1ERAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ERABUTOXIN B
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1eraA00
1CRFA 2BTXA 2UWRA 4LFTA 4UY2C 1JGKA 4IYEA 1CDQA 2UX2A 3NDSA 2MJ0A 1BXPA 1CDSA 4HQPF 2HLQA 1LSIA 1PLOA 2QJAC 3KFDE 1CREA 3HH7A 2QJBC 4ZQYA 1CXOA 1RGJA 1S4YA 2LA1A 4AEAA 2OFSA 5IMYC 1BTEA 3VTSA 2HLRA 1H0JA 2ABXA 3BT1U 5DZ5A 1F8UB 1TXAA 1KTZB 1RL5A 1CB9A 1FF4A 1KL8A 4FAOC 3BT2U 1LJZA 1CODA 2QC1A 1CTXA 4XJJA 4FAOE 1JE9A 1CHVS 4QTIU 4RUDA 1ZADA 2H62D 5DO6A 4DO8A 5IMTD 2X8BB 2L03A 3QB4B 1HAAA 1QM7A 1DRSA 1QKDA 1FSCA 1ERGA 2LCRA 1CXNA 2L5SA 1KFHA 1V6PA 1YWHA 2CDXA 2FD6U 2CCXA 3U73U 1FRAA 1CCQA 1TXBA 2GOOB 1IJCA 2H62C 1IDGA 2QJ9C 2H7ZA 1MR6A 4BIKB 6EBXA 1L4WA 4OM5A 1IDIA 1M9ZA 2I9BE 2PJYB 3EVSC 1LXGA 1IQ9A 2H64B 4P7UA 4BDTB 2BHIA 1KC4A 1CDRA 2JQPA 2MUOA 1HAJA 1KBAA 1KU6B 1QKEA 2GOOC 1IDLA 3KFDI 1IK8A 1JBDA 2K3GA 1KBSA 2CRSA 1ONJA 1IDHA 2VLWA 1NTXA 1W6BA 2CRTA 5DU1A 1ES7B 1TGXA 1ERAA 2PJYC 2H64C 1FASA 1HOYA 2H8UA 1VB0A 1HC9A 4OM4A 1LX5B 1NTNA 3LAQU 2MJ4A 1KS6A 1NORA 1UG4A 2MUPA 1IKCA 1G6MA 1ABTA 3ERAA 2J8BA 1NYSA 2JVEA 3U74U 1FFJA 1REWC 5EBXA 1TFSA 1HC9B 2CTXA 1F94A 1NYUA 2H7ZB 1I02A 1B41B 2MHYA 3EBXA 1LXHA 1XT3A 1KBTA 1KXIA 3PLCA 2H5FA 2MJYA 1FSSB 4EY8B 2MFAA 1NEAA 2NBTA 3NEQA 1NXBA 1COEA 3FEVA 2N99A 1MAHF 2ERAA 1CVOA 3NH7A 1CDTA
chains in the Genus database with same CATH superfamily
1CRFA 2BTXA 2UWRA 4LFTA 4UY2C 1JGKA 4IYEA 1CDQA 2UX2A 3NDSA 2MJ0A 1BXPA 1CDSA 4HQPF 2HLQA 1LSIA 1PLOA 2QJAC 3KFDE 1CREA 3HH7A 2QJBC 4ZQYA 1CXOA 1RGJA 1S4YA 2LA1A 4AEAA 2OFSA 5IMYC 1BTEA 3VTSA 2HLRA 1H0JA 2ABXA 3BT1U 5DZ5A 1F8UB 1TXAA 1KTZB 1RL5A 1CB9A 1FF4A 1KL8A 4FAOC 3BT2U 1LJZA 1CODA 2QC1A 1CTXA 4XJJA 4FAOE 1JE9A 1CHVS 4QTIU 4RUDA 1ZADA 2H62D 5DO6A 4DO8A 5IMTD 2X8BB 2L03A 3QB4B 1HAAA 1QM7A 1DRSA 1QKDA 1FSCA 1ERGA 2LCRA 1CXNA 2L5SA 1KFHA 1V6PA 1YWHA 2CDXA 2FD6U 2CCXA 3U73U 1FRAA 1CCQA 1TXBA 2GOOB 1IJCA 2H62C 1IDGA 2QJ9C 2H7ZA 1MR6A 4BIKB 6EBXA 1L4WA 4OM5A 1IDIA 1M9ZA 2I9BE 2PJYB 3EVSC 1LXGA 1IQ9A 2H64B 4P7UA 4BDTB 2BHIA 1KC4A 1CDRA 2JQPA 2MUOA 1HAJA 1KBAA 1KU6B 1QKEA 2GOOC 1IDLA 3KFDI 1IK8A 1JBDA 2K3GA 1KBSA 2CRSA 1ONJA 1IDHA 2VLWA 1NTXA 1W6BA 2CRTA 5DU1A 1ES7B 1TGXA 1ERAA 2PJYC 2H64C 1FASA 1HOYA 2H8UA 1VB0A 1HC9A 4OM4A 1LX5B 1NTNA 3LAQU 2MJ4A 1KS6A 1NORA 4KSNA 1UG4A 2MUPA 1IKCA 1G6MA 1ABTA 3ERAA 2J8BA 1NYSA 2JVEA 3U74U 1FFJA 1REWC 5EBXA 1TFSA 1HC9B 2CTXA 1F94A 1NYUA 2H7ZB 1I02A 1B41B 2MHYA 3EBXA 1LXHA 1XT3A 1KBTA 1KXIA 3PLCA 2H5FA 2MJYA 1FSSB 4EY8B 2MFAA 1NEAA 2NBTA 3NEQA 1NXBA 1COEA 3FEVA 2N99A 1MAHF 2ERAA 1CVOA 3NH7A 1CDTA
