4FAOE

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
molecule keywords Growth/differentiation factor 2
total genus 19
structure length 91
sequence length 91
chains with identical sequence F, K, L, Q, R, W, X, e, f, k, l
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4faoE00
1JGKA 4LFTA 1KL8A 5IMTD 2CDXA 1LJZA 3KFDE 4OM4A 1ERAA 1ONJA 1NYSA 2JQPA 1KS6A 1NEAA 1IDGA 2H64C 5DO6A 1CHVS 4ZQYA 1RGJA 5IMYC 1JE9A 1IDLA 2HLQA 1KBAA 1MAHF 1CDTA 1KC4A 1DRSA 1KTZB 1CDSA 1LX5B 2J8BA 3PLCA 1CB9A 4UY2C 1COEA 1XT3A 1L4WA 1CVOA 4XJJA 1QKEA 1TFSA 4RUDA 1IDIA 2K3GA 2X8BB 4QTIU 1FFJA 3EVSC 1H0JA 2MHYA 1NXBA 3U74U 1F8UB 2MJYA 2PJYC 1IDHA 1I02A 5EBXA 1NORA 1LXGA 2N99A 1CCQA 1BXPA 1BTEA 1CDQA 1W6BA 3NEQA 4P7UA 2H7ZA 1G6MA 4AEAA 1RL5A 2L03A 1IK8A 2I9BE 2LCRA 2HLRA 3FEVA 1HAJA 4IYEA 4HQPF 1TGXA 1HC9A 3NH7A 1CREA 3BT2U 1HC9B 1CXOA 3VTSA 2CTXA 1NTNA 1FRAA 2MJ0A 2MUOA 4BIKB 4FAOC 1F94A 2H7ZB 2H62D 2NBTA 2QJ9C 1CTXA 1ERGA 2CRSA 2BHIA 1VB0A 3BT1U 2UWRA 1LSIA 2MFAA 2OFSA 1FASA 4DO8A 1CDRA 3NDSA 4FAOE 6EBXA 1CRFA 1TXAA 2ERAA 3KFDI 1YWHA 2CRTA 1QKDA 1IKCA 1KFHA 1LXHA 1CODA 2H64B 1FSCA 2ABXA 1B41B 4BDTB 2MJ4A 2L5SA 1PLOA 2UX2A 1HOYA 1ZADA 1NYUA 2BTXA 2QJAC 2QJBC 3QB4B 1FF4A 2CCXA 1M9ZA 1KXIA 1ES7B 1IQ9A 1KBTA 1QM7A 2GOOC 2LA1A 1REWC 1S4YA 3HH7A 1V6PA 2H62C 2QC1A 1TXBA 1CXNA 2FD6U 1HAAA 1KBSA 4EY8B 1IJCA 3ERAA 2JVEA 3LAQU 1UG4A 2GOOB 2PJYB 3U73U 3EBXA 2H5FA 1MR6A 5DU1A 1NTXA 2H8UA 4OM5A 5DZ5A 1ABTA 2VLWA 1FSSB 1JBDA 1KU6B 2MUPA
chains in the Genus database with same CATH superfamily
1JGKA 4LFTA 1KL8A 5IMTD 2CDXA 1LJZA 3KFDE 4OM4A 1ERAA 1ONJA 1NYSA 2JQPA 1KS6A 1NEAA 1IDGA 2H64C 5DO6A 1CHVS 4ZQYA 1RGJA 5IMYC 1JE9A 1IDLA 2HLQA 1KBAA 1MAHF 1CDTA 1KC4A 1DRSA 1KTZB 1CDSA 1LX5B 2J8BA 3PLCA 1CB9A 4UY2C 1COEA 1XT3A 1L4WA 1CVOA 4XJJA 1QKEA 1TFSA 4RUDA 1IDIA 2K3GA 2X8BB 4QTIU 1FFJA 3EVSC 1H0JA 2MHYA 1NXBA 3U74U 1F8UB 2MJYA 2PJYC 1IDHA 1I02A 