1NYSA

Crystal structure of activin a bound to the ecd of actriib p41
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
93
structure length
91
Chain Sequence
b'ETRECIYYNANWELERTNQSGLERCEGDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords activin receptor
publication title Structures of an ActRIIB:activin A complex reveal a novel binding mode for TGF-beta ligand:receptor interactions
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein/hormone/growth factor
total genus 15
structure length 91
sequence length 93
chains with identical sequence C
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-02-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1nysA00
3BT2U 1IDGA 2FD6U 1JGKA 1JE9A 1V6PA 2JQPA 1IDIA 2JVEA 1IKCA 1IDHA 2N99A 1ES7B 2UWRA 1NTXA 3EBXA 5IMTD 1TGXA 1ZADA 1CDQA 2LCRA 3PLCA 1BXPA 1KFHA 2LA1A 4EY8B 2MUPA 1FFJA 4DO8A 1CREA 2MJ4A 2UX2A 4AEAA 1HOYA 2MJ0A 3EVSC 6EBXA 1HAAA 2H7ZA 3NDSA 1MR6A 1LSIA 2CDXA 1IK8A 3KFDE 1S4YA 1CB9A 1H0JA 1PLOA 1VB0A 3NH7A 2H7ZB 1CDTA 1UG4A 1F8UB 1RL5A 1CXOA 2H8UA 3QB4B 1ERGA 2J8BA 1YWHA 4LFTA 1IQ9A 1KXIA 4P7UA 1LXGA 2CCXA 2CRSA 2HLQA 1CTXA 1LJZA 4ZQYA 2H62D 3VTSA 2H5FA 1NTNA 3U74U 4FAOE 2ABXA 4FAOC 1KBSA 1LXHA 1HC9A 1NYSA 2MUOA 1FSCA 1DRSA 2CRTA 4UY2C 5EBXA 2CTXA 1G6MA 1BTEA 2L5SA 1NXBA 4OM4A 1HC9B 1TFSA 2ERAA 2GOOC 1ONJA 4BIKB 1B41B 2H64C 5DO6A 1CVOA 2HLRA 1L4WA 1CXNA 1RGJA 2OFSA 1TXAA 1CHVS 1KBAA 1CODA 4RUDA 3LAQU 1TXBA 2GOOB 1QKDA 4XJJA 1KC4A 1JBDA 3BT1U 5DU1A 2H64B 2MFAA 2I9BE 1ERAA 1MAHF 1NORA 3ERAA 1IJCA 1CCQA 1IDLA 2QJ9C 2X8BB 2MHYA 1FF4A 4HQPF 4OM5A 1I02A 1ABTA 1F94A 1QM7A 1M9ZA 2NBTA 2VLWA 1CDRA 1KS6A 1NEAA 2PJYC 4BDTB 2L03A 1FSSB 3FEVA 1KU6B 1FASA 3HH7A 1QKEA 1NYUA 1XT3A 1CRFA 1LX5B 4IYEA 4QTIU 1HAJA 1CDSA 2BHIA 3KFDI 2QC1A 2MJYA 2PJYB 2H62C 1W6BA 1KTZB 2BTXA 3NEQA 3U73U 1COEA 1KBTA 1KL8A 2K3GA 2QJBC 1REWC 2QJAC 5DZ5A 5IMYC 1FRAA
chains in the Genus database with same CATH superfamily
