1KTZB

Crystal structure of the human tgf-beta type ii receptor extracellular domain in complex with tgf-beta3
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
106
structure length
106
Chain Sequence
PQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSFORMING GROWTH FACTOR BETA 3
publication title Crystal structure of the human TbetaR2 ectodomain--TGF-beta3 complex.
pubmed rcsb
source organism Homo sapiens
molecule tags Cytokine/cytokine receptor
total genus 23
structure length 106
sequence length 106
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2002-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08917 ecTbetaR2 Transforming growth factor beta receptor 2 ectodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ktzB00
4P7UA 1NXBA 2CRTA 1LX5B 2MUPA 3NDSA 2H64C 5DZ5A 5IMYC 1REWC 1FF4A 1VB0A 3ERAA 1CCQA 1M9ZA 1CVOA 4BDTB 1V6PA 3FEVA 1QKEA 2CTXA 1W6BA 1G6MA 1BTEA 1HAAA 3KFDI 4UY2C 2H64B 2MFAA 1IDIA 1HOYA 1L4WA 1ERGA 3NH7A 1DRSA 2LA1A 2MJYA 2QJBC 2QJ9C 3VTSA 1CHVS 2MJ4A 1CDRA 1CXOA 2LCRA 2H62D 4IYEA 1ONJA 4ZQYA 1H0JA 1CTXA 5EBXA 4XJJA 1ABTA 1CDQA 1MR6A 1KTZB 2H62C 1KBSA 1HAJA 2NBTA 1UG4A 1IKCA 4EY8B 1MAHF 1TXAA 4DO8A 1F8UB 4OM4A 3BT1U 1NEAA 1BXPA 1KFHA 1CODA 1KU6B 1LXHA 1FSSB 1F94A 4QTIU 4RUDA 1LJZA 2ABXA 5IMTD 1PLOA 2H5FA 1RL5A 2QJAC 1NORA 5DU1A 1CRFA 2H7ZB 1IJCA 2ERAA 1TGXA 2N99A 2CCXA 1QKDA 2VLWA 1CDTA 2MUOA 3HH7A 1XT3A 1FASA 1KBAA 3U73U 1KL8A 1JBDA 3KFDE 4AEAA 2I9BE 1JE9A 2H8UA 1IDGA 1NTXA 2JQPA 1HC9B 2H7ZA 1CB9A 1LXGA 1IDLA 4OM5A 1S4YA 1FFJA 4HQPF 2MJ0A 1KS6A 2CRSA 4LFTA 4FAOC 2X8BB 1NTNA 2L5SA 4FAOE 1LSIA 1ES7B 3BT2U 1HC9A 6EBXA 1CXNA 2BHIA 1IK8A 2BTXA 1TFSA 3EVSC 1RGJA 3LAQU 1FRAA 1IDHA 2UX2A 1TXBA 3QB4B 5DO6A 2J8BA 2JVEA 2GOOC 2QC1A 2PJYC 1FSCA 2K3GA 3EBXA 1KXIA 1KC4A 1I02A 1ZADA 1CREA 1KBTA 3PLCA 3NEQA 1B41B 1IQ9A 1ERAA 2GOOB 2UWRA 1JGKA 1CDSA 2PJYB 2CDXA 1COEA 2L03A 2HLQA 1NYUA 1QM7A 3U74U 4BIKB 2HLRA 2MHYA 2FD6U 1NYSA 1YWHA 2OFSA
chains in the Genus database with same CATH superfamily
