4FAOE

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
91
structure length
91
Chain Sequence
RECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein/signaling protein
molecule keywords Growth/differentiation factor 2
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 91
sequence length 91
chains with identical sequence F, K, L, Q, R, W, X, e, f, k, l
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4faoE00
1IQ9A 2MFAA 1IDLA 1S4YA 1LXHA 3KFDI 2LCRA 1H0JA 1QKDA 1NEAA 1KBSA 2L5SA 1HC9A 2GOOB 1JE9A 6EBXA 2HLQA 1CDTA 1QM7A 1BTEA 1FF4A 2CDXA 1ABTA 1BXPA 1CDQA 1HAJA 1QKEA 1NYSA 1CDRA 1KFHA 1IDIA 4RUDA 1L4WA 1W6BA 3FEVA 3U73U 1CDSA 1FASA 1JBDA 1KS6A 3PLCA 2ERAA 1TFSA 2BHIA 1IDHA 1ONJA 3BT1U 1F8UB 4FAOE 1TXBA 5IMYC 1KC4A 3BT2U 1FFJA 1CODA 1FRAA 2I9BE 2OFSA 1NXBA 1UG4A 2MJ4A 1NTXA 1NTNA 2MUOA 1F94A 1CB9A 4ZQYA 3NDSA 1IK8A 2L03A 1CCQA 2NBTA 4BDTB 2UX2A 1G6MA 2H64C 1CTXA 2FD6U 1CVOA 2H62C 2N99A 4P7UA 4QTIU 3QB4B 5DU1A 5DO6A 2BTXA 1KXIA 2LA1A 4FAOC 3NEQA 2CRSA 1KU6B 2H7ZB 1ZADA 3LAQU 1CREA 1ERAA 1NYUA 1V6PA 2MJYA 2VLWA 1HAAA 1REWC 1KL8A 5IMTD 2ABXA 1B41B 1NORA 2HLRA 1MAHF 1XT3A 1TGXA 5DZ5A 2QJBC 4IYEA 2QC1A 1LXGA 1LX5B 3KFDE 2X8BB 2H7ZA 3VTSA 1FSCA 1HOYA 2H8UA 2QJ9C 1IKCA 1IJCA 3ERAA 1I02A 4EY8B 1YWHA 3NH7A 1RGJA 1KBTA 1TXAA 4UY2C 1M9ZA 3U74U 2QJAC 1CRFA 2JVEA 4BIKB 1CHVS 2MUPA 4LFTA 2PJYC 1RL5A 2CTXA 4AEAA 1CXOA 2MJ0A 2JQPA 2H64B 1MR6A 1COEA 1FSSB 1LJZA 1VB0A 2MHYA 2K3GA 3HH7A 4OM4A 1JGKA 3EBXA 1ERGA 1PLOA 4HQPF 2H62D 2CCXA 1IDGA 1CXNA 2GOOC 2PJYB 2J8BA 4XJJA 5EBXA 1LSIA 1DRSA 4OM5A 1HC9B 1KBAA 2CRTA 2UWRA 3EVSC 4DO8A 1KTZB 2H5FA 1ES7B
chains in the Genus database with same CATH superfamily
