5DO6A

Crystal structure of dendroaspis polylepis venom mambalgin-1 t23a mutant
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNAGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Mambalgin-1
total genus 13
structure length 57
sequence length 57
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5do6A00
4FAOC 1CXOA 2CTXA 2CRTA 4BIKB 3PLCA 1M9ZA 1CDRA 1ERGA 1HC9A 2GOOB 2OFSA 3KFDE 1CB9A 2MUOA 1KS6A 1LSIA 2GOOC 1PLOA 1CDQA 1KU6B 1NORA 1CRFA 2H62C 1CREA 1ONJA 2BTXA 1B41B 3U74U 2QC1A 5IMTD 1FSCA 1KBTA 1IJCA 1CHVS 2QJBC 1MR6A 1HAJA 4ZQYA 1COEA 1TFSA 1KL8A 2QJ9C 4EY8B 1IQ9A 1KXIA 1ZADA 2J8BA 3VTSA 2MUPA 1FFJA 6EBXA 1RGJA 2JVEA 1BTEA 1UG4A 1QKDA 3ERAA 2I9BE 4QTIU 4XJJA 1HC9B 5DO6A 1JE9A 1CTXA 1HOYA 5DU1A 1TGXA 4DO8A 2CRSA 1CVOA 1ERAA 3EBXA 1IDLA 1NXBA 4AEAA 2LA1A 1QKEA 2N99A 2MFAA 2L5SA 2LCRA 1XT3A 2H62D 1IK8A 2H64C 3QB4B 1L4WA 1IDIA 1NTNA 1W6BA 4RUDA 3FEVA 1REWC 3KFDI 1DRSA 1NTXA 1S4YA 1I02A 2CDXA 4OM5A 1TXAA 2JQPA 1FF4A 3LAQU 1LJZA 2UX2A 2H8UA 1KBAA 1F8UB 1KFHA 2H7ZB 1FASA 1NYSA 5EBXA 1CDSA 3BT1U 2PJYB 1V6PA 1VB0A 1ABTA 1QM7A 1CCQA 1CDTA 2FD6U 1FSSB 1HAAA 1H0JA 3NDSA 4BDTB 1BXPA 2K3GA 1G6MA 2VLWA 2MJ4A 4IYEA 4OM4A 2ABXA 1NEAA 2HLQA 2UWRA 1IDGA 2PJYC 2QJAC 1NYUA 2NBTA 4FAOE 1KBSA 2L03A 3NH7A 3NEQA 2H7ZA 1LXHA 1TXBA 2HLRA 4LFTA 3U73U 1MAHF 1RL5A 2MJ0A 3EVSC 2H5FA 1F94A 2MJYA 1JBDA 2X8BB 2MHYA 2BHIA 1JGKA 1ES7B 1YWHA 1LXGA 2ERAA 1LX5B 4P7UA 1CXNA 1IKCA 5DZ5A 1IDHA 4UY2C 4HQPF 1FRAA 1KTZB 3HH7A 5IMYC 2H64B 1CODA 2CCXA 1KC4A 3BT2U
chains in the Genus database with same CATH superfamily
4FAOC 1CXOA 2CTXA 2CRTA 4BIKB 3PLCA 1M9ZA 1CDRA 1ERGA 1HC9A 2GOOB 2OFSA 3KFDE 1CB9A 2MUOA 1KS6A 1LSIA 2GOOC 1PLOA 1CDQA 1KU6B 1NORA 1CRFA 2H62C 1CREA 1ONJA 2BTXA 1B41B 3U74U 2QC1A 5IMTD 1FSCA 1KBTA 1IJCA 1CHVS 2QJBC 1MR6A 1HAJA 4ZQYA 1COEA 1TFSA 1KL8A 2QJ9C 4EY8B 1IQ9A 1KXIA 1ZADA 2J8BA 3VTSA 2MUPA 1FFJA 6EBXA 1RGJA 2JVEA 1BTEA 