chains in the Genus database with same CATH topology
1CRFA 2BTXA 2UWRA 4LFTA 4UY2C 1JGKA 4IYEA 1CDQA 2UX2A 3NDSA 2MJ0A 1BXPA 1CDSA 4HQPF 2HLQA 1LSIA 1PLOA 2QJAC 3KFDE 1CREA 3HH7A 2QJBC 4ZQYA 1CXOA 1RGJA 1S4YA 2LA1A 4AEAA 2OFSA 5IMYC 1BTEA 3VTSA 2HLRA 1H0JA 2ABXA 3BT1U 5DZ5A 1F8UB 1TXAA 1KTZB 1RL5A 1CB9A 1FF4A 1KL8A 4FAOC 3BT2U 1LJZA 1CODA 2QC1A 1CTXA 4XJJA 4FAOE 1JE9A 1CHVS 4QTIU 4RUDA 1ZADA 2H62D 5DO6A 4DO8A 5IMTD 2X8BB 2L03A 3QB4B 1HAAA 1QM7A 1DRSA 1QKDA 1FSCA 1ERGA 2LCRA 1CXNA 2L5SA 1KFHA 1V6PA 1YWHA 2CDXA 2FD6U 2CCXA 3U73U 1FRAA 1CCQA 1TXBA 2GOOB 1IJCA 2H62C 1IDGA 2QJ9C 2H7ZA 1MR6A 4BIKB 6EBXA 1L4WA 4OM5A 1IDIA 1M9ZA 2I9BE 2PJYB 3EVSC 1LXGA 1IQ9A 2H64B 4P7UA 4BDTB 2BHIA 1KC4A 1CDRA 2JQPA 2MUOA 1HAJA 1KBAA 1KU6B 1QKEA 2GOOC 1IDLA 3KFDI 1IK8A 1JBDA 2K3GA 1KBSA 2CRSA 1ONJA 1IDHA 2VLWA 1NTXA 1W6BA 2CRTA 5DU1A 1ES7B 1TGXA 1ERAA 2PJYC 2H64C 1FASA 1HOYA 2H8UA 1VB0A 1HC9A 4OM4A 1LX5B 1NTNA 3LAQU 2MJ4A 1KS6A 1NORA 4KSNA 1UG4A 2MUPA 1IKCA 1G6MA 1ABTA 3ERAA 2J8BA 1NYSA 2JVEA 3U74U 1FFJA 1REWC 5EBXA 1TFSA 1HC9B 2CTXA 1F94A 1NYUA 2H7ZB 1I02A 1B41B 2MHYA 3EBXA 1LXHA 1XT3A 1KBTA 1KXIA 3PLCA 2H5FA 2MJYA 1FSSB 4EY8B 2MFAA 1NEAA 2NBTA 3NEQA 1NXBA 1COEA 3FEVA 2N99A 1MAHF 2ERAA 1CVOA 3NH7A 1CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CRF A;  2BTX A;  2UWR A;  4LFT A;  4UY2 C;  1JGK A;  4IYE A;  1CDQ A;  2UX2 A;  3NDS A;  2MJ0 A;  1BXP A;  1CDS A;  4HQP F;  2HLQ A;  1LSI A;  1PLO A;  2QJA C;  3KFD E;  1CRE A;  3HH7 A;  2QJB C;  4ZQY A;  1CXO A;  1RGJ A;  1S4Y A;  2LA1 A;  4AEA A;  2OFS A;  5IMY C;  1BTE A;  3VTS A;  2HLR A;  1H0J A;  2ABX A;  3BT1 U;  5DZ5 A;  1F8U B;  1TXA A;  1KTZ B;  1RL5 A;  1CB9 A;  1FF4 A;  1KL8 A;  4FAO C;  3BT2 U;  1LJZ A;  1COD A;  2QC1 A;  1CTX A;  4XJJ A;  4FAO E;  1JE9 A;  1CHV S;  4QTI U;  4RUD A;  1ZAD A;  2H62 D;  5DO6 A;  4DO8 A;  5IMT D;  2X8B B;  2L03 A;  3QB4 B;  1HAA A;  1QM7 A;  1DRS A;  1QKD A;  1FSC A;  1ERG A;  2LCR A;  1CXN A;  2L5S A;  1KFH A;  1V6P A;  1YWH A;  2CDX A;  2FD6 U;  2CCX A;  3U73 U;  1FRA A;  1CCQ A;  1TXB A;  2GOO B;  1IJC A;  2H62 C;  1IDG A;  2QJ9 C;  