1IQ9A 2MFAA 1IDLA 1S4YA 1LXHA 3KFDI 2LCRA 1H0JA 1QKDA 1NEAA 1KBSA 2L5SA 1HC9A 2GOOB 1JE9A 6EBXA 2HLQA 1CDTA 1QM7A 1BTEA 1FF4A 2CDXA 1ABTA 1BXPA 1CDQA 1HAJA 1QKEA 1NYSA 1CDRA 1KFHA 1IDIA 4RUDA 1L4WA 1W6BA 3FEVA 3U73U 1CDSA 1FASA 1JBDA 1KS6A 3PLCA 2ERAA 1TFSA 2BHIA 1IDHA 1ONJA 3BT1U 1F8UB 4FAOE 1TXBA 5IMYC 1KC4A 3BT2U 1FFJA 1CODA 1FRAA 2I9BE 2OFSA 1NXBA 1UG4A 2MJ4A 1NTXA 1NTNA 2MUOA 1F94A 1CB9A 4ZQYA 3NDSA 1IK8A 2L03A 1CCQA 4KSNA 2NBTA 4BDTB 2UX2A 1G6MA 2H64C 1CTXA 2FD6U 1CVOA 2H62C 2N99A 4P7UA 4QTIU 3QB4B 5DU1A 5DO6A 2BTXA 1KXIA 2LA1A 4FAOC 3NEQA 2CRSA 1KU6B 2H7ZB 1ZADA 3LAQU 1CREA 1ERAA 1NYUA 1V6PA 2MJYA 2VLWA 1HAAA 1REWC 1KL8A 5IMTD 2ABXA 1B41B 1NORA 2HLRA 1MAHF 1XT3A 1TGXA 5DZ5A 2QJBC 4IYEA 2QC1A 1LXGA 1LX5B 3KFDE 2X8BB 2H7ZA 3VTSA 1FSCA 1HOYA 2H8UA 2QJ9C 1IKCA 1IJCA 3ERAA 1I02A 4EY8B 1YWHA 3NH7A 1RGJA 1KBTA 1TXAA 4UY2C 1M9ZA 3U74U 2QJAC 1CRFA 2JVEA 4BIKB 1CHVS 2MUPA 4LFTA 2PJYC 1RL5A 2CTXA 4AEAA 1CXOA 2MJ0A 2JQPA 2H64B 1MR6A 1COEA 1FSSB 1LJZA 1VB0A 2MHYA 2K3GA 3HH7A 4OM4A 1JGKA 3EBXA 1ERGA 1PLOA 4HQPF 2H62D 2CCXA 1IDGA 1CXNA 2GOOC 2PJYB 2J8BA 4XJJA 5EBXA 1LSIA 1DRSA 4OM5A 1HC9B 1KBAA 2CRTA 2UWRA 3EVSC 4DO8A 1KTZB 2H5FA 1ES7B
chains in the Genus database with same CATH topology
1IQ9A 2MFAA 1IDLA 1S4YA 1LXHA 3KFDI 2LCRA 1H0JA 1QKDA 1NEAA 1KBSA 2L5SA 1HC9A 2GOOB 1JE9A 6EBXA 2HLQA 1CDTA 1QM7A 1BTEA 1FF4A 2CDXA 1ABTA 1BXPA 1CDQA 1HAJA 1QKEA 1NYSA 1CDRA 1KFHA 1IDIA 4RUDA 1L4WA 1W6BA 3FEVA 3U73U 1CDSA 1FASA 1JBDA 1KS6A 3PLCA 2ERAA 1TFSA 2BHIA 1IDHA 1ONJA 3BT1U 1F8UB 4FAOE 1TXBA 5IMYC 1KC4A 3BT2U 1FFJA 1CODA 1FRAA 2I9BE 2OFSA 1NXBA 1UG4A 2MJ4A 1NTXA 1NTNA 2MUOA 1F94A 1CB9A 4ZQYA 3NDSA 1IK8A 2L03A 1CCQA 4KSNA 2NBTA 4BDTB 2UX2A 1G6MA 2H64C 1CTXA 2FD6U 1CVOA 2H62C 2N99A 4P7UA 4QTIU 3QB4B 5DU1A 5DO6A 2BTXA 1KXIA 2LA1A 4FAOC 3NEQA 2CRSA 1KU6B 2H7ZB 1ZADA 3LAQU 1CREA 1ERAA 1NYUA 1V6PA 2MJYA 2VLWA 1HAAA 1REWC 1KL8A 5IMTD 2ABXA 1B41B 1NORA 2HLRA 1MAHF 1XT3A 1TGXA 5DZ5A 2QJBC 4IYEA 2QC1A 1LXGA 1LX5B 3KFDE 2X8BB 2H7ZA 3VTSA 1FSCA 1HOYA 2H8UA 2QJ9C 1IKCA 1IJCA 3ERAA 1I02A 4EY8B 1YWHA 3NH7A 1RGJA 1KBTA 1TXAA 4UY2C 1M9ZA 3U74U 2QJAC 1CRFA 2JVEA 4BIKB 1CHVS 2MUPA 4LFTA 2PJYC 1RL5A 2CTXA 