3BT2U 1IDGA 2FD6U 1JGKA 1JE9A 1V6PA 2JQPA 1IDIA 2JVEA 1IKCA 1IDHA 2N99A 1ES7B 2UWRA 1NTXA 3EBXA 5IMTD 1TGXA 1ZADA 1CDQA 2LCRA 3PLCA 1BXPA 1KFHA 2LA1A 4EY8B 2MUPA 1FFJA 4DO8A 1CREA 2MJ4A 2UX2A 4AEAA 1HOYA 2MJ0A 3EVSC 6EBXA 1HAAA 2H7ZA 3NDSA 1MR6A 1LSIA 2CDXA 1IK8A 3KFDE 1S4YA 1CB9A 1H0JA 1PLOA 1VB0A 3NH7A 2H7ZB 1CDTA 1UG4A 1F8UB 1RL5A 1CXOA 2H8UA 3QB4B 1ERGA 2J8BA 1YWHA 4LFTA 1IQ9A 1KXIA 4P7UA 1LXGA 2CCXA 2CRSA 2HLQA 1CTXA 1LJZA 4ZQYA 2H62D 3VTSA 2H5FA 1NTNA 3U74U 4FAOE 2ABXA 4FAOC 1KBSA 1LXHA 1HC9A 1NYSA 2MUOA 1FSCA 1DRSA 2CRTA 4UY2C 5EBXA 2CTXA 1G6MA 1BTEA 2L5SA 1NXBA 4OM4A 1HC9B 1TFSA 2ERAA 2GOOC 1ONJA 4BIKB 1B41B 2H64C 5DO6A 1CVOA 2HLRA 1L4WA 1CXNA 1RGJA 2OFSA 1TXAA 1CHVS 1KBAA 1CODA 4RUDA 3LAQU 1TXBA 2GOOB 1QKDA 4XJJA 1KC4A 1JBDA 3BT1U 5DU1A 2H64B 2MFAA 2I9BE 1ERAA 1MAHF 1NORA 3ERAA 4KSNA 1IJCA 1CCQA 1IDLA 2QJ9C 2X8BB 2MHYA 1FF4A 4HQPF 4OM5A 1I02A 1ABTA 1F94A 1QM7A 1M9ZA 2NBTA 2VLWA 1CDRA 1KS6A 1NEAA 2PJYC 4BDTB 2L03A 1FSSB 3FEVA 1KU6B 1FASA 3HH7A 1QKEA 1NYUA 1XT3A 1CRFA 1LX5B 4IYEA 4QTIU 1HAJA 1CDSA 2BHIA 3KFDI 2QC1A 2MJYA 2PJYB 2H62C 1W6BA 1KTZB 2BTXA 3NEQA 3U73U 1COEA 1KBTA 1KL8A 2K3GA 2QJBC 1REWC 2QJAC 5DZ5A 5IMYC 1FRAA
chains in the Genus database with same CATH topology
3BT2U 1IDGA 2FD6U 1JGKA 1JE9A 1V6PA 2JQPA 1IDIA 2JVEA 1IKCA 1IDHA 2N99A 1ES7B 2UWRA 1NTXA 3EBXA 5IMTD 1TGXA 1ZADA 1CDQA 2LCRA 3PLCA 1BXPA 1KFHA 2LA1A 4EY8B 2MUPA 1FFJA 4DO8A 1CREA 2MJ4A 2UX2A 4AEAA 1HOYA 2MJ0A 3EVSC 6EBXA 1HAAA 2H7ZA 3NDSA 1MR6A 1LSIA 2CDXA 1IK8A 3KFDE 1S4YA 1CB9A 1H0JA 1PLOA 1VB0A 3NH7A 2H7ZB 1CDTA 1UG4A 1F8UB 1RL5A 1CXOA 2H8UA 3QB4B 1ERGA 2J8BA 1YWHA 4LFTA 1IQ9A 1KXIA 4P7UA 1LXGA 2CCXA 2CRSA 2HLQA 1CTXA 1LJZA 4ZQYA 2H62D 3VTSA 2H5FA 1NTNA 3U74U 4FAOE 2ABXA 4FAOC 1KBSA 1LXHA 1HC9A 1NYSA 2MUOA 1FSCA 1DRSA 2CRTA 4UY2C 5EBXA 2CTXA 1G6MA 1BTEA 2L5SA 1NXBA 4OM4A 1HC9B 1TFSA 2ERAA 2GOOC 1ONJA 4BIKB 1B41B 2H64C 5DO6A 1CVOA 2HLRA 1L4WA 1CXNA 1RGJA 2OFSA 1TXAA 1CHVS 1KBAA 1CODA 4RUDA 3LAQU 1TXBA 2GOOB 1QKDA 4XJJA 1KC4A 1JBDA 3BT1U 5DU1A 