1UG4A 1QKDA 3ERAA 2I9BE 4QTIU 4XJJA 1HC9B 5DO6A 1JE9A 1CTXA 1HOYA 5DU1A 1TGXA 4DO8A 2CRSA 1CVOA 1ERAA 3EBXA 1IDLA 1NXBA 4AEAA 2LA1A 1QKEA 2N99A 2MFAA 2L5SA 2LCRA 1XT3A 2H62D 1IK8A 2H64C 3QB4B 1L4WA 1IDIA 1NTNA 1W6BA 4RUDA 3FEVA 1REWC 3KFDI 1DRSA 1NTXA 1S4YA 1I02A 2CDXA 4OM5A 1TXAA 2JQPA 1FF4A 3LAQU 1LJZA 2UX2A 2H8UA 1KBAA 1F8UB 1KFHA 2H7ZB 1FASA 1NYSA 5EBXA 1CDSA 3BT1U 2PJYB 1V6PA 1VB0A 1ABTA 1QM7A 1CCQA 1CDTA 2FD6U 1FSSB 1HAAA 1H0JA 3NDSA 4BDTB 1BXPA 2K3GA 1G6MA 2VLWA 2MJ4A 4IYEA 4OM4A 2ABXA 1NEAA 2HLQA 2UWRA 1IDGA 2PJYC 2QJAC 1NYUA 2NBTA 4FAOE 1KBSA 2L03A 3NH7A 3NEQA 2H7ZA 1LXHA 1TXBA 2HLRA 4LFTA 3U73U 1MAHF 1RL5A 2MJ0A 3EVSC 2H5FA 1F94A 2MJYA 1JBDA 2X8BB 2MHYA 2BHIA 1JGKA 1ES7B 1YWHA 1LXGA 2ERAA 1LX5B 4P7UA 1CXNA 1IKCA 5DZ5A 1IDHA 4UY2C 4HQPF 1FRAA 1KTZB 3HH7A 5IMYC 2H64B 1CODA 2CCXA 1KC4A 4KSNA 3BT2U
chains in the Genus database with same CATH topology
4FAOC 1CXOA 2CTXA 2CRTA 4BIKB 3PLCA 1M9ZA 1CDRA 1ERGA 1HC9A 2GOOB 2OFSA 3KFDE 1CB9A 2MUOA 1KS6A 1LSIA 2GOOC 1PLOA 1CDQA 1KU6B 1NORA 1CRFA 2H62C 1CREA 1ONJA 2BTXA 1B41B 3U74U 2QC1A 5IMTD 1FSCA 1KBTA 1IJCA 1CHVS 2QJBC 1MR6A 1HAJA 4ZQYA 1COEA 1TFSA 1KL8A 2QJ9C 4EY8B 1IQ9A 1KXIA 1ZADA 2J8BA 3VTSA 2MUPA 1FFJA 6EBXA 1RGJA 2JVEA 1BTEA 1UG4A 1QKDA 3ERAA 2I9BE 4QTIU 4XJJA 1HC9B 5DO6A 1JE9A 1CTXA 1HOYA 5DU1A 1TGXA 4DO8A 2CRSA 1CVOA 1ERAA 3EBXA 1IDLA 1NXBA 4AEAA 2LA1A 1QKEA 2N99A 2MFAA 2L5SA 2LCRA 1XT3A 2H62D 1IK8A 2H64C 3QB4B 1L4WA 1IDIA 1NTNA 1W6BA 4RUDA 3FEVA 1REWC 3KFDI 1DRSA 1NTXA 1S4YA 1I02A 2CDXA 4OM5A 1TXAA 2JQPA 1FF4A 3LAQU 1LJZA 2UX2A 2H8UA 1KBAA 1F8UB 1KFHA 2H7ZB 1FASA 1NYSA 5EBXA 1CDSA 3BT1U 2PJYB 1V6PA 1VB0A 1ABTA 1QM7A 1CCQA 1CDTA 2FD6U 1FSSB 1HAAA 1H0JA 3NDSA 4BDTB 1BXPA 2K3GA 1G6MA 2VLWA 2MJ4A 4IYEA 4OM4A 2ABXA 1NEAA 2HLQA 2UWRA 1IDGA 2PJYC 2QJAC 1NYUA 2NBTA 4FAOE 1KBSA 2L03A 3NH7A 3NEQA 2H7ZA 1LXHA 1TXBA 2HLRA 4LFTA 3U73U 1MAHF 1RL5A 2MJ0A 3EVSC 2H5FA 1F94A 