2CRTA

Cardiotoxin iii from taiwan cobra (naja naja atra) determination of structure in solution and comparison with short neurotoxins
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
b'LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN III
publication title Cardiotoxin III from the Taiwan cobra (Naja naja atra). Determination of structure in solution and comparison with short neurotoxins.
pubmed doi rcsb
source organism Naja atra
molecule tags Cardiotoxin
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2crtA00
2K3GA 1REWC 2QJAC 2MUOA 1KL8A 1COEA 1KFHA 2GOOC 1NEAA 3VTSA 1ZADA 1W6BA 1TFSA 2PJYC 4OM4A 4OM5A 1NYUA 1LJZA 1CVOA 1YWHA 1JGKA 1KU6B 1UG4A 1V6PA 2VLWA 2MUPA 4BIKB 1CDSA 1QM7A 3QB4B 2ABXA 1HAJA 1DRSA 1LX5B 1IDHA 1B41B 1IJCA 1JE9A 4FAOE 2MJ4A 1XT3A 2BTXA 1CXOA 2QJBC 1FF4A 2OFSA 1H0JA 3NEQA 4BDTB 1HAAA 1KTZB 3U73U 2L5SA 2J8BA 1M9ZA 1LXHA 1IK8A 1F8UB 2N99A 1KS6A 1KBSA 2H5FA 1NYSA 3LAQU 2LA1A 2H64B 2MHYA 5IMYC 1BTEA 2MFAA 1JBDA 4FAOC 1BXPA 1IDGA 2X8BB 1HC9A 4EY8B 2CRTA 1QKDA 1TGXA 5IMTD 2H64C 1FASA 3BT1U 1CDTA 5DO6A 1CDQA 1TXAA 2H62C 1LSIA 2CTXA 2QC1A 1I02A 2H62D 2H8UA 4DO8A 1CXNA 2H7ZB 4HQPF 1FSSB 1IKCA 4IYEA 2UWRA 2MJYA 1FRAA 1FFJA 1CCQA 2CCXA 1F94A 3FEVA 4RUDA 1CREA 2LCRA 2UX2A 4P7UA 3NH7A 5DZ5A 2JQPA 4ZQYA 1CTXA 1NTXA 5DU1A 1KBTA 2CDXA 2ERAA 1FSCA 1NTNA 1MR6A 3EVSC 1LXGA 1VB0A 1PLOA 5EBXA 1ERAA 1ONJA 1IDIA 1KC4A 2GOOB 1ABTA 3BT2U 2I9BE 1CB9A 2JVEA 2L03A 4AEAA 1ERGA 1ES7B 1L4WA 1NORA 1CODA 1HOYA 1IDLA 2BHIA 3NDSA 1KXIA 1RL5A 4XJJA 1CRFA 1MAHF 1QKEA 1NXBA 4UY2C 1CHVS 1G6MA 4QTIU 3U74U 2H7ZA 3HH7A 6EBXA 3KFDE 4LFTA 1CDRA 2FD6U 1TXBA 1S4YA 2MJ0A 3PLCA 1IQ9A 1RGJA 1HC9B 2QJ9C 3EBXA 2NBTA 3ERAA 3KFDI 2CRSA 2HLRA 2PJYB 2HLQA 1KBAA
chains in the Genus database with same CATH superfamily
