2CRTA

Cardiotoxin iii from taiwan cobra (naja naja atra) determination of structure in solution and comparison with short neurotoxins
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN III
publication title Cardiotoxin III from the Taiwan cobra (Naja naja atra). Determination of structure in solution and comparison with short neurotoxins.
pubmed doi rcsb
source organism Naja atra
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2crtA00
1H0JA 4P7UA 2MFAA 1ERGA 1PLOA 1CDQA 1COEA 1CCQA 2BHIA 1NXBA 2J8BA 1KTZB 1CODA 2CDXA 2MUOA 4OM5A 2PJYB 1TXBA 2I9BE 3EBXA 1LXHA 3HH7A 4ZQYA 1NORA 1CREA 5DZ5A 4QTIU 4BDTB 1V6PA 1NTXA 4IYEA 1KU6B 2MUPA 2QC1A 4FAOE 2H64C 2H7ZA 1FFJA 4UY2C 1LX5B 4RUDA 1NEAA 1JBDA 1QKEA 3U73U 1G6MA 2H62D 1HC9A 1KL8A 4FAOC 1FRAA 2BTXA 2GOOB 1KBTA 1YWHA 3BT2U 1M9ZA 1TFSA 1XT3A 2PJYC 6EBXA 1LSIA 1DRSA 1CRFA 1UG4A 2VLWA 5IMYC 3KFDE 1KFHA 4AEAA 1W6BA 2JQPA 1CHVS 2HLRA 1IDHA 1KBSA 4DO8A 2MHYA 1LXGA 2LA1A 1CTXA 4XJJA 1MAHF 1F8UB 1HC9B 1CXNA 2GOOC 1IK8A 1RGJA 3U74U 1CVOA 1HOYA 1REWC 1KXIA 1TXAA 5DU1A 1KS6A 1FSCA 1BXPA 2N99A 1NYUA 2L5SA 3NH7A 5IMTD 1NYSA 1NTNA 1ZADA 1JE9A 1JGKA 3PLCA 1CDSA 1ES7B 2L03A 1BTEA 2ABXA 2X8BB 2H5FA 1LJZA 1HAAA 2UWRA 1IDGA 1CXOA 1RL5A 3BT1U 1ONJA 2K3GA 3QB4B 1TGXA 1FF4A 2CCXA 2H7ZB 5DO6A 1IKCA 2MJ4A 2QJBC 3ERAA 1ERAA 4HQPF 1ABTA 3EVSC 2CTXA 1L4WA 1IDLA 3VTSA 1FASA 2ERAA 2HLQA 2JVEA 2QJAC 1HAJA 1IQ9A 2CRSA 1KC4A 3NDSA 1B41B 2UX2A 1CDTA 1F94A 1S4YA 1IJCA 2H62C 1VB0A 4BIKB 1MR6A 1CB9A 3KFDI 1QM7A 3NEQA 1CDRA 2OFSA 4EY8B 2LCRA 3LAQU 1QKDA 2MJYA 2MJ0A 2NBTA 2FD6U 1FSSB 4LFTA 4OM4A 2CRTA 3FEVA 1I02A 1KBAA 2H64B 2H8UA 5EBXA 2QJ9C 1IDIA
chains in the Genus database with same CATH superfamily
1H0JA 4P7UA 2MFAA 1ERGA 1PLOA 1CDQA 1COEA 1CCQA 2BHIA 1NXBA 2J8BA 1KTZB 1CODA 2CDXA 2MUOA 4OM5A 2PJYB 1TXBA 2I9BE 3EBXA 1LXHA 3HH7A 4ZQYA 1NORA 1CREA 5DZ5A 4QTIU 4BDTB 1V6PA 1NTXA 4IYEA 1KU6B 2MUPA 2QC1A 4FAOE 2H64C 2H7ZA 1FFJA 4UY2C 1LX5B 4RUDA 1NEAA 1JBDA 1QKEA 3U73U 1G6MA 2H62D 1HC9A 1KL8A 4FAOC 1FRAA 2BTXA 2GOOB 1KBTA 1YWHA 3BT2U 1M9ZA 1TFSA 1XT3A 2PJYC 6EBXA 1LSIA 1DRSA 1CRFA 1UG4A 2VLWA 5IMYC 3KFDE 1KFHA 4AEAA 1W6BA 2JQPA 1CHVS 2HLRA 1IDHA 1KBSA 4DO8A 2MHYA 1LXGA 2LA1A 1CTXA 4XJJA 1MAHF 1F8UB 1HC9B 1CXNA 2GOOC 1IK8A 1RGJA 3U74U 1CVOA 1HOYA 1REWC 1KXIA 1TXAA 5DU1A 