2H7Z A;  1MR6 A;  4BIK B;  6EBX A;  1L4W A;  4OM5 A;  1IDI A;  1M9Z A;  2I9B E;  2PJY B;  3EVS C;  1LXG A;  1IQ9 A;  2H64 B;  4P7U A;  4BDT B;  2BHI A;  1KC4 A;  1CDR A;  2JQP A;  2MUO A;  1HAJ A;  1KBA A;  1KU6 B;  1QKE A;  2GOO C;  1IDL A;  3KFD I;  1IK8 A;  1JBD A;  2K3G A;  1KBS A;  2CRS A;  1ONJ A;  1IDH A;  2VLW A;  1NTX A;  1W6B A;  2CRT A;  5DU1 A;  1ES7 B;  1TGX A;  1ERA A;  2PJY C;  2H64 C;  1FAS A;  1HOY A;  2H8U A;  1VB0 A;  1HC9 A;  4OM4 A;  1LX5 B;  1NTN A;  3LAQ U;  2MJ4 A;  1KS6 A;  1NOR A;  1UG4 A;  2MUP A;  1IKC A;  1G6M A;  1ABT A;  3ERA A;  2J8B A;  1NYS A;  2JVE A;  3U74 U;  1FFJ A;  1REW C;  5EBX A;  1TFS A;  1HC9 B;  2CTX A;  1F94 A;  1NYU A;  2H7Z B;  1I02 A;  1B41 B;  2MHY A;  3EBX A;  1LXH A;  1XT3 A;  1KBT A;  1KXI A;  3PLC A;  2H5F A;  2MJY A;  1FSS B;  4EY8 B;  2MFA A;  1NEA A;  2NBT A;  3NEQ A;  1NXB A;  1COE A;  3FEV A;  2N99 A;  1MAH F;  2ERA A;  1CVO A;  3NH7 A;  1CDT A; 
#chains in the Genus database with same CATH topology
 1CRF A;  2BTX A;  2UWR A;  4LFT A;  4UY2 C;  1JGK A;  4IYE A;  1CDQ A;  2UX2 A;  3NDS A;  2MJ0 A;  1BXP A;  1CDS A;  4HQP F;  2HLQ A;  1LSI A;  1PLO A;  2QJA C;  3KFD E;  1CRE A;  3HH7 A;  2QJB C;  4ZQY A;  1CXO A;  1RGJ A;  1S4Y A;  2LA1 A;  4AEA A;  2OFS A;  5IMY C;  1BTE A;  3VTS A;  2HLR A;  1H0J A;  2ABX A;  3BT1 U;  5DZ5 A;  1F8U B;  1TXA A;  1KTZ B;  1RL5 A;  1CB9 A;  1FF4 A;  1KL8 A;  4FAO C;  3BT2 U;  1LJZ A;  1COD A;  2QC1 A;  1CTX A;  4XJJ A;  4FAO E;  1JE9 A;  1CHV S;  4QTI U;  4RUD A;  1ZAD A;  2H62 D;  5DO6 A;  4DO8 A;  5IMT D;  2X8B B;  2L03 A;  3QB4 B;  1HAA A;  1QM7 A;  1DRS A;  1QKD A;  1FSC A;  1ERG A;  2LCR A;  1CXN A;  2L5S A;  1KFH A;  1V6P A;  1YWH A;  2CDX A;  2FD6 U;  2CCX A;  3U73 U;  1FRA A;  1CCQ A;  1TXB A;  2GOO B;  1IJC A;  2H62 C;  1IDG A;  2QJ9 C;  2H7Z A;  1MR6 A;  4BIK B;  6EBX A;  1L4W A;  4OM5 A;  1IDI A;  1M9Z A;  2I9B E;  2PJY B;  3EVS C;  1LXG A;  1IQ9 A;  2H64 B;  4P7U A;  4BDT B;  2BHI A;  1KC4 A;  1CDR A;  2JQP A;  2MUO A;  1HAJ A;  1KBA A;  1KU6 B;  1QKE A;  2GOO C;  1IDL A;  3KFD I;  1IK8 A;  1JBD A;  2K3G A;  1KBS A;  2CRS A;  1ONJ A;  1IDH A;  2VLW A;  1NTX A;  1W6B A;  2CRT A;  5DU1 A;  1ES7 B;  1TGX A;  1ERA A;  2PJY C;  2H64 C;  1FAS A;  1HOY A;  2H8U A;  1VB0 A;  1HC9 A;  4OM4 A;  1LX5 B;  1NTN A;  3LAQ U;  2MJ4 A;  