4AEAA 1CXOA 2MJ0A 2JQPA 2H64B 1MR6A 1COEA 1FSSB 1LJZA 1VB0A 2MHYA 2K3GA 3HH7A 4OM4A 1JGKA 3EBXA 1ERGA 1PLOA 4HQPF 2H62D 2CCXA 1IDGA 1CXNA 2GOOC 2PJYB 2J8BA 4XJJA 5EBXA 1LSIA 1DRSA 4OM5A 1HC9B 1KBAA 2CRTA 2UWRA 3EVSC 4DO8A 1KTZB 2H5FA 1ES7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ9 A;  2MFA A;  1IDL A;  1S4Y A;  1LXH A;  3KFD I;  2LCR A;  1H0J A;  1QKD A;  1NEA A;  1KBS A;  2L5S A;  1HC9 A;  2GOO B;  1JE9 A;  6EBX A;  2HLQ A;  1CDT A;  1QM7 A;  1BTE A;  1FF4 A;  2CDX A;  1ABT A;  1BXP A;  1CDQ A;  1HAJ A;  1QKE A;  1NYS A;  1CDR A;  1KFH A;  1IDI A;  4RUD A;  1L4W A;  1W6B A;  3FEV A;  3U73 U;  1CDS A;  1FAS A;  1JBD A;  1KS6 A;  3PLC A;  2ERA A;  1TFS A;  2BHI A;  1IDH A;  1ONJ A;  3BT1 U;  1F8U B;  4FAO E;  1TXB A;  5IMY C;  1KC4 A;  3BT2 U;  1FFJ A;  1COD A;  1FRA A;  2I9B E;  2OFS A;  1NXB A;  1UG4 A;  2MJ4 A;  1NTX A;  1NTN A;  2MUO A;  1F94 A;  1CB9 A;  4ZQY A;  3NDS A;  1IK8 A;  2L03 A;  1CCQ A;  2NBT A;  4BDT B;  2UX2 A;  1G6M A;  2H64 C;  1CTX A;  2FD6 U;  1CVO A;  2H62 C;  2N99 A;  4P7U A;  4QTI U;  3QB4 B;  5DU1 A;  5DO6 A;  2BTX A;  1KXI A;  2LA1 A;  4FAO C;  3NEQ A;  2CRS A;  1KU6 B;  2H7Z B;  1ZAD A;  3LAQ U;  1CRE A;  1ERA A;  1NYU A;  1V6P A;  2MJY A;  2VLW A;  1HAA A;  1REW C;  1KL8 A;  5IMT D;  2ABX A;  1B41 B;  1NOR A;  2HLR A;  1MAH F;  1XT3 A;  1TGX A;  5DZ5 A;  2QJB C;  4IYE A;  2QC1 A;  1LXG A;  1LX5 B;  3KFD E;  2X8B B;  2H7Z A;  3VTS A;  1FSC A;  1HOY A;  2H8U A;  2QJ9 C;  1IKC A;  1IJC A;  3ERA A;  1I02 A;  4EY8 B;  1YWH A;  3NH7 A;  1RGJ A;  1KBT A;  1TXA A;  4UY2 C;  1M9Z A;  3U74 U;  2QJA C;  1CRF A;  2JVE A;  4BIK B;  1CHV S;  2MUP A;  4LFT A;  2PJY C;  1RL5 A;  2CTX A;  4AEA A;  1CXO A;  2MJ0 A;  2JQP A;  2H64 B;  1MR6 A;  1COE A;  1FSS B;  1LJZ A;  1VB0 A;  2MHY A;  2K3G A;  3HH7 A;  4OM4 A;  1JGK A;  3EBX A;  1ERG A;  1PLO A;  4HQP F;  2H62 D;  2CCX A;  1IDG A;  1CXN A;  2GOO C;  2PJY B;  2J8B A;  4XJJ A;  5EBX A;  1LSI A;  1DRS A;  4OM5 A;  1HC9 B;  1KBA A;  2CRT A;  2UWR A;  3EVS C;  4DO8 A;  1KTZ B;  2H5F A;  1ES7 B; 