4P7UA 1NXBA 2CRTA 1LX5B 2MUPA 4KSNA 3NDSA 2H64C 5DZ5A 5IMYC 1REWC 1FF4A 1VB0A 3ERAA 1CCQA 1M9ZA 1CVOA 4BDTB 1V6PA 3FEVA 1QKEA 2CTXA 1W6BA 1G6MA 1BTEA 1HAAA 3KFDI 4UY2C 2H64B 2MFAA 1IDIA 1HOYA 1L4WA 1ERGA 3NH7A 1DRSA 2LA1A 2MJYA 2QJBC 2QJ9C 3VTSA 1CHVS 2MJ4A 1CDRA 1CXOA 2LCRA 2H62D 4IYEA 1ONJA 4ZQYA 1H0JA 1CTXA 5EBXA 4XJJA 1ABTA 1CDQA 1MR6A 1KTZB 2H62C 1KBSA 1HAJA 2NBTA 1UG4A 1IKCA 4EY8B 1MAHF 1TXAA 4DO8A 1F8UB 4OM4A 3BT1U 1NEAA 1BXPA 1KFHA 1CODA 1KU6B 1LXHA 1FSSB 1F94A 4QTIU 4RUDA 1LJZA 2ABXA 5IMTD 1PLOA 2H5FA 1RL5A 2QJAC 1NORA 5DU1A 1CRFA 2H7ZB 1IJCA 2ERAA 1TGXA 2N99A 2CCXA 1QKDA 2VLWA 1CDTA 2MUOA 3HH7A 1XT3A 1FASA 1KBAA 3U73U 1KL8A 1JBDA 3KFDE 4AEAA 2I9BE 1JE9A 2H8UA 1IDGA 1NTXA 2JQPA 1HC9B 2H7ZA 1CB9A 1LXGA 1IDLA 4OM5A 1S4YA 1FFJA 4HQPF 2MJ0A 1KS6A 2CRSA 4LFTA 4FAOC 2X8BB 1NTNA 2L5SA 4FAOE 1LSIA 1ES7B 3BT2U 1HC9A 6EBXA 1CXNA 2BHIA 1IK8A 2BTXA 1TFSA 3EVSC 1RGJA 3LAQU 1FRAA 1IDHA 2UX2A 1TXBA 3QB4B 5DO6A 2J8BA 2JVEA 2GOOC 2QC1A 2PJYC 1FSCA 2K3GA 3EBXA 1KXIA 1KC4A 1I02A 1ZADA 1CREA 1KBTA 3PLCA 3NEQA 1B41B 1IQ9A 1ERAA 2GOOB 2UWRA 1JGKA 1CDSA 2PJYB 2CDXA 1COEA 2L03A 2HLQA 1NYUA 1QM7A 3U74U 4BIKB 2HLRA 2MHYA 2FD6U 1NYSA 1YWHA 2OFSA
chains in the Genus database with same CATH topology
4P7UA 1NXBA 2CRTA 1LX5B 2MUPA 4KSNA 3NDSA 2H64C 5DZ5A 5IMYC 1REWC 1FF4A 1VB0A 3ERAA 1CCQA 1M9ZA 1CVOA 4BDTB 1V6PA 3FEVA 1QKEA 2CTXA 1W6BA 1G6MA 1BTEA 1HAAA 3KFDI 4UY2C 2H64B 2MFAA 1IDIA 1HOYA 1L4WA 1ERGA 3NH7A 1DRSA 2LA1A 2MJYA 2QJBC 2QJ9C 3VTSA 1CHVS 2MJ4A 1CDRA 1CXOA 2LCRA 2H62D 4IYEA 1ONJA 4ZQYA 1H0JA 1CTXA 5EBXA 4XJJA 1ABTA 1CDQA 1MR6A 1KTZB 2H62C 1KBSA 1HAJA 2NBTA 1UG4A 1IKCA 4EY8B 1MAHF 1TXAA 4DO8A 1F8UB 4OM4A 3BT1U 1NEAA 1BXPA 1KFHA 1CODA 1KU6B 1LXHA 1FSSB 1F94A 4QTIU 4RUDA 1LJZA 2ABXA 5IMTD 1PLOA 2H5FA 1RL5A 2QJAC 1NORA 5DU1A 1CRFA 2H7ZB 1IJCA 2ERAA 1TGXA 2N99A 2CCXA 1QKDA 2VLWA 1CDTA 2MUOA 3HH7A 1XT3A 1FASA 1KBAA 3U73U 1KL8A 1JBDA 3KFDE 4AEAA 2I9BE 1JE9A 2H8UA 1IDGA 1NTXA 2JQPA 1HC9B 2H7ZA 1CB9A 