1FASA

1.9 angstrom resolution structure of fasciculin 1, an anti-acetylcholinesterase toxin from green mamba snake venom
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
61
structure length
61
Chain Sequence
TMCYSHTTTSRAILTNCGENSCYRKSRRHPPKMVLGRGCGCPPGDDYLEVKCCTSPDKCNY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords FASCICULIN 1
publication title 1.9-A resolution structure of fasciculin 1, an anti-acetylcholinesterase toxin from green mamba snake venom.
pubmed rcsb
source organism Dendroaspis angusticeps
total genus 12
structure length 61
sequence length 61
ec nomenclature
pdb deposition date 1992-08-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1fasA00
2CRTA 4DO8A 2I9BE 1TXBA 1REWC 2HLQA 2LA1A 2H62D 1CXOA 1TXAA 2MJ4A 1NTNA 1VB0A 4ZQYA 3FEVA 1KS6A 1UG4A 6EBXA 4UY2C 2GOOB 3NH7A 2VLWA 2K3GA 2CTXA 2MUPA 2H7ZA 2H62C 1FRAA 1PLOA 1YWHA 1F8UB 2MJ0A 1BTEA 1ERAA 1ES7B 1CVOA 1CREA 4AEAA 1HAJA 4OM4A 2H8UA 1KBTA 2CCXA 2MHYA 1NXBA 1W6BA 3U74U 2L03A 1S4YA 1IDLA 2FD6U 2J8BA 1KTZB 1IDIA 1KBAA 3EVSC 1LX5B 2NBTA 3NDSA 5DU1A 1NORA 3KFDE 1I02A 2H64B 1HC9B 1TGXA 1QKDA 1B41B 4OM5A 1JGKA 1HOYA 2N99A 1CDRA 3VTSA 1CHVS 2H64C 2HLRA 3KFDI 1DRSA 1LXHA 2GOOC 3LAQU 1LJZA 1XT3A 3PLCA 1IK8A 1QM7A 1CDSA 2OFSA 1IDGA 2MFAA 4BDTB 1H0JA 1JBDA 4RUDA 5EBXA 5DZ5A 1KU6B 4EY8B 1HAAA 1CRFA 5IMTD 1KFHA 2PJYB 2BTXA 1CDQA 1L4WA 4QTIU 1COEA 1HC9A 2QJBC 2H5FA 1CCQA 2ERAA 1IJCA 1NYUA 1QKEA 5DO6A 2PJYC 1KXIA 1G6MA 1NYSA 4XJJA 1RGJA 2JVEA 2BHIA 2MJYA 4HQPF 2QC1A 1MAHF 1FSCA 2UWRA 4BIKB 1FASA 1CODA 3BT1U 5IMYC 1IKCA 1CXNA 1BXPA 3HH7A 4P7UA 2QJ9C 4FAOC 1KBSA 2ABXA 4LFTA 2LCRA 1KL8A 1IQ9A 2L5SA 1ZADA 3U73U 2MUOA 3NEQA 4IYEA 1FSSB 1KC4A 1CDTA 3ERAA 1ERGA 1M9ZA 1MR6A 2CDXA 2JQPA 1ABTA 1FF4A 1NEAA 1F94A 1ONJA 2UX2A 2QJAC 2CRSA 1RL5A 2H7ZB 1CB9A 1TFSA 1LSIA 1FFJA 1V6PA 1LXGA 3BT2U 1JE9A 3EBXA 4FAOE 1IDHA 3QB4B 2X8BB 1CTXA 1NTXA
chains in the Genus database with same CATH superfamily