5EBXA 1NORA 1LXGA 2N99A 1CCQA 1BXPA 1BTEA 1CDQA 1W6BA 3NEQA 4P7UA 2H7ZA 1G6MA 4AEAA 1RL5A 2L03A 1IK8A 2I9BE 2LCRA 2HLRA 3FEVA 1HAJA 4IYEA 4HQPF 1TGXA 1HC9A 3NH7A 1CREA 3BT2U 1HC9B 1CXOA 3VTSA 2CTXA 1NTNA 1FRAA 2MJ0A 2MUOA 4BIKB 4FAOC 1F94A 2H7ZB 2H62D 2NBTA 2QJ9C 1CTXA 1ERGA 2CRSA 2BHIA 1VB0A 3BT1U 2UWRA 1LSIA 2MFAA 2OFSA 1FASA 4DO8A 1CDRA 3NDSA 4FAOE 6EBXA 1CRFA 1TXAA 2ERAA 3KFDI 1YWHA 2CRTA 1QKDA 1IKCA 1KFHA 1LXHA 1CODA 2H64B 1FSCA 2ABXA 1B41B 4BDTB 2MJ4A 2L5SA 1PLOA 2UX2A 1HOYA 1ZADA 1NYUA 2BTXA 2QJAC 2QJBC 3QB4B 1FF4A 2CCXA 1M9ZA 1KXIA 1ES7B 1IQ9A 1KBTA 1QM7A 2GOOC 2LA1A 1REWC 1S4YA 3HH7A 1V6PA 2H62C 2QC1A 1TXBA 1CXNA 2FD6U 1HAAA 1KBSA 4KSNA 4EY8B 1IJCA 3ERAA 2JVEA 3LAQU 1UG4A 2GOOB 2PJYB 3U73U 3EBXA 2H5FA 1MR6A 5DU1A 1NTXA 2H8UA 4OM5A 5DZ5A 1ABTA 2VLWA 1FSSB 1JBDA 1KU6B 2MUPA
chains in the Genus database with same CATH topology
1JGKA 4LFTA 1KL8A 5IMTD 2CDXA 1LJZA 3KFDE 4OM4A 1ERAA 1ONJA 1NYSA 2JQPA 1KS6A 1NEAA 1IDGA 2H64C 5DO6A 1CHVS 4ZQYA 1RGJA 5IMYC 1JE9A 1IDLA 2HLQA 1KBAA 1MAHF 1CDTA 1KC4A 1DRSA 1KTZB 1CDSA 1LX5B 2J8BA 3PLCA 1CB9A 4UY2C 1COEA 1XT3A 1L4WA 1CVOA 4XJJA 1QKEA 1TFSA 4RUDA 1IDIA 2K3GA 2X8BB 4QTIU 1FFJA 3EVSC 1H0JA 2MHYA 1NXBA 3U74U 1F8UB 2MJYA 2PJYC 1IDHA 1I02A 5EBXA 1NORA 1LXGA 2N99A 1CCQA 1BXPA 1BTEA 1CDQA 1W6BA 3NEQA 4P7UA 2H7ZA 1G6MA 4AEAA 1RL5A 2L03A 1IK8A 2I9BE 2LCRA 2HLRA 3FEVA 1HAJA 4IYEA 4HQPF 1TGXA 1HC9A 3NH7A 1CREA 3BT2U 1HC9B 1CXOA 3VTSA 2CTXA 1NTNA 1FRAA 2MJ0A 2MUOA 4BIKB 4FAOC 1F94A 2H7ZB 2H62D 2NBTA 2QJ9C 1CTXA 1ERGA 2CRSA 2BHIA 1VB0A 3BT1U 2UWRA 1LSIA 2MFAA 2OFSA 1FASA 4DO8A 1CDRA 3NDSA 4FAOE 6EBXA 1CRFA 1TXAA 2ERAA 3KFDI 1YWHA 2CRTA 1QKDA 1IKCA 1KFHA 1LXHA 1CODA 2H64B 1FSCA 2ABXA 1B41B 4BDTB 2MJ4A 2L5SA 1PLOA 2UX2A 1HOYA 1ZADA 1NYUA 2BTXA 2QJAC 2QJBC 3QB4B 1FF4A 2CCXA 1M9ZA 1KXIA 1ES7B 1IQ9A 1KBTA 1QM7A 2GOOC 2LA1A 1REWC 1S4YA 3HH7A 1V6PA 2H62C 2QC1A 1TXBA 1CXNA 2FD6U 