2H64B 2MFAA 2I9BE 1ERAA 1MAHF 1NORA 3ERAA 4KSNA 1IJCA 1CCQA 1IDLA 2QJ9C 2X8BB 2MHYA 1FF4A 4HQPF 4OM5A 1I02A 1ABTA 1F94A 1QM7A 1M9ZA 2NBTA 2VLWA 1CDRA 1KS6A 1NEAA 2PJYC 4BDTB 2L03A 1FSSB 3FEVA 1KU6B 1FASA 3HH7A 1QKEA 1NYUA 1XT3A 1CRFA 1LX5B 4IYEA 4QTIU 1HAJA 1CDSA 2BHIA 3KFDI 2QC1A 2MJYA 2PJYB 2H62C 1W6BA 1KTZB 2BTXA 3NEQA 3U73U 1COEA 1KBTA 1KL8A 2K3GA 2QJBC 1REWC 2QJAC 5DZ5A 5IMYC 1FRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT2 U;  1IDG A;  2FD6 U;  1JGK A;  1JE9 A;  1V6P A;  2JQP A;  1IDI A;  2JVE A;  1IKC A;  1IDH A;  2N99 A;  1ES7 B;  2UWR A;  1NTX A;  3EBX A;  5IMT D;  1TGX A;  1ZAD A;  1CDQ A;  2LCR A;  3PLC A;  1BXP A;  1KFH A;  2LA1 A;  4EY8 B;  2MUP A;  1FFJ A;  4DO8 A;  1CRE A;  2MJ4 A;  2UX2 A;  4AEA A;  1HOY A;  2MJ0 A;  3EVS C;  6EBX A;  1HAA A;  2H7Z A;  3NDS A;  1MR6 A;  1LSI A;  2CDX A;  1IK8 A;  3KFD E;  1S4Y A;  1CB9 A;  1H0J A;  1PLO A;  1VB0 A;  3NH7 A;  2H7Z B;  1CDT A;  1UG4 A;  1F8U B;  1RL5 A;  1CXO A;  2H8U A;  3QB4 B;  1ERG A;  2J8B A;  1YWH A;  4LFT A;  1IQ9 A;  1KXI A;  4P7U A;  1LXG A;  2CCX A;  2CRS A;  2HLQ A;  1CTX A;  1LJZ A;  4ZQY A;  2H62 D;  3VTS A;  2H5F A;  1NTN A;  3U74 U;  4FAO E;  2ABX A;  4FAO C;  1KBS A;  1LXH A;  1HC9 A;  1NYS A;  2MUO A;  1FSC A;  1DRS A;  2CRT A;  4UY2 C;  5EBX A;  2CTX A;  1G6M A;  1BTE A;  2L5S A;  1NXB A;  4OM4 A;  1HC9 B;  1TFS A;  2ERA A;  2GOO C;  1ONJ A;  4BIK B;  1B41 B;  2H64 C;  5DO6 A;  1CVO A;  2HLR A;  1L4W A;  1CXN A;  1RGJ A;  2OFS A;  1TXA A;  1CHV S;  1KBA A;  1COD A;  4RUD A;  3LAQ U;  1TXB A;  2GOO B;  1QKD A;  4XJJ A;  1KC4 A;  1JBD A;  3BT1 U;  5DU1 A;  2H64 B;  2MFA A;  2I9B E;  1ERA A;  1MAH F;  1NOR A;  3ERA A;  1IJC A;  1CCQ A;  1IDL A;  2QJ9 C;  2X8B B;  2MHY A;  1FF4 A;  4HQP F;  4OM5 A;  1I02 A;  1ABT A;  1F94 A;  1QM7 A;  1M9Z A;  2NBT A;  2VLW A;  1CDR A;  1KS6 A;  1NEA A;  2PJY C;  4BDT B;  2L03 A;  1FSS B;  3FEV A;  1KU6 B;  1FAS A;  3HH7 A;  1QKE A;  1NYU A;  1XT3 A;  1CRF A;  1LX5 B;  4IYE A;  4QTI U;  1HAJ A;  1CDS A;  2BHI A;  3KFD I;  2QC1 A;  2MJY A;  2PJY B;  2H62 C;  1W6B A;  1KTZ B;  2BTX A;  3NEQ A;  3U73 U;  1COE A;  1KBT A;  1KL8 A;  2K3G A;  2QJB C;  1REW C;  2QJA C;  5DZ5 A;  5IMY C;  1FRA A; 