2CRTA 4DO8A 2I9BE 1TXBA 1REWC 2HLQA 2LA1A 2H62D 1CXOA 1TXAA 2MJ4A 1NTNA 1VB0A 4ZQYA 3FEVA 1KS6A 1UG4A 6EBXA 4UY2C 2GOOB 3NH7A 2VLWA 2K3GA 2CTXA 2MUPA 2H7ZA 2H62C 1FRAA 1PLOA 1YWHA 1F8UB 2MJ0A 1BTEA 1ERAA 1ES7B 1CVOA 1CREA 4AEAA 1HAJA 4OM4A 2H8UA 1KBTA 2CCXA 2MHYA 1NXBA 1W6BA 3U74U 2L03A 1S4YA 1IDLA 2FD6U 2J8BA 1KTZB 1IDIA 1KBAA 3EVSC 1LX5B 2NBTA 3NDSA 5DU1A 1NORA 3KFDE 1I02A 2H64B 1HC9B 1TGXA 1QKDA 1B41B 4OM5A 1JGKA 1HOYA 2N99A 1CDRA 3VTSA 1CHVS 2H64C 2HLRA 3KFDI 1DRSA 1LXHA 2GOOC 3LAQU 1LJZA 1XT3A 3PLCA 1IK8A 1QM7A 1CDSA 2OFSA 1IDGA 2MFAA 4BDTB 1H0JA 1JBDA 4RUDA 5EBXA 5DZ5A 1KU6B 4EY8B 1HAAA 1CRFA 5IMTD 1KFHA 2PJYB 2BTXA 1CDQA 1L4WA 4QTIU 1COEA 1HC9A 2QJBC 2H5FA 1CCQA 2ERAA 1IJCA 1NYUA 1QKEA 5DO6A 2PJYC 1KXIA 1G6MA 1NYSA 4KSNA 4XJJA 1RGJA 2JVEA 2BHIA 2MJYA 4HQPF 2QC1A 1MAHF 1FSCA 2UWRA 4BIKB 1FASA 1CODA 3BT1U 5IMYC 1IKCA 1CXNA 1BXPA 3HH7A 4P7UA 2QJ9C 4FAOC 1KBSA 2ABXA 4LFTA 2LCRA 1KL8A 1IQ9A 2L5SA 1ZADA 3U73U 2MUOA 3NEQA 4IYEA 1FSSB 1KC4A 1CDTA 3ERAA 1ERGA 1M9ZA 1MR6A 2CDXA 2JQPA 1ABTA 1FF4A 1NEAA 1F94A 1ONJA 2UX2A 2QJAC 2CRSA 1RL5A 2H7ZB 1CB9A 1TFSA 1LSIA 1FFJA 1V6PA 1LXGA 3BT2U 1JE9A 3EBXA 4FAOE 1IDHA 3QB4B 2X8BB 1CTXA 1NTXA
chains in the Genus database with same CATH topology
2CRTA 4DO8A 2I9BE 1TXBA 1REWC 2HLQA 2LA1A 2H62D 1CXOA 1TXAA 2MJ4A 1NTNA 1VB0A 4ZQYA 3FEVA 1KS6A 1UG4A 6EBXA 4UY2C 2GOOB 3NH7A 2VLWA 2K3GA 2CTXA 2MUPA 2H7ZA 2H62C 1FRAA 1PLOA 1YWHA 1F8UB 2MJ0A 1BTEA 1ERAA 1ES7B 1CVOA 1CREA 4AEAA 1HAJA 4OM4A 2H8UA 1KBTA 2CCXA 2MHYA 1NXBA 1W6BA 3U74U 2L03A 1S4YA 1IDLA 2FD6U 2J8BA 1KTZB 1IDIA 1KBAA 3EVSC 1LX5B 2NBTA 3NDSA 5DU1A 1NORA 3KFDE 1I02A 2H64B 1HC9B 1TGXA 1QKDA 1B41B 4OM5A 1JGKA 1HOYA 2N99A 1CDRA 3VTSA 1CHVS 2H64C 2HLRA 3KFDI 1DRSA 1LXHA 2GOOC 3LAQU 1LJZA 1XT3A 3PLCA 1IK8A 1QM7A 1CDSA 2OFSA 1IDGA 2MFAA 4BDTB 1H0JA 1JBDA 4RUDA 5EBXA 5DZ5A 1KU6B 4EY8B 1HAAA 1CRFA 5IMTD 1KFHA 2PJYB 2BTXA 1CDQA 1L4WA 4QTIU 1COEA 1HC9A 2QJBC 2H5FA 1CCQA 2ERAA 1IJCA 1NYUA 1QKEA 5DO6A 2PJYC 1KXIA 1G6MA 1NYSA 4KSNA 4XJJA 1RGJA 2JVEA 