2K3GA 1REWC 2QJAC 2MUOA 1KL8A 1COEA 1KFHA 2GOOC 1NEAA 3VTSA 1ZADA 1W6BA 1TFSA 2PJYC 4OM4A 4OM5A 1NYUA 1LJZA 1CVOA 1YWHA 1JGKA 1KU6B 1UG4A 1V6PA 2VLWA 2MUPA 4BIKB 1CDSA 1QM7A 3QB4B 2ABXA 1HAJA 1DRSA 1LX5B 1IDHA 1B41B 1IJCA 1JE9A 4FAOE 2MJ4A 1XT3A 2BTXA 1CXOA 2QJBC 1FF4A 2OFSA 1H0JA 3NEQA 4BDTB 1HAAA 1KTZB 3U73U 2L5SA 2J8BA 1M9ZA 1LXHA 1IK8A 1F8UB 2N99A 1KS6A 1KBSA 2H5FA 1NYSA 3LAQU 2LA1A 2H64B 2MHYA 5IMYC 1BTEA 2MFAA 1JBDA 4FAOC 1BXPA 1IDGA 2X8BB 1HC9A 4EY8B 2CRTA 1QKDA 1TGXA 5IMTD 2H64C 1FASA 3BT1U 1CDTA 5DO6A 1CDQA 1TXAA 2H62C 1LSIA 2CTXA 2QC1A 1I02A 2H62D 2H8UA 4DO8A 1CXNA 2H7ZB 4HQPF 1FSSB 1IKCA 4IYEA 2UWRA 2MJYA 1FRAA 1FFJA 1CCQA 2CCXA 1F94A 3FEVA 4RUDA 1CREA 2LCRA 2UX2A 4P7UA 3NH7A 5DZ5A 2JQPA 4ZQYA 1CTXA 1NTXA 5DU1A 1KBTA 2CDXA 2ERAA 1FSCA 1NTNA 1MR6A 3EVSC 1LXGA 1VB0A 1PLOA 5EBXA 1ERAA 1ONJA 1IDIA 1KC4A 2GOOB 1ABTA 3BT2U 2I9BE 1CB9A 2JVEA 2L03A 4AEAA 1ERGA 1ES7B 1L4WA 1NORA 1CODA 1HOYA 1IDLA 2BHIA 3NDSA 1KXIA 1RL5A 4XJJA 1CRFA 1MAHF 1QKEA 1NXBA 4UY2C 1CHVS 1G6MA 4QTIU 3U74U 2H7ZA 3HH7A 6EBXA 3KFDE 4LFTA 1CDRA 2FD6U 1TXBA 1S4YA 2MJ0A 3PLCA 1IQ9A 1RGJA 1HC9B 2QJ9C 3EBXA 2NBTA 3ERAA 3KFDI 4KSNA 2CRSA 2HLRA 2PJYB 2HLQA 1KBAA
chains in the Genus database with same CATH topology
2K3GA 1REWC 2QJAC 2MUOA 1KL8A 1COEA 1KFHA 2GOOC 1NEAA 3VTSA 1ZADA 1W6BA 1TFSA 2PJYC 4OM4A 4OM5A 1NYUA 1LJZA 1CVOA 1YWHA 1JGKA 1KU6B 1UG4A 1V6PA 2VLWA 2MUPA 4BIKB 1CDSA 1QM7A 3QB4B 2ABXA 1HAJA 1DRSA 1LX5B 1IDHA 1B41B 1IJCA 1JE9A 4FAOE 2MJ4A 1XT3A 2BTXA 1CXOA 2QJBC 1FF4A 2OFSA 1H0JA 3NEQA 4BDTB 1HAAA 1KTZB 3U73U 2L5SA 2J8BA 1M9ZA 1LXHA 1IK8A 1F8UB 2N99A 1KS6A 1KBSA 2H5FA 1NYSA 3LAQU 2LA1A 2H64B 2MHYA 5IMYC 1BTEA 2MFAA 1JBDA 4FAOC 1BXPA 1IDGA 2X8BB 1HC9A 4EY8B 2CRTA 1QKDA 1TGXA 5IMTD 2H64C 1FASA 3BT1U 1CDTA 5DO6A 1CDQA 1TXAA 2H62C 1LSIA 2CTXA 2QC1A 1I02A 2H62D 2H8UA 4DO8A 1CXNA 2H7ZB 4HQPF 1FSSB 1IKCA 4IYEA 2UWRA 2MJYA 1FRAA 1FFJA 1CCQA 2CCXA 1F94A 3FEVA 4RUDA 1CREA 2LCRA 2UX2A 4P7UA 3NH7A 5DZ5A 2JQPA 4ZQYA 1CTXA 1NTXA 5DU1A 1KBTA 2CDXA 2ERAA 1FSCA 1NTNA 1MR6A 3EVSC 1LXGA 1VB0A 1PLOA 5EBXA 1ERAA 1ONJA 1IDIA 1KC4A 2GOOB 1ABTA 3BT2U 