1KS6A 1FSCA 1BXPA 2N99A 1NYUA 2L5SA 3NH7A 5IMTD 1NYSA 1NTNA 1ZADA 1JE9A 1JGKA 3PLCA 1CDSA 1ES7B 2L03A 1BTEA 2ABXA 2X8BB 2H5FA 1LJZA 1HAAA 2UWRA 1IDGA 1CXOA 1RL5A 3BT1U 1ONJA 2K3GA 3QB4B 1TGXA 1FF4A 2CCXA 2H7ZB 5DO6A 1IKCA 2MJ4A 2QJBC 3ERAA 1ERAA 4HQPF 1ABTA 3EVSC 2CTXA 1L4WA 1IDLA 3VTSA 1FASA 2ERAA 2HLQA 2JVEA 2QJAC 1HAJA 1IQ9A 2CRSA 1KC4A 3NDSA 1B41B 2UX2A 1CDTA 1F94A 1S4YA 1IJCA 2H62C 1VB0A 4BIKB 1MR6A 1CB9A 3KFDI 1QM7A 3NEQA 1CDRA 4KSNA 2OFSA 4EY8B 2LCRA 3LAQU 1QKDA 2MJYA 2MJ0A 2NBTA 2FD6U 1FSSB 4LFTA 4OM4A 2CRTA 3FEVA 1I02A 1KBAA 2H64B 2H8UA 5EBXA 2QJ9C 1IDIA
chains in the Genus database with same CATH topology
1H0JA 4P7UA 2MFAA 1ERGA 1PLOA 1CDQA 1COEA 1CCQA 2BHIA 1NXBA 2J8BA 1KTZB 1CODA 2CDXA 2MUOA 4OM5A 2PJYB 1TXBA 2I9BE 3EBXA 1LXHA 3HH7A 4ZQYA 1NORA 1CREA 5DZ5A 4QTIU 4BDTB 1V6PA 1NTXA 4IYEA 1KU6B 2MUPA 2QC1A 4FAOE 2H64C 2H7ZA 1FFJA 4UY2C 1LX5B 4RUDA 1NEAA 1JBDA 1QKEA 3U73U 1G6MA 2H62D 1HC9A 1KL8A 4FAOC 1FRAA 2BTXA 2GOOB 1KBTA 1YWHA 3BT2U 1M9ZA 1TFSA 1XT3A 2PJYC 6EBXA 1LSIA 1DRSA 1CRFA 1UG4A 2VLWA 5IMYC 3KFDE 1KFHA 4AEAA 1W6BA 2JQPA 1CHVS 2HLRA 1IDHA 1KBSA 4DO8A 2MHYA 1LXGA 2LA1A 1CTXA 4XJJA 1MAHF 1F8UB 1HC9B 1CXNA 2GOOC 1IK8A 1RGJA 3U74U 1CVOA 1HOYA 1REWC 1KXIA 1TXAA 5DU1A 1KS6A 1FSCA 1BXPA 2N99A 1NYUA 2L5SA 3NH7A 5IMTD 1NYSA 1NTNA 1ZADA 1JE9A 1JGKA 3PLCA 1CDSA 1ES7B 2L03A 1BTEA 2ABXA 2X8BB 2H5FA 1LJZA 1HAAA 2UWRA 1IDGA 1CXOA 1RL5A 3BT1U 1ONJA 2K3GA 3QB4B 1TGXA 1FF4A 2CCXA 2H7ZB 5DO6A 1IKCA 2MJ4A 2QJBC 3ERAA 1ERAA 4HQPF 1ABTA 3EVSC 2CTXA 1L4WA 1IDLA 3VTSA 1FASA 2ERAA 2HLQA 2JVEA 2QJAC 1HAJA 1IQ9A 2CRSA 1KC4A 3NDSA 1B41B 2UX2A 1CDTA 1F94A 1S4YA 1IJCA 2H62C 1VB0A 4BIKB 1MR6A 1CB9A 3KFDI 1QM7A 3NEQA 1CDRA 4KSNA 2OFSA 4EY8B 2LCRA 3LAQU 1QKDA 2MJYA 2MJ0A 2NBTA 2FD6U 1FSSB 4LFTA 4OM4A 2CRTA 3FEVA 1I02A 1KBAA 2H64B 2H8UA 5EBXA 2QJ9C 1IDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0J A;  4P7U A;  2MFA A;  1ERG A;  1PLO A;  1CDQ A;  1COE A;  1CCQ A;  2BHI A;  1NXB A;  2J8B A;  1KTZ B;  1COD A;  2CDX A;  2MUO A;  4OM5 A;  2PJY B;  1TXB A;  2I9B E;  3EBX A;  1LXH A;  3HH7 A;  4ZQY A;  1NOR A;  1CRE A;  5DZ5 A;  4QTI U;  4BDT B;  1V6P A;  1NTX A;  4IYE A;  1KU6 B;  2MUP A;  2QC1 A;  4FAO E;  2H64 C;  2H7Z A;  1FFJ A;  4UY2 C;  1LX5 B;  4RUD A;  1NEA A;  1JBD A;  1QKE A;  3U73 U;  