1HAAA 1KBSA 4KSNA 4EY8B 1IJCA 3ERAA 2JVEA 3LAQU 1UG4A 2GOOB 2PJYB 3U73U 3EBXA 2H5FA 1MR6A 5DU1A 1NTXA 2H8UA 4OM5A 5DZ5A 1ABTA 2VLWA 1FSSB 1JBDA 1KU6B 2MUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGK A;  4LFT A;  1KL8 A;  5IMT D;  2CDX A;  1LJZ A;  3KFD E;  4OM4 A;  1ERA A;  1ONJ A;  1NYS A;  2JQP A;  1KS6 A;  1NEA A;  1IDG A;  2H64 C;  5DO6 A;  1CHV S;  4ZQY A;  1RGJ A;  5IMY C;  1JE9 A;  1IDL A;  2HLQ A;  1KBA A;  1MAH F;  1CDT A;  1KC4 A;  1DRS A;  1KTZ B;  1CDS A;  1LX5 B;  2J8B A;  3PLC A;  1CB9 A;  4UY2 C;  1COE A;  1XT3 A;  1L4W A;  1CVO A;  4XJJ A;  1QKE A;  1TFS A;  4RUD A;  1IDI A;  2K3G A;  2X8B B;  4QTI U;  1FFJ A;  3EVS C;  1H0J A;  2MHY A;  1NXB A;  3U74 U;  1F8U B;  2MJY A;  2PJY C;  1IDH A;  1I02 A;  5EBX A;  1NOR A;  1LXG A;  2N99 A;  1CCQ A;  1BXP A;  1BTE A;  1CDQ A;  1W6B A;  3NEQ A;  4P7U A;  2H7Z A;  1G6M A;  4AEA A;  1RL5 A;  2L03 A;  1IK8 A;  2I9B E;  2LCR A;  2HLR A;  3FEV A;  1HAJ A;  4IYE A;  4HQP F;  1TGX A;  1HC9 A;  3NH7 A;  1CRE A;  3BT2 U;  1HC9 B;  1CXO A;  3VTS A;  2CTX A;  1NTN A;  1FRA A;  2MJ0 A;  2MUO A;  4BIK B;  4FAO C;  1F94 A;  2H7Z B;  2H62 D;  2NBT A;  2QJ9 C;  1CTX A;  1ERG A;  2CRS A;  2BHI A;  1VB0 A;  3BT1 U;  2UWR A;  1LSI A;  2MFA A;  2OFS A;  1FAS A;  4DO8 A;  1CDR A;  3NDS A;  4FAO E;  6EBX A;  1CRF A;  1TXA A;  2ERA A;  3KFD I;  1YWH A;  2CRT A;  1QKD A;  1IKC A;  1KFH A;  1LXH A;  1COD A;  2H64 B;  1FSC A;  2ABX A;  1B41 B;  4BDT B;  2MJ4 A;  2L5S A;  1PLO A;  2UX2 A;  1HOY A;  1ZAD A;  1NYU A;  2BTX A;  2QJA C;  2QJB C;  3QB4 B;  1FF4 A;  2CCX A;  1M9Z A;  1KXI A;  1ES7 B;  1IQ9 A;  1KBT A;  1QM7 A;  2GOO C;  2LA1 A;  1REW C;  1S4Y A;  3HH7 A;  1V6P A;  2H62 C;  2QC1 A;  1TXB A;  1CXN A;  2FD6 U;  1HAA A;  1KBS A;  4EY8 B;  1IJC A;  3ERA A;  2JVE A;  3LAQ U;  1UG4 A;  2GOO B;  2PJY B;  3U73 U;  3EBX A;  2H5F A;  1MR6 A;  5DU1 A;  1NTX A;  2H8U A;  4OM5 A;  5DZ5 A;  1ABT A;  2VLW A;  1FSS B;  1JBD A;  1KU6 B;  2MUP A; 
