1ERAA

Tertiary structure of erabutoxin b in aqueous solution elucidated by two-dimensional nuclear magnetic resonance
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
62
structure length
62
Chain Sequence
b'RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN B
publication title Tertiary structure of erabutoxin b in aqueous solution as elucidated by two-dimensional nuclear magnetic resonance.
pubmed doi rcsb
source organism Laticauda semifasciata
molecule tags Toxin
total genus 9
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1994-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1eraA00
2NBTA 1MR6A 1IJCA 1QKDA 4EY8B 3NEQA 1ES7B 1NORA 2QJ9C 2H64B 1IK8A 1H0JA 1HC9B 2K3GA 4BIKB 1KS6A 3VTSA 3KFDE 1LSIA 1BXPA 1QM7A 3EBXA 4FAOE 1IKCA 2JVEA 1CB9A 1HOYA 3KFDI 1RL5A 1M9ZA 1NYSA 2GOOB 2HLRA 1IQ9A 1MAHF 1NTNA 2PJYB 5DU1A 1JBDA 2JQPA 1V6PA 2H64C 2LA1A 1LJZA 2BTXA 1NYUA 1CXNA 1ONJA 2L5SA 1G6MA 2MJ4A 2H62C 4AEAA 1IDLA 5DZ5A 2X8BB 1B41B 2MUOA 1CRFA 2N99A 4UY2C 2H7ZA 1FRAA 1BTEA 4ZQYA 2GOOC 2BHIA 1ABTA 2FD6U 1XT3A 2PJYC 2ABXA 2CDXA 1CHVS 2MHYA 4IYEA 1HAAA 1L4WA 5DO6A 1KBAA 2VLWA 1HAJA 2MUPA 2H7ZB 1CTXA 1TXBA 1PLOA 1NTXA 2MFAA 3HH7A 1COEA 2OFSA 2CTXA 2MJ0A 1FSSB 3QB4B 1LXHA 1FASA 1YWHA 3LAQU 1CDSA 2CRSA 1JGKA 2H62D 2QC1A 2H5FA 4LFTA 1TGXA 4OM5A 1NEAA 1CCQA 1ERAA 1KL8A 5IMYC 2QJAC 1KTZB 1TXAA 4BDTB 2UWRA 4HQPF 1TFSA 1CDRA 4OM4A 1ZADA 1CDTA 1QKEA 3BT1U 1DRSA 1NXBA 1I02A 2ERAA 1LX5B 4XJJA 1KBSA 1KFHA 3NDSA 2J8BA 2QJBC 3PLCA 1FFJA 1CREA 1RGJA 2CRTA 1W6BA 2H8UA 3FEVA 4QTIU 2CCXA 1IDGA 2I9BE 1CODA 4P7UA 3U73U 1KC4A 2MJYA 3ERAA 1REWC 3BT2U 1F94A 1IDIA 1KBTA 4RUDA 1F8UB 2HLQA 1JE9A 5EBXA 3EVSC 1KU6B 2UX2A 4DO8A 3NH7A 5IMTD 1CDQA 1UG4A 1CXOA 3U74U 1HC9A 1KXIA 1VB0A 1IDHA 1S4YA 4FAOC 1FF4A 2LCRA 6EBXA 1ERGA 2L03A 1CVOA 1FSCA 1LXGA
chains in the Genus database with same CATH superfamily