1KS6 A;  1NOR A;  4KSN A;  1UG4 A;  2MUP A;  1IKC A;  1G6M A;  1ABT A;  3ERA A;  2J8B A;  1NYS A;  2JVE A;  3U74 U;  1FFJ A;  1REW C;  5EBX A;  1TFS A;  1HC9 B;  2CTX A;  1F94 A;  1NYU A;  2H7Z B;  1I02 A;  1B41 B;  2MHY A;  3EBX A;  1LXH A;  1XT3 A;  1KBT A;  1KXI A;  3PLC A;  2H5F A;  2MJY A;  1FSS B;  4EY8 B;  2MFA A;  1NEA A;  2NBT A;  3NEQ A;  1NXB A;  1COE A;  3FEV A;  2N99 A;  1MAH F;  2ERA A;  1CVO A;  3NH7 A;  1CDT A; 
#chains in the Genus database with same CATH homology
 1CRF A;  2BTX A;  2UWR A;  4LFT A;  4UY2 C;  1JGK A;  4IYE A;  1CDQ A;  2UX2 A;  3NDS A;  2MJ0 A;  1BXP A;  1CDS A;  4HQP F;  2HLQ A;  1LSI A;  1PLO A;  2QJA C;  3KFD E;  1CRE A;  3HH7 A;  2QJB C;  4ZQY A;  1CXO A;  1RGJ A;  1S4Y A;  2LA1 A;  4AEA A;  2OFS A;  5IMY C;  1BTE A;  3VTS A;  2HLR A;  1H0J A;  2ABX A;  3BT1 U;  5DZ5 A;  1F8U B;  1TXA A;  1KTZ B;  1RL5 A;  1CB9 A;  1FF4 A;  1KL8 A;  4FAO C;  3BT2 U;  1LJZ A;  1COD A;  2QC1 A;  1CTX A;  4XJJ A;  4FAO E;  1JE9 A;  1CHV S;  4QTI U;  4RUD A;  1ZAD A;  2H62 D;  5DO6 A;  4DO8 A;  5IMT D;  2X8B B;  2L03 A;  3QB4 B;  1HAA A;  1QM7 A;  1DRS A;  1QKD A;  1FSC A;  1ERG A;  2LCR A;  1CXN A;  2L5S A;  1KFH A;  1V6P A;  1YWH A;  2CDX A;  2FD6 U;  2CCX A;  3U73 U;  1FRA A;  1CCQ A;  1TXB A;  2GOO B;  1IJC A;  2H62 C;  1IDG A;  2QJ9 C;  2H7Z A;  1MR6 A;  4BIK B;  6EBX A;  1L4W A;  4OM5 A;  1IDI A;  1M9Z A;  2I9B E;  2PJY B;  3EVS C;  1LXG A;  1IQ9 A;  2H64 B;  4P7U A;  4BDT B;  2BHI A;  1KC4 A;  1CDR A;  2JQP A;  2MUO A;  1HAJ A;  1KBA A;  1KU6 B;  1QKE A;  2GOO C;  1IDL A;  3KFD I;  1IK8 A;  1JBD A;  2K3G A;  1KBS A;  2CRS A;  1ONJ A;  1IDH A;  2VLW A;  1NTX A;  1W6B A;  2CRT A;  5DU1 A;  1ES7 B;  1TGX A;  1ERA A;  2PJY C;  2H64 C;  1FAS A;  1HOY A;  2H8U A;  1VB0 A;  1HC9 A;  4OM4 A;  1LX5 B;  1NTN A;  3LAQ U;  2MJ4 A;  1KS6 A;  1NOR A;  4KSN A;  1UG4 A;  2MUP A;  1IKC A;  1G6M A;  1ABT A;  3ERA A;  2J8B A;  1NYS A;  2JVE A;  3U74 U;  1FFJ A;  1REW C;  5EBX A;  1TFS A;  1HC9 B;  2CTX A;  1F94 A;  1NYU A;  2H7Z B;  1I02 A;  1B41 B;  2MHY A;  3EBX A;  1LXH A;  1XT3 A;  1KBT A;  1KXI A;  3PLC A;  2H5F A;  2MJY A;  1FSS B;  4EY8 B;  2MFA A;  1NEA A;  2NBT A;  3NEQ A;  1NXB A;  1COE A;  3FEV A;  2N99 A;  1MAH F;  2ERA A;  1CVO A;  3NH7 A;  1CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...