#chains in the Genus database with same CATH topology
 1JGK A;  4LFT A;  1KL8 A;  5IMT D;  2CDX A;  1LJZ A;  3KFD E;  4OM4 A;  1ERA A;  1ONJ A;  1NYS A;  2JQP A;  1KS6 A;  1NEA A;  1IDG A;  2H64 C;  5DO6 A;  1CHV S;  4ZQY A;  1RGJ A;  5IMY C;  1JE9 A;  1IDL A;  2HLQ A;  1KBA A;  1MAH F;  1CDT A;  1KC4 A;  1DRS A;  1KTZ B;  1CDS A;  1LX5 B;  2J8B A;  3PLC A;  1CB9 A;  4UY2 C;  1COE A;  1XT3 A;  1L4W A;  1CVO A;  4XJJ A;  1QKE A;  1TFS A;  4RUD A;  1IDI A;  2K3G A;  2X8B B;  4QTI U;  1FFJ A;  3EVS C;  1H0J A;  2MHY A;  1NXB A;  3U74 U;  1F8U B;  2MJY A;  2PJY C;  1IDH A;  1I02 A;  5EBX A;  1NOR A;  1LXG A;  2N99 A;  1CCQ A;  1BXP A;  1BTE A;  1CDQ A;  1W6B A;  3NEQ A;  4P7U A;  2H7Z A;  1G6M A;  4AEA A;  1RL5 A;  2L03 A;  1IK8 A;  2I9B E;  2LCR A;  2HLR A;  3FEV A;  1HAJ A;  4IYE A;  4HQP F;  1TGX A;  1HC9 A;  3NH7 A;  1CRE A;  3BT2 U;  1HC9 B;  1CXO A;  3VTS A;  2CTX A;  1NTN A;  1FRA A;  2MJ0 A;  2MUO A;  4BIK B;  4FAO C;  1F94 A;  2H7Z B;  2H62 D;  2NBT A;  2QJ9 C;  1CTX A;  1ERG A;  2CRS A;  2BHI A;  1VB0 A;  3BT1 U;  2UWR A;  1LSI A;  2MFA A;  2OFS A;  1FAS A;  4DO8 A;  1CDR A;  3NDS A;  4FAO E;  6EBX A;  1CRF A;  1TXA A;  2ERA A;  3KFD I;  1YWH A;  2CRT A;  1QKD A;  1IKC A;  1KFH A;  1LXH A;  1COD A;  2H64 B;  1FSC A;  2ABX A;  1B41 B;  4BDT B;  2MJ4 A;  2L5S A;  1PLO A;  2UX2 A;  1HOY A;  1ZAD A;  1NYU A;  2BTX A;  2QJA C;  2QJB C;  3QB4 B;  1FF4 A;  2CCX A;  1M9Z A;  1KXI A;  1ES7 B;  1IQ9 A;  1KBT A;  1QM7 A;  2GOO C;  2LA1 A;  1REW C;  1S4Y A;  3HH7 A;  1V6P A;  2H62 C;  2QC1 A;  1TXB A;  1CXN A;  2FD6 U;  1HAA A;  1KBS A;  4KSN A;  4EY8 B;  1IJC A;  3ERA A;  2JVE A;  3LAQ U;  1UG4 A;  2GOO B;  2PJY B;  3U73 U;  3EBX A;  2H5F A;  1MR6 A;  5DU1 A;  1NTX A;  2H8U A;  4OM5 A;  5DZ5 A;  1ABT A;  2VLW A;  1FSS B;  1JBD A;  1KU6 B;  2MUP A; 