2NBTA 1MR6A 1IJCA 1QKDA 4EY8B 3NEQA 1ES7B 1NORA 2QJ9C 2H64B 1IK8A 1H0JA 1HC9B 2K3GA 4BIKB 1KS6A 3VTSA 3KFDE 1LSIA 1BXPA 1QM7A 3EBXA 4FAOE 1IKCA 2JVEA 1CB9A 1HOYA 3KFDI 1RL5A 1M9ZA 1NYSA 2GOOB 2HLRA 1IQ9A 1MAHF 1NTNA 2PJYB 5DU1A 1JBDA 2JQPA 1V6PA 2H64C 2LA1A 1LJZA 2BTXA 1NYUA 1CXNA 1ONJA 2L5SA 1G6MA 2MJ4A 2H62C 4AEAA 1IDLA 5DZ5A 2X8BB 1B41B 2MUOA 1CRFA 2N99A 4UY2C 2H7ZA 1FRAA 1BTEA 4ZQYA 2GOOC 2BHIA 1ABTA 2FD6U 4KSNA 1XT3A 2PJYC 2ABXA 2CDXA 1CHVS 2MHYA 4IYEA 1HAAA 1L4WA 5DO6A 1KBAA 2VLWA 1HAJA 2MUPA 2H7ZB 1CTXA 1TXBA 1PLOA 1NTXA 2MFAA 3HH7A 1COEA 2OFSA 2CTXA 2MJ0A 1FSSB 3QB4B 1LXHA 1FASA 1YWHA 3LAQU 1CDSA 2CRSA 1JGKA 2H62D 2QC1A 2H5FA 4LFTA 1TGXA 4OM5A 1NEAA 1CCQA 1ERAA 1KL8A 5IMYC 2QJAC 1KTZB 1TXAA 4BDTB 2UWRA 4HQPF 1TFSA 1CDRA 4OM4A 1ZADA 1CDTA 1QKEA 3BT1U 1DRSA 1NXBA 1I02A 2ERAA 1LX5B 4XJJA 1KBSA 1KFHA 3NDSA 2J8BA 2QJBC 3PLCA 1FFJA 1CREA 1RGJA 2CRTA 1W6BA 2H8UA 3FEVA 4QTIU 2CCXA 1IDGA 2I9BE 1CODA 4P7UA 3U73U 1KC4A 2MJYA 3ERAA 1REWC 3BT2U 1F94A 1IDIA 1KBTA 4RUDA 1F8UB 2HLQA 1JE9A 5EBXA 3EVSC 1KU6B 2UX2A 4DO8A 3NH7A 5IMTD 1CDQA 1UG4A 1CXOA 3U74U 1HC9A 1KXIA 1VB0A 1IDHA 1S4YA 4FAOC 1FF4A 2LCRA 6EBXA 1ERGA 2L03A 1CVOA 1FSCA 1LXGA
chains in the Genus database with same CATH topology
2NBTA 1MR6A 1IJCA 1QKDA 4EY8B 3NEQA 1ES7B 1NORA 2QJ9C 2H64B 1IK8A 1H0JA 1HC9B 2K3GA 4BIKB 1KS6A 3VTSA 3KFDE 1LSIA 1BXPA 1QM7A 3EBXA 4FAOE 1IKCA 2JVEA 1CB9A 1HOYA 3KFDI 1RL5A 1M9ZA 1NYSA 2GOOB 2HLRA 1IQ9A 1MAHF 1NTNA 2PJYB 5DU1A 1JBDA 2JQPA 1V6PA 2H64C 2LA1A 1LJZA 2BTXA 1NYUA 1CXNA 1ONJA 2L5SA 1G6MA 2MJ4A 2H62C 4AEAA 1IDLA 5DZ5A 2X8BB 1B41B 2MUOA 1CRFA 2N99A 4UY2C 2H7ZA 1FRAA 1BTEA 4ZQYA 2GOOC 2BHIA 1ABTA 2FD6U 4KSNA 1XT3A 2PJYC 2ABXA 2CDXA 1CHVS 2MHYA 4IYEA 1HAAA 1L4WA 5DO6A 1KBAA 2VLWA 1HAJA 2MUPA 2H7ZB 1CTXA 1TXBA 1PLOA 1NTXA 2MFAA 3HH7A 1COEA 2OFSA 2CTXA 2MJ0A 1FSSB 3QB4B 1LXHA 1FASA 1YWHA 3LAQU 1CDSA 2CRSA 1JGKA 2H62D 2QC1A 2H5FA 4LFTA 1TGXA 4OM5A 1NEAA 1CCQA 1ERAA 1KL8A 5IMYC 2QJAC 1KTZB 1TXAA 4BDTB 2UWRA 4HQPF 1TFSA 1CDRA 4OM4A 1ZADA 1CDTA 1QKEA 3BT1U 1DRSA 1NXBA 1I02A 2ERAA 1LX5B 