2MJYA 1JBDA 2X8BB 2MHYA 2BHIA 1JGKA 1ES7B 1YWHA 1LXGA 2ERAA 1LX5B 4P7UA 1CXNA 1IKCA 5DZ5A 1IDHA 4UY2C 4HQPF 1FRAA 1KTZB 3HH7A 5IMYC 2H64B 1CODA 2CCXA 1KC4A 4KSNA 3BT2U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAO C;  1CXO A;  2CTX A;  2CRT A;  4BIK B;  3PLC A;  1M9Z A;  1CDR A;  1ERG A;  1HC9 A;  2GOO B;  2OFS A;  3KFD E;  1CB9 A;  2MUO A;  1KS6 A;  1LSI A;  2GOO C;  1PLO A;  1CDQ A;  1KU6 B;  1NOR A;  1CRF A;  2H62 C;  1CRE A;  1ONJ A;  2BTX A;  1B41 B;  3U74 U;  2QC1 A;  5IMT D;  1FSC A;  1KBT A;  1IJC A;  1CHV S;  2QJB C;  1MR6 A;  1HAJ A;  4ZQY A;  1COE A;  1TFS A;  1KL8 A;  2QJ9 C;  4EY8 B;  1IQ9 A;  1KXI A;  1ZAD A;  2J8B A;  3VTS A;  2MUP A;  1FFJ A;  6EBX A;  1RGJ A;  2JVE A;  1BTE A;  1UG4 A;  1QKD A;  3ERA A;  2I9B E;  4QTI U;  4XJJ A;  1HC9 B;  5DO6 A;  1JE9 A;  1CTX A;  1HOY A;  5DU1 A;  1TGX A;  4DO8 A;  2CRS A;  1CVO A;  1ERA A;  3EBX A;  1IDL A;  1NXB A;  4AEA A;  2LA1 A;  1QKE A;  2N99 A;  2MFA A;  2L5S A;  2LCR A;  1XT3 A;  2H62 D;  1IK8 A;  2H64 C;  3QB4 B;  1L4W A;  1IDI A;  1NTN A;  1W6B A;  4RUD A;  3FEV A;  1REW C;  3KFD I;  1DRS A;  1NTX A;  1S4Y A;  1I02 A;  2CDX A;  4OM5 A;  1TXA A;  2JQP A;  1FF4 A;  3LAQ U;  1LJZ A;  2UX2 A;  2H8U A;  1KBA A;  1F8U B;  1KFH A;  2H7Z B;  1FAS A;  1NYS A;  5EBX A;  1CDS A;  3BT1 U;  2PJY B;  1V6P A;  1VB0 A;  1ABT A;  1QM7 A;  1CCQ A;  1CDT A;  2FD6 U;  1FSS B;  1HAA A;  1H0J A;  3NDS A;  4BDT B;  1BXP A;  2K3G A;  1G6M A;  2VLW A;  2MJ4 A;  4IYE A;  4OM4 A;  2ABX A;  1NEA A;  2HLQ A;  2UWR A;  1IDG A;  2PJY C;  2QJA C;  1NYU A;  2NBT A;  4FAO E;  1KBS A;  2L03 A;  3NH7 A;  3NEQ A;  2H7Z A;  1LXH A;  1TXB A;  2HLR A;  4LFT A;  3U73 U;  1MAH F;  1RL5 A;  2MJ0 A;  3EVS C;  2H5F A;  1F94 A;  2MJY A;  1JBD A;  2X8B B;  2MHY A;  2BHI A;  1JGK A;  1ES7 B;  1YWH A;  1LXG A;  2ERA A;  1LX5 B;  4P7U A;  1CXN A;  1IKC A;  5DZ5 A;  1IDH A;  4UY2 C;  4HQP F;  1FRA A;  1KTZ B;  3HH7 A;  5IMY C;  2H64 B;  1COD A;  2CCX A;  1KC4 A;  3BT2 U; 