#chains in the Genus database with same CATH topology
 1IQ9 A;  2MFA A;  1IDL A;  1S4Y A;  1LXH A;  3KFD I;  2LCR A;  1H0J A;  1QKD A;  1NEA A;  1KBS A;  2L5S A;  1HC9 A;  2GOO B;  1JE9 A;  6EBX A;  2HLQ A;  1CDT A;  1QM7 A;  1BTE A;  1FF4 A;  2CDX A;  1ABT A;  1BXP A;  1CDQ A;  1HAJ A;  1QKE A;  1NYS A;  1CDR A;  1KFH A;  1IDI A;  4RUD A;  1L4W A;  1W6B A;  3FEV A;  3U73 U;  1CDS A;  1FAS A;  1JBD A;  1KS6 A;  3PLC A;  2ERA A;  1TFS A;  2BHI A;  1IDH A;  1ONJ A;  3BT1 U;  1F8U B;  4FAO E;  1TXB A;  5IMY C;  1KC4 A;  3BT2 U;  1FFJ A;  1COD A;  1FRA A;  2I9B E;  2OFS A;  1NXB A;  1UG4 A;  2MJ4 A;  1NTX A;  1NTN A;  2MUO A;  1F94 A;  1CB9 A;  4ZQY A;  3NDS A;  1IK8 A;  2L03 A;  1CCQ A;  4KSN A;  2NBT A;  4BDT B;  2UX2 A;  1G6M A;  2H64 C;  1CTX A;  2FD6 U;  1CVO A;  2H62 C;  2N99 A;  4P7U A;  4QTI U;  3QB4 B;  5DU1 A;  5DO6 A;  2BTX A;  1KXI A;  2LA1 A;  4FAO C;  3NEQ A;  2CRS A;  1KU6 B;  2H7Z B;  1ZAD A;  3LAQ U;  1CRE A;  1ERA A;  1NYU A;  1V6P A;  2MJY A;  2VLW A;  1HAA A;  1REW C;  1KL8 A;  5IMT D;  2ABX A;  1B41 B;  1NOR A;  2HLR A;  1MAH F;  1XT3 A;  1TGX A;  5DZ5 A;  2QJB C;  4IYE A;  2QC1 A;  1LXG A;  1LX5 B;  3KFD E;  2X8B B;  2H7Z A;  3VTS A;  1FSC A;  1HOY A;  2H8U A;  2QJ9 C;  1IKC A;  1IJC A;  3ERA A;  1I02 A;  4EY8 B;  1YWH A;  3NH7 A;  1RGJ A;  1KBT A;  1TXA A;  4UY2 C;  1M9Z A;  3U74 U;  2QJA C;  1CRF A;  2JVE A;  4BIK B;  1CHV S;  2MUP A;  4LFT A;  2PJY C;  1RL5 A;  2CTX A;  4AEA A;  1CXO A;  2MJ0 A;  2JQP A;  2H64 B;  1MR6 A;  1COE A;  1FSS B;  1LJZ A;  1VB0 A;  2MHY A;  2K3G A;  3HH7 A;  4OM4 A;  1JGK A;  3EBX A;  1ERG A;  1PLO A;  4HQP F;  2H62 D;  2CCX A;  1IDG A;  1CXN A;  2GOO C;  2PJY B;  2J8B A;  4XJJ A;  5EBX A;  1LSI A;  1DRS A;  4OM5 A;  1HC9 B;  1KBA A;  2CRT A;  2UWR A;  3EVS C;  4DO8 A;  1KTZ B;  2H5F A;  1ES7 B; 