#chains in the Genus database with same CATH homology
 1JGK A;  4LFT A;  1KL8 A;  5IMT D;  2CDX A;  1LJZ A;  3KFD E;  4OM4 A;  1ERA A;  1ONJ A;  1NYS A;  2JQP A;  1KS6 A;  1NEA A;  1IDG A;  2H64 C;  5DO6 A;  1CHV S;  4ZQY A;  1RGJ A;  5IMY C;  1JE9 A;  1IDL A;  2HLQ A;  1KBA A;  1MAH F;  1CDT A;  1KC4 A;  1DRS A;  1KTZ B;  1CDS A;  1LX5 B;  2J8B A;  3PLC A;  1CB9 A;  4UY2 C;  1COE A;  1XT3 A;  1L4W A;  1CVO A;  4XJJ A;  1QKE A;  1TFS A;  4RUD A;  1IDI A;  2K3G A;  2X8B B;  4QTI U;  1FFJ A;  3EVS C;  1H0J A;  2MHY A;  1NXB A;  3U74 U;  1F8U B;  2MJY A;  2PJY C;  1IDH A;  1I02 A;  5EBX A;  1NOR A;  1LXG A;  2N99 A;  1CCQ A;  1BXP A;  1BTE A;  1CDQ A;  1W6B A;  3NEQ A;  4P7U A;  2H7Z A;  1G6M A;  4AEA A;  1RL5 A;  2L03 A;  1IK8 A;  2I9B E;  2LCR A;  2HLR A;  3FEV A;  1HAJ A;  4IYE A;  4HQP F;  1TGX A;  1HC9 A;  3NH7 A;  1CRE A;  3BT2 U;  1HC9 B;  1CXO A;  3VTS A;  2CTX A;  1NTN A;  1FRA A;  2MJ0 A;  2MUO A;  4BIK B;  4FAO C;  1F94 A;  2H7Z B;  2H62 D;  2NBT A;  2QJ9 C;  1CTX A;  1ERG A;  2CRS A;  2BHI A;  1VB0 A;  3BT1 U;  2UWR A;  1LSI A;  2MFA A;  2OFS A;  1FAS A;  4DO8 A;  1CDR A;  3NDS A;  4FAO E;  6EBX A;  1CRF A;  1TXA A;  2ERA A;  3KFD I;  1YWH A;  2CRT A;  1QKD A;  1IKC A;  1KFH A;  1LXH A;  1COD A;  2H64 B;  1FSC A;  2ABX A;  1B41 B;  4BDT B;  2MJ4 A;  2L5S A;  1PLO A;  2UX2 A;  1HOY A;  1ZAD A;  1NYU A;  2BTX A;  2QJA C;  2QJB C;  3QB4 B;  1FF4 A;  2CCX A;  1M9Z A;  1KXI A;  1ES7 B;  1IQ9 A;  1KBT A;  1QM7 A;  2GOO C;  2LA1 A;  1REW C;  1S4Y A;  3HH7 A;  1V6P A;  2H62 C;  2QC1 A;  1TXB A;  1CXN A;  2FD6 U;  1HAA A;  1KBS A;  4KSN A;  4EY8 B;  1IJC A;  3ERA A;  2JVE A;  3LAQ U;  1UG4 A;  2GOO B;  2PJY B;  3U73 U;  3EBX A;  2H5F A;  1MR6 A;  5DU1 A;  1NTX A;  2H8U A;  4OM5 A;  5DZ5 A;  1ABT A;  2VLW A;  1FSS B;  1JBD A;  1KU6 B;  2MUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...