1LXGA 1IDLA 4OM5A 1S4YA 1FFJA 4HQPF 2MJ0A 1KS6A 2CRSA 4LFTA 4FAOC 2X8BB 1NTNA 2L5SA 4FAOE 1LSIA 1ES7B 3BT2U 1HC9A 6EBXA 1CXNA 2BHIA 1IK8A 2BTXA 1TFSA 3EVSC 1RGJA 3LAQU 1FRAA 1IDHA 2UX2A 1TXBA 3QB4B 5DO6A 2J8BA 2JVEA 2GOOC 2QC1A 2PJYC 1FSCA 2K3GA 3EBXA 1KXIA 1KC4A 1I02A 1ZADA 1CREA 1KBTA 3PLCA 3NEQA 1B41B 1IQ9A 1ERAA 2GOOB 2UWRA 1JGKA 1CDSA 2PJYB 2CDXA 1COEA 2L03A 2HLQA 1NYUA 1QM7A 3U74U 4BIKB 2HLRA 2MHYA 2FD6U 1NYSA 1YWHA 2OFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P7U A;  1NXB A;  2CRT A;  1LX5 B;  2MUP A;  3NDS A;  2H64 C;  5DZ5 A;  5IMY C;  1REW C;  1FF4 A;  1VB0 A;  3ERA A;  1CCQ A;  1M9Z A;  1CVO A;  4BDT B;  1V6P A;  3FEV A;  1QKE A;  2CTX A;  1W6B A;  1G6M A;  1BTE A;  1HAA A;  3KFD I;  4UY2 C;  2H64 B;  2MFA A;  1IDI A;  1HOY A;  1L4W A;  1ERG A;  3NH7 A;  1DRS A;  2LA1 A;  2MJY A;  2QJB C;  2QJ9 C;  3VTS A;  1CHV S;  2MJ4 A;  1CDR A;  1CXO A;  2LCR A;  2H62 D;  4IYE A;  1ONJ A;  4ZQY A;  1H0J A;  1CTX A;  5EBX A;  4XJJ A;  1ABT A;  1CDQ A;  1MR6 A;  1KTZ B;  2H62 C;  1KBS A;  1HAJ A;  2NBT A;  1UG4 A;  1IKC A;  4EY8 B;  1MAH F;  1TXA A;  4DO8 A;  1F8U B;  4OM4 A;  3BT1 U;  1NEA A;  1BXP A;  1KFH A;  1COD A;  1KU6 B;  1LXH A;  1FSS B;  1F94 A;  4QTI U;  4RUD A;  1LJZ A;  2ABX A;  5IMT D;  1PLO A;  2H5F A;  1RL5 A;  2QJA C;  1NOR A;  5DU1 A;  1CRF A;  2H7Z B;  1IJC A;  2ERA A;  1TGX A;  2N99 A;  2CCX A;  1QKD A;  2VLW A;  1CDT A;  2MUO A;  3HH7 A;  1XT3 A;  1FAS A;  1KBA A;  3U73 U;  1KL8 A;  1JBD A;  3KFD E;  4AEA A;  2I9B E;  1JE9 A;  2H8U A;  1IDG A;  1NTX A;  2JQP A;  1HC9 B;  2H7Z A;  1CB9 A;  1LXG A;  1IDL A;  4OM5 A;  1S4Y A;  1FFJ A;  4HQP F;  2MJ0 A;  1KS6 A;  2CRS A;  4LFT A;  4FAO C;  2X8B B;  1NTN A;  2L5S A;  4FAO E;  1LSI A;  1ES7 B;  3BT2 U;  1HC9 A;  6EBX A;  1CXN A;  2BHI A;  1IK8 A;  2BTX A;  1TFS A;  3EVS C;  1RGJ A;  3LAQ U;  1FRA A;  1IDH A;  2UX2 A;  1TXB A;  3QB4 B;  5DO6 A;  2J8B A;  2JVE A;  2GOO C;  2QC1 A;  2PJY C;  1FSC A;  2K3G A;  3EBX A;  1KXI A;  1KC4 A;  1I02 A;  1ZAD A;  1CRE A;  1KBT A;  3PLC A;  3NEQ A;  1B41 B;  1IQ9 A;  1ERA A;  2GOO B;  2UWR A;  1JGK A;  1CDS A;  2PJY B;  2CDX A;  1COE A;  2L03 A;  2HLQ A;  1NYU A;  1QM7 A;  3U74 U;  4BIK B;  2HLR A;  2MHY A;  2FD6 U;  1NYS A;  1YWH A;  2OFS A; 