4XJJA 1KBSA 1KFHA 3NDSA 2J8BA 2QJBC 3PLCA 1FFJA 1CREA 1RGJA 2CRTA 1W6BA 2H8UA 3FEVA 4QTIU 2CCXA 1IDGA 2I9BE 1CODA 4P7UA 3U73U 1KC4A 2MJYA 3ERAA 1REWC 3BT2U 1F94A 1IDIA 1KBTA 4RUDA 1F8UB 2HLQA 1JE9A 5EBXA 3EVSC 1KU6B 2UX2A 4DO8A 3NH7A 5IMTD 1CDQA 1UG4A 1CXOA 3U74U 1HC9A 1KXIA 1VB0A 1IDHA 1S4YA 4FAOC 1FF4A 2LCRA 6EBXA 1ERGA 2L03A 1CVOA 1FSCA 1LXGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NBT A;  1MR6 A;  1IJC A;  1QKD A;  4EY8 B;  3NEQ A;  1ES7 B;  1NOR A;  2QJ9 C;  2H64 B;  1IK8 A;  1H0J A;  1HC9 B;  2K3G A;  4BIK B;  1KS6 A;  3VTS A;  3KFD E;  1LSI A;  1BXP A;  1QM7 A;  3EBX A;  4FAO E;  1IKC A;  2JVE A;  1CB9 A;  1HOY A;  3KFD I;  1RL5 A;  1M9Z A;  1NYS A;  2GOO B;  2HLR A;  1IQ9 A;  1MAH F;  1NTN A;  2PJY B;  5DU1 A;  1JBD A;  2JQP A;  1V6P A;  2H64 C;  2LA1 A;  1LJZ A;  2BTX A;  1NYU A;  1CXN A;  1ONJ A;  2L5S A;  1G6M A;  2MJ4 A;  2H62 C;  4AEA A;  1IDL A;  5DZ5 A;  2X8B B;  1B41 B;  2MUO A;  1CRF A;  2N99 A;  4UY2 C;  2H7Z A;  1FRA A;  1BTE A;  4ZQY A;  2GOO C;  2BHI A;  1ABT A;  2FD6 U;  1XT3 A;  2PJY C;  2ABX A;  2CDX A;  1CHV S;  2MHY A;  4IYE A;  1HAA A;  1L4W A;  5DO6 A;  1KBA A;  2VLW A;  1HAJ A;  2MUP A;  2H7Z B;  1CTX A;  1TXB A;  1PLO A;  1NTX A;  2MFA A;  3HH7 A;  1COE A;  2OFS A;  2CTX A;  2MJ0 A;  1FSS B;  3QB4 B;  1LXH A;  1FAS A;  1YWH A;  3LAQ U;  1CDS A;  2CRS A;  1JGK A;  2H62 D;  2QC1 A;  2H5F A;  4LFT A;  1TGX A;  4OM5 A;  1NEA A;  1CCQ A;  1ERA A;  1KL8 A;  5IMY C;  2QJA C;  1KTZ B;  1TXA A;  4BDT B;  2UWR A;  4HQP F;  1TFS A;  1CDR A;  4OM4 A;  1ZAD A;  1CDT A;  1QKE A;  3BT1 U;  1DRS A;  1NXB A;  1I02 A;  2ERA A;  1LX5 B;  4XJJ A;  1KBS A;  1KFH A;  3NDS A;  2J8B A;  2QJB C;  3PLC A;  1FFJ A;  1CRE A;  1RGJ A;  2CRT A;  1W6B A;  2H8U A;  3FEV A;  4QTI U;  2CCX A;  1IDG A;  2I9B E;  1COD A;  4P7U A;  3U73 U;  1KC4 A;  2MJY A;  3ERA A;  1REW C;  3BT2 U;  1F94 A;  1IDI A;  1KBT A;  4RUD A;  1F8U B;  2HLQ A;  1JE9 A;  5EBX A;  3EVS C;  1KU6 B;  2UX2 A;  4DO8 A;  3NH7 A;  5IMT D;  1CDQ A;  1UG4 A;  1CXO A;  3U74 U;  1HC9 A;  1KXI A;  1VB0 A;  1IDH A;  1S4Y A;  4FAO C;  1FF4 A;  2LCR A;  6EBX A;  1ERG A;  2L03 A;  1CVO A;  1FSC A;  1LXG A; 