#chains in the Genus database with same CATH topology
 3BT2 U;  1IDG A;  2FD6 U;  1JGK A;  1JE9 A;  1V6P A;  2JQP A;  1IDI A;  2JVE A;  1IKC A;  1IDH A;  2N99 A;  1ES7 B;  2UWR A;  1NTX A;  3EBX A;  5IMT D;  1TGX A;  1ZAD A;  1CDQ A;  2LCR A;  3PLC A;  1BXP A;  1KFH A;  2LA1 A;  4EY8 B;  2MUP A;  1FFJ A;  4DO8 A;  1CRE A;  2MJ4 A;  2UX2 A;  4AEA A;  1HOY A;  2MJ0 A;  3EVS C;  6EBX A;  1HAA A;  2H7Z A;  3NDS A;  1MR6 A;  1LSI A;  2CDX A;  1IK8 A;  3KFD E;  1S4Y A;  1CB9 A;  1H0J A;  1PLO A;  1VB0 A;  3NH7 A;  2H7Z B;  1CDT A;  1UG4 A;  1F8U B;  1RL5 A;  1CXO A;  2H8U A;  3QB4 B;  1ERG A;  2J8B A;  1YWH A;  4LFT A;  1IQ9 A;  1KXI A;  4P7U A;  1LXG A;  2CCX A;  2CRS A;  2HLQ A;  1CTX A;  1LJZ A;  4ZQY A;  2H62 D;  3VTS A;  2H5F A;  1NTN A;  3U74 U;  4FAO E;  2ABX A;  4FAO C;  1KBS A;  1LXH A;  1HC9 A;  1NYS A;  2MUO A;  1FSC A;  1DRS A;  2CRT A;  4UY2 C;  5EBX A;  2CTX A;  1G6M A;  1BTE A;  2L5S A;  1NXB A;  4OM4 A;  1HC9 B;  1TFS A;  2ERA A;  2GOO C;  1ONJ A;  4BIK B;  1B41 B;  2H64 C;  5DO6 A;  1CVO A;  2HLR A;  1L4W A;  1CXN A;  1RGJ A;  2OFS A;  1TXA A;  1CHV S;  1KBA A;  1COD A;  4RUD A;  3LAQ U;  1TXB A;  2GOO B;  1QKD A;  4XJJ A;  1KC4 A;  1JBD A;  3BT1 U;  5DU1 A;  2H64 B;  2MFA A;  2I9B E;  1ERA A;  1MAH F;  1NOR A;  3ERA A;  4KSN A;  1IJC A;  1CCQ A;  1IDL A;  2QJ9 C;  2X8B B;  2MHY A;  1FF4 A;  4HQP F;  4OM5 A;  1I02 A;  1ABT A;  1F94 A;  1QM7 A;  1M9Z A;  2NBT A;  2VLW A;  1CDR A;  1KS6 A;  1NEA A;  2PJY C;  4BDT B;  2L03 A;  1FSS B;  3FEV A;  1KU6 B;  1FAS A;  3HH7 A;  1QKE A;  1NYU A;  1XT3 A;  1CRF A;  1LX5 B;  4IYE A;  4QTI U;  1HAJ A;  1CDS A;  2BHI A;  3KFD I;  2QC1 A;  2MJY A;  2PJY B;  2H62 C;  1W6B A;  1KTZ B;  2BTX A;  3NEQ A;  3U73 U;  1COE A;  1KBT A;  1KL8 A;  2K3G A;  2QJB C;  1REW C;  2QJA C;  5DZ5 A;  5IMY C;  1FRA A; 