2BHIA 2MJYA 4HQPF 2QC1A 1MAHF 1FSCA 2UWRA 4BIKB 1FASA 1CODA 3BT1U 5IMYC 1IKCA 1CXNA 1BXPA 3HH7A 4P7UA 2QJ9C 4FAOC 1KBSA 2ABXA 4LFTA 2LCRA 1KL8A 1IQ9A 2L5SA 1ZADA 3U73U 2MUOA 3NEQA 4IYEA 1FSSB 1KC4A 1CDTA 3ERAA 1ERGA 1M9ZA 1MR6A 2CDXA 2JQPA 1ABTA 1FF4A 1NEAA 1F94A 1ONJA 2UX2A 2QJAC 2CRSA 1RL5A 2H7ZB 1CB9A 1TFSA 1LSIA 1FFJA 1V6PA 1LXGA 3BT2U 1JE9A 3EBXA 4FAOE 1IDHA 3QB4B 2X8BB 1CTXA 1NTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRT A;  4DO8 A;  2I9B E;  1TXB A;  1REW C;  2HLQ A;  2LA1 A;  2H62 D;  1CXO A;  1TXA A;  2MJ4 A;  1NTN A;  1VB0 A;  4ZQY A;  3FEV A;  1KS6 A;  1UG4 A;  6EBX A;  4UY2 C;  2GOO B;  3NH7 A;  2VLW A;  2K3G A;  2CTX A;  2MUP A;  2H7Z A;  2H62 C;  1FRA A;  1PLO A;  1YWH A;  1F8U B;  2MJ0 A;  1BTE A;  1ERA A;  1ES7 B;  1CVO A;  1CRE A;  4AEA A;  1HAJ A;  4OM4 A;  2H8U A;  1KBT A;  2CCX A;  2MHY A;  1NXB A;  1W6B A;  3U74 U;  2L03 A;  1S4Y A;  1IDL A;  2FD6 U;  2J8B A;  1KTZ B;  1IDI A;  1KBA A;  3EVS C;  1LX5 B;  2NBT A;  3NDS A;  5DU1 A;  1NOR A;  3KFD E;  1I02 A;  2H64 B;  1HC9 B;  1TGX A;  1QKD A;  1B41 B;  4OM5 A;  1JGK A;  1HOY A;  2N99 A;  1CDR A;  3VTS A;  1CHV S;  2H64 C;  2HLR A;  3KFD I;  1DRS A;  1LXH A;  2GOO C;  3LAQ U;  1LJZ A;  1XT3 A;  3PLC A;  1IK8 A;  1QM7 A;  1CDS A;  2OFS A;  1IDG A;  2MFA A;  4BDT B;  1H0J A;  1JBD A;  4RUD A;  5EBX A;  5DZ5 A;  1KU6 B;  4EY8 B;  1HAA A;  1CRF A;  5IMT D;  1KFH A;  2PJY B;  2BTX A;  1CDQ A;  1L4W A;  4QTI U;  1COE A;  1HC9 A;  2QJB C;  2H5F A;  1CCQ A;  2ERA A;  1IJC A;  1NYU A;  1QKE A;  5DO6 A;  2PJY C;  1KXI A;  1G6M A;  1NYS A;  4XJJ A;  1RGJ A;  2JVE A;  2BHI A;  2MJY A;  4HQP F;  2QC1 A;  1MAH F;  1FSC A;  2UWR A;  4BIK B;  1FAS A;  1COD A;  3BT1 U;  5IMY C;  1IKC A;  1CXN A;  1BXP A;  3HH7 A;  4P7U A;  2QJ9 C;  4FAO C;  1KBS A;  2ABX A;  4LFT A;  2LCR A;  1KL8 A;  1IQ9 A;  2L5S A;  1ZAD A;  3U73 U;  2MUO A;  3NEQ A;  4IYE A;  1FSS B;  1KC4 A;  1CDT A;  3ERA A;  1ERG A;  1M9Z A;  1MR6 A;  2CDX A;  2JQP A;  1ABT A;  1FF4 A;  1NEA A;  1F94 A;  1ONJ A;  2UX2 A;  2QJA C;  2CRS A;  1RL5 A;  2H7Z B;  1CB9 A;  1TFS A;  1LSI A;  1FFJ A;  1V6P A;  1LXG A;  3BT2 U;  1JE9 A;  3EBX A;  4FAO E;  1IDH A;  3QB4 B;  2X8B B;  1CTX A;  1NTX A; 