2I9BE 1CB9A 2JVEA 2L03A 4AEAA 1ERGA 1ES7B 1L4WA 1NORA 1CODA 1HOYA 1IDLA 2BHIA 3NDSA 1KXIA 1RL5A 4XJJA 1CRFA 1MAHF 1QKEA 1NXBA 4UY2C 1CHVS 1G6MA 4QTIU 3U74U 2H7ZA 3HH7A 6EBXA 3KFDE 4LFTA 1CDRA 2FD6U 1TXBA 1S4YA 2MJ0A 3PLCA 1IQ9A 1RGJA 1HC9B 2QJ9C 3EBXA 2NBTA 3ERAA 3KFDI 4KSNA 2CRSA 2HLRA 2PJYB 2HLQA 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3G A;  1REW C;  2QJA C;  2MUO A;  1KL8 A;  1COE A;  1KFH A;  2GOO C;  1NEA A;  3VTS A;  1ZAD A;  1W6B A;  1TFS A;  2PJY C;  4OM4 A;  4OM5 A;  1NYU A;  1LJZ A;  1CVO A;  1YWH A;  1JGK A;  1KU6 B;  1UG4 A;  1V6P A;  2VLW A;  2MUP A;  4BIK B;  1CDS A;  1QM7 A;  3QB4 B;  2ABX A;  1HAJ A;  1DRS A;  1LX5 B;  1IDH A;  1B41 B;  1IJC A;  1JE9 A;  4FAO E;  2MJ4 A;  1XT3 A;  2BTX A;  1CXO A;  2QJB C;  1FF4 A;  2OFS A;  1H0J A;  3NEQ A;  4BDT B;  1HAA A;  1KTZ B;  3U73 U;  2L5S A;  2J8B A;  1M9Z A;  1LXH A;  1IK8 A;  1F8U B;  2N99 A;  1KS6 A;  1KBS A;  2H5F A;  1NYS A;  3LAQ U;  2LA1 A;  2H64 B;  2MHY A;  5IMY C;  1BTE A;  2MFA A;  1JBD A;  4FAO C;  1BXP A;  1IDG A;  2X8B B;  1HC9 A;  4EY8 B;  2CRT A;  1QKD A;  1TGX A;  5IMT D;  2H64 C;  1FAS A;  3BT1 U;  1CDT A;  5DO6 A;  1CDQ A;  1TXA A;  2H62 C;  1LSI A;  2CTX A;  2QC1 A;  1I02 A;  2H62 D;  2H8U A;  4DO8 A;  1CXN A;  2H7Z B;  4HQP F;  1FSS B;  1IKC A;  4IYE A;  2UWR A;  2MJY A;  1FRA A;  1FFJ A;  1CCQ A;  2CCX A;  1F94 A;  3FEV A;  4RUD A;  1CRE A;  2LCR A;  2UX2 A;  4P7U A;  3NH7 A;  5DZ5 A;  2JQP A;  4ZQY A;  1CTX A;  1NTX A;  5DU1 A;  1KBT A;  2CDX A;  2ERA A;  1FSC A;  1NTN A;  1MR6 A;  3EVS C;  1LXG A;  1VB0 A;  1PLO A;  5EBX A;  1ERA A;  1ONJ A;  1IDI A;  1KC4 A;  2GOO B;  1ABT A;  3BT2 U;  2I9B E;  1CB9 A;  2JVE A;  2L03 A;  4AEA A;  1ERG A;  1ES7 B;  1L4W A;  1NOR A;  1COD A;  1HOY A;  1IDL A;  2BHI A;  3NDS A;  1KXI A;  1RL5 A;  4XJJ A;  1CRF A;  1MAH F;  1QKE A;  1NXB A;  4UY2 C;  1CHV S;  1G6M A;  4QTI U;  3U74 U;  2H7Z A;  3HH7 A;  6EBX A;  3KFD E;  4LFT A;  1CDR A;  2FD6 U;  1TXB A;  1S4Y A;  2MJ0 A;  3PLC A;  1IQ9 A;  1RGJ A;  1HC9 B;  2QJ9 C;  3EBX A;  2NBT A;  3ERA A;  3KFD I;  2CRS A;  2HLR A;  2PJY B;  2HLQ A;  1KBA A; 
