOYA 2CCXA 1S4YA 2PJYC 1QKEA 1ERGA 1TGXA 5IMYC 2PJYB 3EVSC 2ERAA 1CCQA 2UWRA 4QTIU 2H8UA 2H7ZB 1MR6A 1CRFA 1JGKA 4HQPF 4LFTA 2BTXA 1IQ9A 2CTXA 1QKDA 1V6PA 1M9ZA 2QJBC 4AEAA 1CDSA 1CB9A 1FRAA 2MFAA 1CDRA 1HC9B 1B41B 1VB0A 1ZADA 2JQPA 3EBXA 1W6BA 2H64B 3KFDI 1KBSA 2N99A 4OM4A 1RL5A 1CVOA 1COEA 3QB4B 1MAHF 1FSCA 1NORA 1IDIA 2HLQA 2H62D 1KTZB 3KFDE 1FSSB 4UY2C 1CDQA 1ABTA 1KXIA 1CDTA 1CODA 4EY8B 1NYSA 3VTSA 5EBXA 1HAJA 1UG4A 1PLOA 1TFSA 2H5FA 1HAAA 3FEVA 2MJYA 2L5SA 1I02A 4BIKB 3BT1U 1ES7B 3BT2U 2UX2A 1LX5B
chains in the Genus database with same CATH topology
1LSIA 4BDTB 1LXHA 1DRSA 2LCRA 2OFSA 1IDLA 1KBTA 4XJJA 3NH7A 1NTNA 1IDGA 2QC1A 1KU6B 1G6MA 1REWC 3ERAA 2K3GA 1CTXA 1IK8A 4IYEA 1LXGA 5DU1A 1KC4A 1CREA 3NEQA 1QM7A 3PLCA 1FASA 1RGJA 1TXBA 4OM5A 5DZ5A 1NEAA 2ABXA 1F94A 4FAOE 2HLRA 1CXOA 1KFHA 1L4WA 1FF4A 2QJAC 3U73U 2CRSA 2GOOC 2H62C 1NXBA 1ONJA 2GOOB 3NDSA 2MUPA 2MJ0A 2CRTA 5DO6A 1IKCA 2X8BB 2J8BA 2QJ9C 3LAQU 4FAOC 1BXPA 4P7UA 2I9BE 1KS6A 2MUOA 2MHYA 1BTEA 2CDXA 1FFJA 1JBDA 1LJZA 1KBAA 4ZQYA 1H0JA 2JVEA 2H7ZA 3HH7A 6EBXA 1IJCA 2NBTA 5IMTD 4RUDA 3U74U 1CXNA 2H64C 4KSNA 2MJ4A 1YWHA 1CHVS 1JE9A 1HC9A 1F8UB 2L03A 1NYUA 1XT3A 1KL8A 1ERAA 1TXAA 2LA1A 4DO8A 1IDHA 2VLWA 1NTXA 2FD6U 2BHIA 1HOYA 2CCXA 1S4YA 2PJYC 1QKEA 1ERGA 1TGXA 5IMYC 2PJYB 3EVSC 2ERAA 1CCQA 2UWRA 4QTIU 2H8UA 2H7ZB 1MR6A 1CRFA 1JGKA 4HQPF 4LFTA 2BTXA 1IQ9A 2CTXA 1QKDA 1V6PA 1M9ZA 2QJBC 4AEAA 1CDSA 1CB9A 1FRAA 2MFAA 1CDRA 1HC9B 1B41B 1VB0A 1ZADA 2JQPA 3EBXA 1W6BA 2H64B 3KFDI 1KBSA 2N99A 4OM4A 1RL5A 1CVOA 1COEA 3QB4B 1MAHF 1FSCA 1NORA 1IDIA 2HLQA 2H62D 1KTZB 3KFDE 1FSSB 4UY2C 1CDQA 1ABTA 1KXIA 1CDTA 1CODA 4EY8B 1NYSA 3VTSA 5EBXA 1HAJA 1UG4A 1PLOA 1TFSA 2H5FA 1HAAA 3FEVA 2MJYA 2L5SA 1I02A 4BIKB 3BT1U 1ES7B 3BT2U 2UX2A 1LX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSI A;  4BDT B;  1LXH A;  1DRS A;  2LCR A;  2OFS A;  1IDL A;  1KBT A;  4XJJ A;  3NH7 A;  1NTN A;  1IDG A;  2QC1 A;  1KU6 B;  1G6M A;  1REW C;  3ERA A;  2K3G A;  1CTX A;  1IK8 A;  4IYE A;  1LXG A;  5DU1 A;  1KC4 A;  1CRE A;  3NEQ A;  1QM7 A;  3PLC A;  1FAS A;  1RGJ A;  1TXB A;  4OM5 A;  5DZ5 A;  1NEA A;  2ABX A;  1F94 A;  4FAO E;  2HLR A;  1CXO A;  1KFH A;  1L4W A;  1FF4 A;  2QJA C;  3U73 U;  2CRS A;  2GOO C;  2H62 C;  1NXB A;  1ONJ A;  2GOO B;  3NDS A;  2MUP A;  2MJ0 A;  2CRT A;  5DO6 A;  1IKC A;  2X8B B;  2J8B A;  2QJ9 C;  3LAQ U;  4FAO C;  1BXP A;  4P7U A;  2I9B E;  1KS6 A;  2MUO A;  2MHY