#chains in the Genus database with same CATH topology
 2CRT A;  4DO8 A;  2I9B E;  1TXB A;  1REW C;  2HLQ A;  2LA1 A;  2H62 D;  1CXO A;  1TXA A;  2MJ4 A;  1NTN A;  1VB0 A;  4ZQY A;  3FEV A;  1KS6 A;  1UG4 A;  6EBX A;  4UY2 C;  2GOO B;  3NH7 A;  2VLW A;  2K3G A;  2CTX A;  2MUP A;  2H7Z A;  2H62 C;  1FRA A;  1PLO A;  1YWH A;  1F8U B;  2MJ0 A;  1BTE A;  1ERA A;  1ES7 B;  1CVO A;  1CRE A;  4AEA A;  1HAJ A;  4OM4 A;  2H8U A;  1KBT A;  2CCX A;  2MHY A;  1NXB A;  1W6B A;  3U74 U;  2L03 A;  1S4Y A;  1IDL A;  2FD6 U;  2J8B A;  1KTZ B;  1IDI A;  1KBA A;  3EVS C;  1LX5 B;  2NBT A;  3NDS A;  5DU1 A;  1NOR A;  3KFD E;  1I02 A;  2H64 B;  1HC9 B;  1TGX A;  1QKD A;  1B41 B;  4OM5 A;  1JGK A;  1HOY A;  2N99 A;  1CDR A;  3VTS A;  1CHV S;  2H64 C;  2HLR A;  3KFD I;  1DRS A;  1LXH A;  2GOO C;  3LAQ U;  1LJZ A;  1XT3 A;  3PLC A;  1IK8 A;  1QM7 A;  1CDS A;  2OFS A;  1IDG A;  2MFA A;  4BDT B;  1H0J A;  1JBD A;  4RUD A;  5EBX A;  5DZ5 A;  1KU6 B;  4EY8 B;  1HAA A;  1CRF A;  5IMT D;  1KFH A;  2PJY B;  2BTX A;  1CDQ A;  1L4W A;  4QTI U;  1COE A;  1HC9 A;  2QJB C;  2H5F A;  1CCQ A;  2ERA A;  1IJC A;  1NYU A;  1QKE A;  5DO6 A;  2PJY C;  1KXI A;  1G6M A;  1NYS A;  4KSN A;  4XJJ A;  1RGJ A;  2JVE A;  2BHI A;  2MJY A;  4HQP F;  2QC1 A;  1MAH F;  1FSC A;  2UWR A;  4BIK B;  1FAS A;  1COD A;  3BT1 U;  5IMY C;  1IKC A;  1CXN A;  1BXP A;  3HH7 A;  4P7U A;  2QJ9 C;  4FAO C;  1KBS A;  2ABX A;  4LFT A;  2LCR A;  1KL8 A;  1IQ9 A;  2L5S A;  1ZAD A;  3U73 U;  2MUO A;  3NEQ A;  4IYE A;  1FSS B;  1KC4 A;  1CDT A;  3ERA A;  1ERG A;  1M9Z A;  1MR6 A;  2CDX A;  2JQP A;  1ABT A;  1FF4 A;  1NEA A;  1F94 A;  1ONJ A;  2UX2 A;  2QJA C;  2CRS A;  1RL5 A;  2H7Z B;  1CB9 A;  1TFS A;  1LSI A;  1FFJ A;  1V6P A;  1LXG A;  3BT2 U;  1JE9 A;  3EBX A;  4FAO E;  1IDH A;  3QB4 B;  2X8B B;  1CTX A;  1NTX A; 