#chains in the Genus database with same CATH topology
 4FAO C;  1CXO A;  2CTX A;  2CRT A;  4BIK B;  3PLC A;  1M9Z A;  1CDR A;  1ERG A;  1HC9 A;  2GOO B;  2OFS A;  3KFD E;  1CB9 A;  2MUO A;  1KS6 A;  1LSI A;  2GOO C;  1PLO A;  1CDQ A;  1KU6 B;  1NOR A;  1CRF A;  2H62 C;  1CRE A;  1ONJ A;  2BTX A;  1B41 B;  3U74 U;  2QC1 A;  5IMT D;  1FSC A;  1KBT A;  1IJC A;  1CHV S;  2QJB C;  1MR6 A;  1HAJ A;  4ZQY A;  1COE A;  1TFS A;  1KL8 A;  2QJ9 C;  4EY8 B;  1IQ9 A;  1KXI A;  1ZAD A;  2J8B A;  3VTS A;  2MUP A;  1FFJ A;  6EBX A;  1RGJ A;  2JVE A;  1BTE A;  1UG4 A;  1QKD A;  3ERA A;  2I9B E;  4QTI U;  4XJJ A;  1HC9 B;  5DO6 A;  1JE9 A;  1CTX A;  1HOY A;  5DU1 A;  1TGX A;  4DO8 A;  2CRS A;  1CVO A;  1ERA A;  3EBX A;  1IDL A;  1NXB A;  4AEA A;  2LA1 A;  1QKE A;  2N99 A;  2MFA A;  2L5S A;  2LCR A;  1XT3 A;  2H62 D;  1IK8 A;  2H64 C;  3QB4 B;  1L4W A;  1IDI A;  1NTN A;  1W6B A;  4RUD A;  3FEV A;  1REW C;  3KFD I;  1DRS A;  1NTX A;  1S4Y A;  1I02 A;  2CDX A;  4OM5 A;  1TXA A;  2JQP A;  1FF4 A;  3LAQ U;  1LJZ A;  2UX2 A;  2H8U A;  1KBA A;  1F8U B;  1KFH A;  2H7Z B;  1FAS A;  1NYS A;  5EBX A;  1CDS A;  3BT1 U;  2PJY B;  1V6P A;  1VB0 A;  1ABT A;  1QM7 A;  1CCQ A;  1CDT A;  2FD6 U;  1FSS B;  1HAA A;  1H0J A;  3NDS A;  4BDT B;  1BXP A;  2K3G A;  1G6M A;  2VLW A;  2MJ4 A;  4IYE A;  4OM4 A;  2ABX A;  1NEA A;  2HLQ A;  2UWR A;  1IDG A;  2PJY C;  2QJA C;  1NYU A;  2NBT A;  4FAO E;  1KBS A;  2L03 A;  3NH7 A;  3NEQ A;  2H7Z A;  1LXH A;  1TXB A;  2HLR A;  4LFT A;  3U73 U;  1MAH F;  1RL5 A;  2MJ0 A;  3EVS C;  2H5F A;  1F94 A;  2MJY A;  1JBD A;  2X8B B;  2MHY A;  2BHI A;  1JGK A;  1ES7 B;  1YWH A;  1LXG A;  2ERA A;  1LX5 B;  4P7U A;  1CXN A;  1IKC A;  5DZ5 A;  1IDH A;  4UY2 C;  4HQP F;  1FRA A;  1KTZ B;  3HH7 A;  5IMY C;  2H64 B;  1COD A;  2CCX A;  1KC4 A;  4KSN A;  3BT2 U; 