#chains in the Genus database with same CATH topology
 4P7U A;  1NXB A;  2CRT A;  1LX5 B;  2MUP A;  4KSN A;  3NDS A;  2H64 C;  5DZ5 A;  5IMY C;  1REW C;  1FF4 A;  1VB0 A;  3ERA A;  1CCQ A;  1M9Z A;  1CVO A;  4BDT B;  1V6P A;  3FEV A;  1QKE A;  2CTX A;  1W6B A;  1G6M A;  1BTE A;  1HAA A;  3KFD I;  4UY2 C;  2H64 B;  2MFA A;  1IDI A;  1HOY A;  1L4W A;  1ERG A;  3NH7 A;  1DRS A;  2LA1 A;  2MJY A;  2QJB C;  2QJ9 C;  3VTS A;  1CHV S;  2MJ4 A;  1CDR A;  1CXO A;  2LCR A;  2H62 D;  4IYE A;  1ONJ A;  4ZQY A;  1H0J A;  1CTX A;  5EBX A;  4XJJ A;  1ABT A;  1CDQ A;  1MR6 A;  1KTZ B;  2H62 C;  1KBS A;  1HAJ A;  2NBT A;  1UG4 A;  1IKC A;  4EY8 B;  1MAH F;  1TXA A;  4DO8 A;  1F8U B;  4OM4 A;  3BT1 U;  1NEA A;  1BXP A;  1KFH A;  1COD A;  1KU6 B;  1LXH A;  1FSS B;  1F94 A;  4QTI U;  4RUD A;  1LJZ A;  2ABX A;  5IMT D;  1PLO A;  2H5F A;  1RL5 A;  2QJA C;  1NOR A;  5DU1 A;  1CRF A;  2H7Z B;  1IJC A;  2ERA A;  1TGX A;  2N99 A;  2CCX A;  1QKD A;  2VLW A;  1CDT A;  2MUO A;  3HH7 A;  1XT3 A;  1FAS A;  1KBA A;  3U73 U;  1KL8 A;  1JBD A;  3KFD E;  4AEA A;  2I9B E;  1JE9 A;  2H8U A;  1IDG A;  1NTX A;  2JQP A;  1HC9 B;  2H7Z A;  1CB9 A;  1LXG A;  1IDL A;  4OM5 A;  1S4Y A;  1FFJ A;  4HQP F;  2MJ0 A;  1KS6 A;  2CRS A;  4LFT A;  4FAO C;  2X8B B;  1NTN A;  2L5S A;  4FAO E;  1LSI A;  1ES7 B;  3BT2 U;  1HC9 A;  6EBX A;  1CXN A;  2BHI A;  1IK8 A;  2BTX A;  1TFS A;  3EVS C;  1RGJ A;  3LAQ U;  1FRA A;  1IDH A;  2UX2 A;  1TXB A;  3QB4 B;  5DO6 A;  2J8B A;  2JVE A;  2GOO C;  2QC1 A;  2PJY C;  1FSC A;  2K3G A;  3EBX A;  1KXI A;  1KC4 A;  1I02 A;  1ZAD A;  1CRE A;  1KBT A;  3PLC A;  3NEQ A;  1B41 B;  1IQ9 A;  1ERA A;  2GOO B;  2UWR A;  1JGK A;  1CDS A;  2PJY B;  2CDX A;  1COE A;  2L03 A;  2HLQ A;  1NYU A;  1QM7 A;  3U74 U;  4BIK B;  2HLR A;  2MHY A;  2FD6 U;  1NYS A;  1YWH A;  2OFS A; 