#chains in the Genus database with same CATH homology
 2CRT A;  4DO8 A;  2I9B E;  1TXB A;  1REW C;  2HLQ A;  2LA1 A;  2H62 D;  1CXO A;  1TXA A;  2MJ4 A;  1NTN A;  1VB0 A;  4ZQY A;  3FEV A;  1KS6 A;  1UG4 A;  6EBX A;  4UY2 C;  2GOO B;  3NH7 A;  2VLW A;  2K3G A;  2CTX A;  2MUP A;  2H7Z A;  2H62 C;  1FRA A;  1PLO A;  1YWH A;  1F8U B;  2MJ0 A;  1BTE A;  1ERA A;  1ES7 B;  1CVO A;  1CRE A;  4AEA A;  1HAJ A;  4OM4 A;  2H8U A;  1KBT A;  2CCX A;  2MHY A;  1NXB A;  1W6B A;  3U74 U;  2L03 A;  1S4Y A;  1IDL A;  2FD6 U;  2J8B A;  1KTZ B;  1IDI A;  1KBA A;  3EVS C;  1LX5 B;  2NBT A;  3NDS A;  5DU1 A;  1NOR A;  3KFD E;  1I02 A;  2H64 B;  1HC9 B;  1TGX A;  1QKD A;  1B41 B;  4OM5 A;  1JGK A;  1HOY A;  2N99 A;  1CDR A;  3VTS A;  1CHV S;  2H64 C;  2HLR A;  3KFD I;  1DRS A;  1LXH A;  2GOO C;  3LAQ U;  1LJZ A;  1XT3 A;  3PLC A;  1IK8 A;  1QM7 A;  1CDS A;  2OFS A;  1IDG A;  2MFA A;  4BDT B;  1H0J A;  1JBD A;  4RUD A;  5EBX A;  5DZ5 A;  1KU6 B;  4EY8 B;  1HAA A;  1CRF A;  5IMT D;  1KFH A;  2PJY B;  2BTX A;  1CDQ A;  1L4W A;  4QTI U;  1COE A;  1HC9 A;  2QJB C;  2H5F A;  1CCQ A;  2ERA A;  1IJC A;  1NYU A;  1QKE A;  5DO6 A;  2PJY C;  1KXI A;  1G6M A;  1NYS A;  4KSN A;  4XJJ A;  1RGJ A;  2JVE A;  2BHI A;  2MJY A;  4HQP F;  2QC1 A;  1MAH F;  1FSC A;  2UWR A;  4BIK B;  1FAS A;  1COD A;  3BT1 U;  5IMY C;  1IKC A;  1CXN A;  1BXP A;  3HH7 A;  4P7U A;  2QJ9 C;  4FAO C;  1KBS A;  2ABX A;  4LFT A;  2LCR A;  1KL8 A;  1IQ9 A;  2L5S A;  1ZAD A;  3U73 U;  2MUO A;  3NEQ A;  4IYE A;  1FSS B;  1KC4 A;  1CDT A;  3ERA A;  1ERG A;  1M9Z A;  1MR6 A;  2CDX A;  2JQP A;  1ABT A;  1FF4 A;  1NEA A;  1F94 A;  1ONJ A;  2UX2 A;  2QJA C;  2CRS A;  1RL5 A;  2H7Z B;  1CB9 A;  1TFS A;  1LSI A;  1FFJ A;  1V6P A;  1LXG A;  3BT2 U;  1JE9 A;  3EBX A;  4FAO E;  1IDH A;  3QB4 B;  2X8B B;  1CTX A;  1NTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...