#chains in the Genus database with same CATH homology
 3BT2 U;  1IDG A;  2FD6 U;  1JGK A;  1JE9 A;  1V6P A;  2JQP A;  1IDI A;  2JVE A;  1IKC A;  1IDH A;  2N99 A;  1ES7 B;  2UWR A;  1NTX A;  3EBX A;  5IMT D;  1TGX A;  1ZAD A;  1CDQ A;  2LCR A;  3PLC A;  1BXP A;  1KFH A;  2LA1 A;  4EY8 B;  2MUP A;  1FFJ A;  4DO8 A;  1CRE A;  2MJ4 A;  2UX2 A;  4AEA A;  1HOY A;  2MJ0 A;  3EVS C;  6EBX A;  1HAA A;  2H7Z A;  3NDS A;  1MR6 A;  1LSI A;  2CDX A;  1IK8 A;  3KFD E;  1S4Y A;  1CB9 A;  1H0J A;  1PLO A;  1VB0 A;  3NH7 A;  2H7Z B;  1CDT A;  1UG4 A;  1F8U B;  1RL5 A;  1CXO A;  2H8U A;  3QB4 B;  1ERG A;  2J8B A;  1YWH A;  4LFT A;  1IQ9 A;  1KXI A;  4P7U A;  1LXG A;  2CCX A;  2CRS A;  2HLQ A;  1CTX A;  1LJZ A;  4ZQY A;  2H62 D;  3VTS A;  2H5F A;  1NTN A;  3U74 U;  4FAO E;  2ABX A;  4FAO C;  1KBS A;  1LXH A;  1HC9 A;  1NYS A;  2MUO A;  1FSC A;  1DRS A;  2CRT A;  4UY2 C;  5EBX A;  2CTX A;  1G6M A;  1BTE A;  2L5S A;  1NXB A;  4OM4 A;  1HC9 B;  1TFS A;  2ERA A;  2GOO C;  1ONJ A;  4BIK B;  1B41 B;  2H64 C;  5DO6 A;  1CVO A;  2HLR A;  1L4W A;  1CXN A;  1RGJ A;  2OFS A;  1TXA A;  1CHV S;  1KBA A;  1COD A;  4RUD A;  3LAQ U;  1TXB A;  2GOO B;  1QKD A;  4XJJ A;  1KC4 A;  1JBD A;  3BT1 U;  5DU1 A;  2H64 B;  2MFA A;  2I9B E;  1ERA A;  1MAH F;  1NOR A;  3ERA A;  4KSN A;  1IJC A;  1CCQ A;  1IDL A;  2QJ9 C;  2X8B B;  2MHY A;  1FF4 A;  4HQP F;  4OM5 A;  1I02 A;  1ABT A;  1F94 A;  1QM7 A;  1M9Z A;  2NBT A;  2VLW A;  1CDR A;  1KS6 A;  1NEA A;  2PJY C;  4BDT B;  2L03 A;  1FSS B;  3FEV A;  1KU6 B;  1FAS A;  3HH7 A;  1QKE A;  1NYU A;  1XT3 A;  1CRF A;  1LX5 B;  4IYE A;  4QTI U;  1HAJ A;  1CDS A;  2BHI A;  3KFD I;  2QC1 A;  2MJY A;  2PJY B;  2H62 C;  1W6B A;  1KTZ B;  2BTX A;  3NEQ A;  3U73 U;  1COE A;  1KBT A;  1KL8 A;  2K3G A;  2QJB C;  1REW C;  2QJA C;  5DZ5 A;  5IMY C;  1FRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...