#chains in the Genus database with same CATH topology
 2NBT A;  1MR6 A;  1IJC A;  1QKD A;  4EY8 B;  3NEQ A;  1ES7 B;  1NOR A;  2QJ9 C;  2H64 B;  1IK8 A;  1H0J A;  1HC9 B;  2K3G A;  4BIK B;  1KS6 A;  3VTS A;  3KFD E;  1LSI A;  1BXP A;  1QM7 A;  3EBX A;  4FAO E;  1IKC A;  2JVE A;  1CB9 A;  1HOY A;  3KFD I;  1RL5 A;  1M9Z A;  1NYS A;  2GOO B;  2HLR A;  1IQ9 A;  1MAH F;  1NTN A;  2PJY B;  5DU1 A;  1JBD A;  2JQP A;  1V6P A;  2H64 C;  2LA1 A;  1LJZ A;  2BTX A;  1NYU A;  1CXN A;  1ONJ A;  2L5S A;  1G6M A;  2MJ4 A;  2H62 C;  4AEA A;  1IDL A;  5DZ5 A;  2X8B B;  1B41 B;  2MUO A;  1CRF A;  2N99 A;  4UY2 C;  2H7Z A;  1FRA A;  1BTE A;  4ZQY A;  2GOO C;  2BHI A;  1ABT A;  2FD6 U;  4KSN A;  1XT3 A;  2PJY C;  2ABX A;  2CDX A;  1CHV S;  2MHY A;  4IYE A;  1HAA A;  1L4W A;  5DO6 A;  1KBA A;  2VLW A;  1HAJ A;  2MUP A;  2H7Z B;  1CTX A;  1TXB A;  1PLO A;  1NTX A;  2MFA A;  3HH7 A;  1COE A;  2OFS A;  2CTX A;  2MJ0 A;  1FSS B;  3QB4 B;  1LXH A;  1FAS A;  1YWH A;  3LAQ U;  1CDS A;  2CRS A;  1JGK A;  2H62 D;  2QC1 A;  2H5F A;  4LFT A;  1TGX A;  4OM5 A;  1NEA A;  1CCQ A;  1ERA A;  1KL8 A;  5IMY C;  2QJA C;  1KTZ B;  1TXA A;  4BDT B;  2UWR A;  4HQP F;  1TFS A;  1CDR A;  4OM4 A;  1ZAD A;  1CDT A;  1QKE A;  3BT1 U;  1DRS A;  1NXB A;  1I02 A;  2ERA A;  1LX5 B;  4XJJ A;  1KBS A;  1KFH A;  3NDS A;  2J8B A;  2QJB C;  3PLC A;  1FFJ A;  1CRE A;  1RGJ A;  2CRT A;  1W6B A;  2H8U A;  3FEV A;  4QTI U;  2CCX A;  1IDG A;  2I9B E;  1COD A;  4P7U A;  3U73 U;  1KC4 A;  2MJY A;  3ERA A;  1REW C;  3BT2 U;  1F94 A;  1IDI A;  1KBT A;  4RUD A;  1F8U B;  2HLQ A;  1JE9 A;  5EBX A;  3EVS C;  1KU6 B;  2UX2 A;  4DO8 A;  3NH7 A;  5IMT D;  1CDQ A;  1UG4 A;  1CXO A;  3U74 U;  1HC9 A;  1KXI A;  1VB0 A;  1IDH A;  1S4Y A;  4FAO C;  1FF4 A;  2LCR A;  6EBX A;  1ERG A;  2L03 A;  1CVO A;  1FSC A;  1LXG A; 