#chains in the Genus database with same CATH homology
 1IQ9 A;  2MFA A;  1IDL A;  1S4Y A;  1LXH A;  3KFD I;  2LCR A;  1H0J A;  1QKD A;  1NEA A;  1KBS A;  2L5S A;  1HC9 A;  2GOO B;  1JE9 A;  6EBX A;  2HLQ A;  1CDT A;  1QM7 A;  1BTE A;  1FF4 A;  2CDX A;  1ABT A;  1BXP A;  1CDQ A;  1HAJ A;  1QKE A;  1NYS A;  1CDR A;  1KFH A;  1IDI A;  4RUD A;  1L4W A;  1W6B A;  3FEV A;  3U73 U;  1CDS A;  1FAS A;  1JBD A;  1KS6 A;  3PLC A;  2ERA A;  1TFS A;  2BHI A;  1IDH A;  1ONJ A;  3BT1 U;  1F8U B;  4FAO E;  1TXB A;  5IMY C;  1KC4 A;  3BT2 U;  1FFJ A;  1COD A;  1FRA A;  2I9B E;  2OFS A;  1NXB A;  1UG4 A;  2MJ4 A;  1NTX A;  1NTN A;  2MUO A;  1F94 A;  1CB9 A;  4ZQY A;  3NDS A;  1IK8 A;  2L03 A;  1CCQ A;  4KSN A;  2NBT A;  4BDT B;  2UX2 A;  1G6M A;  2H64 C;  1CTX A;  2FD6 U;  1CVO A;  2H62 C;  2N99 A;  4P7U A;  4QTI U;  3QB4 B;  5DU1 A;  5DO6 A;  2BTX A;  1KXI A;  2LA1 A;  4FAO C;  3NEQ A;  2CRS A;  1KU6 B;  2H7Z B;  1ZAD A;  3LAQ U;  1CRE A;  1ERA A;  1NYU A;  1V6P A;  2MJY A;  2VLW A;  1HAA A;  1REW C;  1KL8 A;  5IMT D;  2ABX A;  1B41 B;  1NOR A;  2HLR A;  1MAH F;  1XT3 A;  1TGX A;  5DZ5 A;  2QJB C;  4IYE A;  2QC1 A;  1LXG A;  1LX5 B;  3KFD E;  2X8B B;  2H7Z A;  3VTS A;  1FSC A;  1HOY A;  2H8U A;  2QJ9 C;  1IKC A;  1IJC A;  3ERA A;  1I02 A;  4EY8 B;  1YWH A;  3NH7 A;  1RGJ A;  1KBT A;  1TXA A;  4UY2 C;  1M9Z A;  3U74 U;  2QJA C;  1CRF A;  2JVE A;  4BIK B;  1CHV S;  2MUP A;  4LFT A;  2PJY C;  1RL5 A;  2CTX A;  4AEA A;  1CXO A;  2MJ0 A;  2JQP A;  2H64 B;  1MR6 A;  1COE A;  1FSS B;  1LJZ A;  1VB0 A;  2MHY A;  2K3G A;  3HH7 A;  4OM4 A;  1JGK A;  3EBX A;  1ERG A;  1PLO A;  4HQP F;  2H62 D;  2CCX A;  1IDG A;  1CXN A;  2GOO C;  2PJY B;  2J8B A;  4XJJ A;  5EBX A;  1LSI A;  1DRS A;  4OM5 A;  1HC9 B;  1KBA A;  2CRT A;  2UWR A;  3EVS C;  4DO8 A;  1KTZ B;  2H5F A;  1ES7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...