#chains in the Genus database with same CATH topology
 2K3G A;  1REW C;  2QJA C;  2MUO A;  1KL8 A;  1COE A;  1KFH A;  2GOO C;  1NEA A;  3VTS A;  1ZAD A;  1W6B A;  1TFS A;  2PJY C;  4OM4 A;  4OM5 A;  1NYU A;  1LJZ A;  1CVO A;  1YWH A;  1JGK A;  1KU6 B;  1UG4 A;  1V6P A;  2VLW A;  2MUP A;  4BIK B;  1CDS A;  1QM7 A;  3QB4 B;  2ABX A;  1HAJ A;  1DRS A;  1LX5 B;  1IDH A;  1B41 B;  1IJC A;  1JE9 A;  4FAO E;  2MJ4 A;  1XT3 A;  2BTX A;  1CXO A;  2QJB C;  1FF4 A;  2OFS A;  1H0J A;  3NEQ A;  4BDT B;  1HAA A;  1KTZ B;  3U73 U;  2L5S A;  2J8B A;  1M9Z A;  1LXH A;  1IK8 A;  1F8U B;  2N99 A;  1KS6 A;  1KBS A;  2H5F A;  1NYS A;  3LAQ U;  2LA1 A;  2H64 B;  2MHY A;  5IMY C;  1BTE A;  2MFA A;  1JBD A;  4FAO C;  1BXP A;  1IDG A;  2X8B B;  1HC9 A;  4EY8 B;  2CRT A;  1QKD A;  1TGX A;  5IMT D;  2H64 C;  1FAS A;  3BT1 U;  1CDT A;  5DO6 A;  1CDQ A;  1TXA A;  2H62 C;  1LSI A;  2CTX A;  2QC1 A;  1I02 A;  2H62 D;  2H8U A;  4DO8 A;  1CXN A;  2H7Z B;  4HQP F;  1FSS B;  1IKC A;  4IYE A;  2UWR A;  2MJY A;  1FRA A;  1FFJ A;  1CCQ A;  2CCX A;  1F94 A;  3FEV A;  4RUD A;  1CRE A;  2LCR A;  2UX2 A;  4P7U A;  3NH7 A;  5DZ5 A;  2JQP A;  4ZQY A;  1CTX A;  1NTX A;  5DU1 A;  1KBT A;  2CDX A;  2ERA A;  1FSC A;  1NTN A;  1MR6 A;  3EVS C;  1LXG A;  1VB0 A;  1PLO A;  5EBX A;  1ERA A;  1ONJ A;  1IDI A;  1KC4 A;  2GOO B;  1ABT A;  3BT2 U;  2I9B E;  1CB9 A;  2JVE A;  2L03 A;  4AEA A;  1ERG A;  1ES7 B;  1L4W A;  1NOR A;  1COD A;  1HOY A;  1IDL A;  2BHI A;  3NDS A;  1KXI A;  1RL5 A;  4XJJ A;  1CRF A;  1MAH F;  1QKE A;  1NXB A;  4UY2 C;  1CHV S;  1G6M A;  4QTI U;  3U74 U;  2H7Z A;  3HH7 A;  6EBX A;  3KFD E;  4LFT A;  1CDR A;  2FD6 U;  1TXB A;  1S4Y A;  2MJ0 A;  3PLC A;  1IQ9 A;  1RGJ A;  1HC9 B;  2QJ9 C;  3EBX A;  2NBT A;  3ERA A;  3KFD I;  4KSN A;  2CRS A;  2HLR A;  2PJY B;  2HLQ A;  1KBA A; 