A;  1BTE A;  2CDX A;  1FFJ A;  1JBD A;  1LJZ A;  1KBA A;  4ZQY A;  1H0J A;  2JVE A;  2H7Z A;  3HH7 A;  6EBX A;  1IJC A;  2NBT A;  5IMT D;  4RUD A;  3U74 U;  1CXN A;  2H64 C;  2MJ4 A;  1YWH A;  1CHV S;  1JE9 A;  1HC9 A;  1F8U B;  2L03 A;  1NYU A;  1XT3 A;  1KL8 A;  1ERA A;  1TXA A;  2LA1 A;  4DO8 A;  1IDH A;  2VLW A;  1NTX A;  2FD6 U;  2BHI A;  1HOY A;  2CCX A;  1S4Y A;  2PJY C;  1QKE A;  1ERG A;  1TGX A;  5IMY C;  2PJY B;  3EVS C;  2ERA A;  1CCQ A;  2UWR A;  4QTI U;  2H8U A;  2H7Z B;  1MR6 A;  1CRF A;  1JGK A;  4HQP F;  4LFT A;  2BTX A;  1IQ9 A;  2CTX A;  1QKD A;  1V6P A;  1M9Z A;  2QJB C;  4AEA A;  1CDS A;  1CB9 A;  1FRA A;  2MFA A;  1CDR A;  1HC9 B;  1B41 B;  1VB0 A;  1ZAD A;  2JQP A;  3EBX A;  1W6B A;  2H64 B;  3KFD I;  1KBS A;  2N99 A;  4OM4 A;  1RL5 A;  1CVO A;  1COE A;  3QB4 B;  1MAH F;  1FSC A;  1NOR A;  1IDI A;  2HLQ A;  2H62 D;  1KTZ B;  3KFD E;  1FSS B;  4UY2 C;  1CDQ A;  1ABT A;  1KXI A;  1CDT A;  1COD A;  4EY8 B;  1NYS A;  3VTS A;  5EBX A;  1HAJ A;  1UG4 A;  1PLO A;  1TFS A;  2H5F A;  1HAA A;  3FEV A;  2MJY A;  2L5S A;  1I02 A;  4BIK B;  3BT1 U;  1ES7 B;  3BT2 U;  2UX2 A;  1LX5 B; 
#chains in the Genus database with same CATH topology
 1LSI A;  4BDT B;  1LXH A;  1DRS A;  2LCR A;  2OFS A;  1IDL A;  1KBT A;  4XJJ A;  3NH7 A;  1NTN A;  1IDG A;  2QC1 A;  1KU6 B;  1G6M A;  1REW C;  3ERA A;  2K3G A;  1CTX A;  1IK8 A;  4IYE A;  1LXG A;  5DU1 A;  1KC4 A;  1CRE A;  3NEQ A;  1QM7 A;  3PLC A;  1FAS A;  1RGJ A;  1TXB A;  4OM5 A;  5DZ5 A;  1NEA A;  2ABX A;  1F94 A;  4FAO E;  2HLR A;  1CXO A;  1KFH A;  1L4W A;  1FF4 A;  2QJA C;  3U73 U;  2CRS A;  2GOO C;  2H62 C;  1NXB A;  1ONJ A;  2GOO B;  3NDS A;  2MUP A;  2MJ0 A;  2CRT A;  5DO6 A;  1IKC A;  2X8B B;  2J8B A;  2QJ9 C;  3LAQ U;  4FAO C;  1BXP A;  4P7U A;  2I9B E;  1KS6 A;  2MUO A;  2MHY A;  1BTE A;  2CDX A;  1FFJ A;  1JBD A;  1LJZ A;  1KBA A;  4ZQY A;  1H0J A;  2JVE A;  2H7Z A;  3HH7 A;  6EBX A;  1IJC A;  2NBT A;  5IMT D;  4RUD A;  3U74 U;  1CXN A;  2H64 C;  4KSN A;  2MJ4 A;  1YWH A;  1CHV S;  1JE9 A;  1HC9 A;  1F8U B;  2L03 A;  1NYU A;  1XT3 A;  1KL8 A;  1ERA A;  1TXA A;  2LA1 A;  4DO8 A;  1IDH A;  2VLW A;  1NTX A;  2FD6 U;  2BHI A;  1HOY A;  2CCX A;  1S4Y A;  2PJY C;  1QKE A;  1ERG A;  1TGX A;  5IMY C;  2PJY B;  3EVS C;  2ERA A;  1CCQ A;  2UWR A;  4QTI U;  2H8U A;  2H7Z B;  1MR6 A;  1CRF A;  1JGK A;  4HQP F;  4LFT A;  2BTX A;  1IQ9 A;  2CTX A;  1QKD A;  1V6P A;  