#chains in the Genus database with same CATH homology
 2NBT A;  1MR6 A;  1IJC A;  1QKD A;  4EY8 B;  3NEQ A;  1ES7 B;  1NOR A;  2QJ9 C;  2H64 B;  1IK8 A;  1H0J A;  1HC9 B;  2K3G A;  4BIK B;  1KS6 A;  3VTS A;  3KFD E;  1LSI A;  1BXP A;  1QM7 A;  3EBX A;  4FAO E;  1IKC A;  2JVE A;  1CB9 A;  1HOY A;  3KFD I;  1RL5 A;  1M9Z A;  1NYS A;  2GOO B;  2HLR A;  1IQ9 A;  1MAH F;  1NTN A;  2PJY B;  5DU1 A;  1JBD A;  2JQP A;  1V6P A;  2H64 C;  2LA1 A;  1LJZ A;  2BTX A;  1NYU A;  1CXN A;  1ONJ A;  2L5S A;  1G6M A;  2MJ4 A;  2H62 C;  4AEA A;  1IDL A;  5DZ5 A;  2X8B B;  1B41 B;  2MUO A;  1CRF A;  2N99 A;  4UY2 C;  2H7Z A;  1FRA A;  1BTE A;  4ZQY A;  2GOO C;  2BHI A;  1ABT A;  2FD6 U;  4KSN A;  1XT3 A;  2PJY C;  2ABX A;  2CDX A;  1CHV S;  2MHY A;  4IYE A;  1HAA A;  1L4W A;  5DO6 A;  1KBA A;  2VLW A;  1HAJ A;  2MUP A;  2H7Z B;  1CTX A;  1TXB A;  1PLO A;  1NTX A;  2MFA A;  3HH7 A;  1COE A;  2OFS A;  2CTX A;  2MJ0 A;  1FSS B;  3QB4 B;  1LXH A;  1FAS A;  1YWH A;  3LAQ U;  1CDS A;  2CRS A;  1JGK A;  2H62 D;  2QC1 A;  2H5F A;  4LFT A;  1TGX A;  4OM5 A;  1NEA A;  1CCQ A;  1ERA A;  1KL8 A;  5IMY C;  2QJA C;  1KTZ B;  1TXA A;  4BDT B;  2UWR A;  4HQP F;  1TFS A;  1CDR A;  4OM4 A;  1ZAD A;  1CDT A;  1QKE A;  3BT1 U;  1DRS A;  1NXB A;  1I02 A;  2ERA A;  1LX5 B;  4XJJ A;  1KBS A;  1KFH A;  3NDS A;  2J8B A;  2QJB C;  3PLC A;  1FFJ A;  1CRE A;  1RGJ A;  2CRT A;  1W6B A;  2H8U A;  3FEV A;  4QTI U;  2CCX A;  1IDG A;  2I9B E;  1COD A;  4P7U A;  3U73 U;  1KC4 A;  2MJY A;  3ERA A;  1REW C;  3BT2 U;  1F94 A;  1IDI A;  1KBT A;  4RUD A;  1F8U B;  2HLQ A;  1JE9 A;  5EBX A;  3EVS C;  1KU6 B;  2UX2 A;  4DO8 A;  3NH7 A;  5IMT D;  1CDQ A;  1UG4 A;  1CXO A;  3U74 U;  1HC9 A;  1KXI A;  1VB0 A;  1IDH A;  1S4Y A;  4FAO C;  1FF4 A;  2LCR A;  6EBX A;  1ERG A;  2L03 A;  1CVO A;  1FSC A;  1LXG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...