#chains in the Genus database with same CATH homology
 4P7U A;  1NXB A;  2CRT A;  1LX5 B;  2MUP A;  4KSN A;  3NDS A;  2H64 C;  5DZ5 A;  5IMY C;  1REW C;  1FF4 A;  1VB0 A;  3ERA A;  1CCQ A;  1M9Z A;  1CVO A;  4BDT B;  1V6P A;  3FEV A;  1QKE A;  2CTX A;  1W6B A;  1G6M A;  1BTE A;  1HAA A;  3KFD I;  4UY2 C;  2H64 B;  2MFA A;  1IDI A;  1HOY A;  1L4W A;  1ERG A;  3NH7 A;  1DRS A;  2LA1 A;  2MJY A;  2QJB C;  2QJ9 C;  3VTS A;  1CHV S;  2MJ4 A;  1CDR A;  1CXO A;  2LCR A;  2H62 D;  4IYE A;  1ONJ A;  4ZQY A;  1H0J A;  1CTX A;  5EBX A;  4XJJ A;  1ABT A;  1CDQ A;  1MR6 A;  1KTZ B;  2H62 C;  1KBS A;  1HAJ A;  2NBT A;  1UG4 A;  1IKC A;  4EY8 B;  1MAH F;  1TXA A;  4DO8 A;  1F8U B;  4OM4 A;  3BT1 U;  1NEA A;  1BXP A;  1KFH A;  1COD A;  1KU6 B;  1LXH A;  1FSS B;  1F94 A;  4QTI U;  4RUD A;  1LJZ A;  2ABX A;  5IMT D;  1PLO A;  2H5F A;  1RL5 A;  2QJA C;  1NOR A;  5DU1 A;  1CRF A;  2H7Z B;  1IJC A;  2ERA A;  1TGX A;  2N99 A;  2CCX A;  1QKD A;  2VLW A;  1CDT A;  2MUO A;  3HH7 A;  1XT3 A;  1FAS A;  1KBA A;  3U73 U;  1KL8 A;  1JBD A;  3KFD E;  4AEA A;  2I9B E;  1JE9 A;  2H8U A;  1IDG A;  1NTX A;  2JQP A;  1HC9 B;  2H7Z A;  1CB9 A;  1LXG A;  1IDL A;  4OM5 A;  1S4Y A;  1FFJ A;  4HQP F;  2MJ0 A;  1KS6 A;  2CRS A;  4LFT A;  4FAO C;  2X8B B;  1NTN A;  2L5S A;  4FAO E;  1LSI A;  1ES7 B;  3BT2 U;  1HC9 A;  6EBX A;  1CXN A;  2BHI A;  1IK8 A;  2BTX A;  1TFS A;  3EVS C;  1RGJ A;  3LAQ U;  1FRA A;  1IDH A;  2UX2 A;  1TXB A;  3QB4 B;  5DO6 A;  2J8B A;  2JVE A;  2GOO C;  2QC1 A;  2PJY C;  1FSC A;  2K3G A;  3EBX A;  1KXI A;  1KC4 A;  1I02 A;  1ZAD A;  1CRE A;  1KBT A;  3PLC A;  3NEQ A;  1B41 B;  1IQ9 A;  1ERA A;  2GOO B;  2UWR A;  1JGK A;  1CDS A;  2PJY B;  2CDX A;  1COE A;  2L03 A;  2HLQ A;  1NYU A;  1QM7 A;  3U74 U;  4BIK B;  2HLR A;  2MHY A;  2FD6 U;  1NYS A;  1YWH A;  2OFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...