1M9Z A;  2QJB C;  4AEA A;  1CDS A;  1CB9 A;  1FRA A;  2MFA A;  1CDR A;  1HC9 B;  1B41 B;  1VB0 A;  1ZAD A;  2JQP A;  3EBX A;  1W6B A;  2H64 B;  3KFD I;  1KBS A;  2N99 A;  4OM4 A;  1RL5 A;  1CVO A;  1COE A;  3QB4 B;  1MAH F;  1FSC A;  1NOR A;  1IDI A;  2HLQ A;  2H62 D;  1KTZ B;  3KFD E;  1FSS B;  4UY2 C;  1CDQ A;  1ABT A;  1KXI A;  1CDT A;  1COD A;  4EY8 B;  1NYS A;  3VTS A;  5EBX A;  1HAJ A;  1UG4 A;  1PLO A;  1TFS A;  2H5F A;  1HAA A;  3FEV A;  2MJY A;  2L5S A;  1I02 A;  4BIK B;  3BT1 U;  1ES7 B;  3BT2 U;  2UX2 A;  1LX5 B; 
#chains in the Genus database with same CATH homology
 1LSI A;  4BDT B;  1LXH A;  1DRS A;  2LCR A;  2OFS A;  1IDL A;  1KBT A;  4XJJ A;  3NH7 A;  1NTN A;  1IDG A;  2QC1 A;  1KU6 B;  1G6M A;  1REW C;  3ERA A;  2K3G A;  1CTX A;  1IK8 A;  4IYE A;  1LXG A;  5DU1 A;  1KC4 A;  1CRE A;  3NEQ A;  1QM7 A;  3PLC A;  1FAS A;  1RGJ A;  1TXB A;  4OM5 A;  5DZ5 A;  1NEA A;  2ABX A;  1F94 A;  4FAO E;  2HLR A;  1CXO A;  1KFH A;  1L4W A;  1FF4 A;  2QJA C;  3U73 U;  2CRS A;  2GOO C;  2H62 C;  1NXB A;  1ONJ A;  2GOO B;  3NDS A;  2MUP A;  2MJ0 A;  2CRT A;  5DO6 A;  1IKC A;  2X8B B;  2J8B A;  2QJ9 C;  3LAQ U;  4FAO C;  1BXP A;  4P7U A;  2I9B E;  1KS6 A;  2MUO A;  2MHY A;  1BTE A;  2CDX A;  1FFJ A;  1JBD A;  1LJZ A;  1KBA A;  4ZQY A;  1H0J A;  2JVE A;  2H7Z A;  3HH7 A;  6EBX A;  1IJC A;  2NBT A;  5IMT D;  4RUD A;  3U74 U;  1CXN A;  2H64 C;  4KSN A;  2MJ4 A;  1YWH A;  1CHV S;  1JE9 A;  1HC9 A;  1F8U B;  2L03 A;  1NYU A;  1XT3 A;  1KL8 A;  1ERA A;  1TXA A;  2LA1 A;  4DO8 A;  1IDH A;  2VLW A;  1NTX A;  2FD6 U;  2BHI A;  1HOY A;  2CCX A;  1S4Y A;  2PJY C;  1QKE A;  1ERG A;  1TGX A;  5IMY C;  2PJY B;  3EVS C;  2ERA A;  1CCQ A;  2UWR A;  4QTI U;  2H8U A;  2H7Z B;  1MR6 A;  1CRF A;  1JGK A;  4HQP F;  4LFT A;  2BTX A;  1IQ9 A;  2CTX A;  1QKD A;  1V6P A;  1M9Z A;  2QJB C;  4AEA A;  1CDS A;  1CB9 A;  1FRA A;  2MFA A;  1CDR A;  1HC9 B;  1B41 B;  1VB0 A;  1ZAD A;  2JQP A;  3EBX A;  1W6B A;  2H64 B;  3KFD I;  1KBS A;  2N99 A;  4OM4 A;  1RL5 A;  1CVO A;  1COE A;  3QB4 B;  1MAH F;  1FSC A;  1NOR A;  1IDI A;  2HLQ A;  2H62 D;  1KTZ B;  3KFD E;  1FSS B;  4UY2 C;  1CDQ A;  1ABT A;  1KXI A;  1CDT A;  1COD A;  4EY8 B;  1NYS A;  3VTS A;  5EBX A;  1HAJ A;  1UG4 A;  1PLO A;  1TFS A;  2H5F A;  1HAA A;  3FEV A;  2MJY A;  2L5S A;  1I02 A;  4BIK B;  3BT1 U;  1ES7 B;  3BT2 U;  2UX2 A;  1LX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...