#chains in the Genus database with same CATH homology
 2K3G A;  1REW C;  2QJA C;  2MUO A;  1KL8 A;  1COE A;  1KFH A;  2GOO C;  1NEA A;  3VTS A;  1ZAD A;  1W6B A;  1TFS A;  2PJY C;  4OM4 A;  4OM5 A;  1NYU A;  1LJZ A;  1CVO A;  1YWH A;  1JGK A;  1KU6 B;  1UG4 A;  1V6P A;  2VLW A;  2MUP A;  4BIK B;  1CDS A;  1QM7 A;  3QB4 B;  2ABX A;  1HAJ A;  1DRS A;  1LX5 B;  1IDH A;  1B41 B;  1IJC A;  1JE9 A;  4FAO E;  2MJ4 A;  1XT3 A;  2BTX A;  1CXO A;  2QJB C;  1FF4 A;  2OFS A;  1H0J A;  3NEQ A;  4BDT B;  1HAA A;  1KTZ B;  3U73 U;  2L5S A;  2J8B A;  1M9Z A;  1LXH A;  1IK8 A;  1F8U B;  2N99 A;  1KS6 A;  1KBS A;  2H5F A;  1NYS A;  3LAQ U;  2LA1 A;  2H64 B;  2MHY A;  5IMY C;  1BTE A;  2MFA A;  1JBD A;  4FAO C;  1BXP A;  1IDG A;  2X8B B;  1HC9 A;  4EY8 B;  2CRT A;  1QKD A;  1TGX A;  5IMT D;  2H64 C;  1FAS A;  3BT1 U;  1CDT A;  5DO6 A;  1CDQ A;  1TXA A;  2H62 C;  1LSI A;  2CTX A;  2QC1 A;  1I02 A;  2H62 D;  2H8U A;  4DO8 A;  1CXN A;  2H7Z B;  4HQP F;  1FSS B;  1IKC A;  4IYE A;  2UWR A;  2MJY A;  1FRA A;  1FFJ A;  1CCQ A;  2CCX A;  1F94 A;  3FEV A;  4RUD A;  1CRE A;  2LCR A;  2UX2 A;  4P7U A;  3NH7 A;  5DZ5 A;  2JQP A;  4ZQY A;  1CTX A;  1NTX A;  5DU1 A;  1KBT A;  2CDX A;  2ERA A;  1FSC A;  1NTN A;  1MR6 A;  3EVS C;  1LXG A;  1VB0 A;  1PLO A;  5EBX A;  1ERA A;  1ONJ A;  1IDI A;  1KC4 A;  2GOO B;  1ABT A;  3BT2 U;  2I9B E;  1CB9 A;  2JVE A;  2L03 A;  4AEA A;  1ERG A;  1ES7 B;  1L4W A;  1NOR A;  1COD A;  1HOY A;  1IDL A;  2BHI A;  3NDS A;  1KXI A;  1RL5 A;  4XJJ A;  1CRF A;  1MAH F;  1QKE A;  1NXB A;  4UY2 C;  1CHV S;  1G6M A;  4QTI U;  3U74 U;  2H7Z A;  3HH7 A;  6EBX A;  3KFD E;  4LFT A;  1CDR A;  2FD6 U;  1TXB A;  1S4Y A;  2MJ0 A;  3PLC A;  1IQ9 A;  1RGJ A;  1HC9 B;  2QJ9 C;  3EBX A;  2NBT A;  3ERA A;  3KFD I;  4KSN A;  2CRS A;  2HLR A;  2PJY B;  2HLQ A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...