#chains in the Genus database with same CATH homology
 4FAO C;  1CXO A;  2CTX A;  2CRT A;  4BIK B;  3PLC A;  1M9Z A;  1CDR A;  1ERG A;  1HC9 A;  2GOO B;  2OFS A;  3KFD E;  1CB9 A;  2MUO A;  1KS6 A;  1LSI A;  2GOO C;  1PLO A;  1CDQ A;  1KU6 B;  1NOR A;  1CRF A;  2H62 C;  1CRE A;  1ONJ A;  2BTX A;  1B41 B;  3U74 U;  2QC1 A;  5IMT D;  1FSC A;  1KBT A;  1IJC A;  1CHV S;  2QJB C;  1MR6 A;  1HAJ A;  4ZQY A;  1COE A;  1TFS A;  1KL8 A;  2QJ9 C;  4EY8 B;  1IQ9 A;  1KXI A;  1ZAD A;  2J8B A;  3VTS A;  2MUP A;  1FFJ A;  6EBX A;  1RGJ A;  2JVE A;  1BTE A;  1UG4 A;  1QKD A;  3ERA A;  2I9B E;  4QTI U;  4XJJ A;  1HC9 B;  5DO6 A;  1JE9 A;  1CTX A;  1HOY A;  5DU1 A;  1TGX A;  4DO8 A;  2CRS A;  1CVO A;  1ERA A;  3EBX A;  1IDL A;  1NXB A;  4AEA A;  2LA1 A;  1QKE A;  2N99 A;  2MFA A;  2L5S A;  2LCR A;  1XT3 A;  2H62 D;  1IK8 A;  2H64 C;  3QB4 B;  1L4W A;  1IDI A;  1NTN A;  1W6B A;  4RUD A;  3FEV A;  1REW C;  3KFD I;  1DRS A;  1NTX A;  1S4Y A;  1I02 A;  2CDX A;  4OM5 A;  1TXA A;  2JQP A;  1FF4 A;  3LAQ U;  1LJZ A;  2UX2 A;  2H8U A;  1KBA A;  1F8U B;  1KFH A;  2H7Z B;  1FAS A;  1NYS A;  5EBX A;  1CDS A;  3BT1 U;  2PJY B;  1V6P A;  1VB0 A;  1ABT A;  1QM7 A;  1CCQ A;  1CDT A;  2FD6 U;  1FSS B;  1HAA A;  1H0J A;  3NDS A;  4BDT B;  1BXP A;  2K3G A;  1G6M A;  2VLW A;  2MJ4 A;  4IYE A;  4OM4 A;  2ABX A;  1NEA A;  2HLQ A;  2UWR A;  1IDG A;  2PJY C;  2QJA C;  1NYU A;  2NBT A;  4FAO E;  1KBS A;  2L03 A;  3NH7 A;  3NEQ A;  2H7Z A;  1LXH A;  1TXB A;  2HLR A;  4LFT A;  3U73 U;  1MAH F;  1RL5 A;  2MJ0 A;  3EVS C;  2H5F A;  1F94 A;  2MJY A;  1JBD A;  2X8B B;  2MHY A;  2BHI A;  1JGK A;  1ES7 B;  1YWH A;  1LXG A;  2ERA A;  1LX5 B;  4P7U A;  1CXN A;  1IKC A;  5DZ5 A;  1IDH A;  4UY2 C;  4HQP F;  1FRA A;  1KTZ B;  3HH7 A;  5IMY C;  2H64 B;  1COD A;  2CCX A;  1KC4 A;  4KSN A;  3BT2 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...