1G6M A;  2H62 D;  1HC9 A;  1KL8 A;  4FAO C;  1FRA A;  2BTX A;  2GOO B;  1KBT A;  1YWH A;  3BT2 U;  1M9Z A;  1TFS A;  1XT3 A;  2PJY C;  6EBX A;  1LSI A;  1DRS A;  1CRF A;  1UG4 A;  2VLW A;  5IMY C;  3KFD E;  1KFH A;  4AEA A;  1W6B A;  2JQP A;  1CHV S;  2HLR A;  1IDH A;  1KBS A;  4DO8 A;  2MHY A;  1LXG A;  2LA1 A;  1CTX A;  4XJJ A;  1MAH F;  1F8U B;  1HC9 B;  1CXN A;  2GOO C;  1IK8 A;  1RGJ A;  3U74 U;  1CVO A;  1HOY A;  1REW C;  1KXI A;  1TXA A;  5DU1 A;  1KS6 A;  1FSC A;  1BXP A;  2N99 A;  1NYU A;  2L5S A;  3NH7 A;  5IMT D;  1NYS A;  1NTN A;  1ZAD A;  1JE9 A;  1JGK A;  3PLC A;  1CDS A;  1ES7 B;  2L03 A;  1BTE A;  2ABX A;  2X8B B;  2H5F A;  1LJZ A;  1HAA A;  2UWR A;  1IDG A;  1CXO A;  1RL5 A;  3BT1 U;  1ONJ A;  2K3G A;  3QB4 B;  1TGX A;  1FF4 A;  2CCX A;  2H7Z B;  5DO6 A;  1IKC A;  2MJ4 A;  2QJB C;  3ERA A;  1ERA A;  4HQP F;  1ABT A;  3EVS C;  2CTX A;  1L4W A;  1IDL A;  3VTS A;  1FAS A;  2ERA A;  2HLQ A;  2JVE A;  2QJA C;  1HAJ A;  1IQ9 A;  2CRS A;  1KC4 A;  3NDS A;  1B41 B;  2UX2 A;  1CDT A;  1F94 A;  1S4Y A;  1IJC A;  2H62 C;  1VB0 A;  4BIK B;  1MR6 A;  1CB9 A;  3KFD I;  1QM7 A;  3NEQ A;  1CDR A;  2OFS A;  4EY8 B;  2LCR A;  3LAQ U;  1QKD A;  2MJY A;  2MJ0 A;  2NBT A;  2FD6 U;  1FSS B;  4LFT A;  4OM4 A;  2CRT A;  3FEV A;  1I02 A;  1KBA A;  2H64 B;  2H8U A;  5EBX A;  2QJ9 C;  1IDI A; 
#chains in the Genus database with same CATH topology
 1H0J A;  4P7U A;  2MFA A;  1ERG A;  1PLO A;  1CDQ A;  1COE A;  1CCQ A;  2BHI A;  1NXB A;  2J8B A;  1KTZ B;  1COD A;  2CDX A;  2MUO A;  4OM5 A;  2PJY B;  1TXB A;  2I9B E;  3EBX A;  1LXH A;  3HH7 A;  4ZQY A;  1NOR A;  1CRE A;  5DZ5 A;  4QTI U;  4BDT B;  1V6P A;  1NTX A;  4IYE A;  1KU6 B;  2MUP A;  2QC1 A;  4FAO E;  2H64 C;  2H7Z A;  1FFJ A;  4UY2 C;  1LX5 B;  4RUD A;  1NEA A;  1JBD A;  1QKE A;  3U73 U;  1G6M A;  2H62 D;  1HC9 A;  1KL8 A;  4FAO C;  1FRA A;  2BTX A;  2GOO B;  1KBT A;  1YWH A;  3BT2 U;  1M9Z A;  1TFS A;  1XT3 A;  2PJY C;  6EBX A;  1LSI A;  1DRS A;  1CRF A;  1UG4 A;  2VLW A;  5IMY C;  3KFD E;  1KFH A;  4AEA A;  1W6B A;  2JQP A;  1CHV S;  2HLR A;  1IDH A;  1KBS A;  4DO8 A;  2MHY A;  1LXG A;  2LA1 A;  1CTX A;  4XJJ A;  1MAH F;  1F8U B;  1HC9 B;  1CXN A;  2GOO C;  1IK8 A;  1RGJ A;  3U74 U;  1CVO A;  1HOY A;  1REW C;  1KXI A;  1TXA A;  5DU1 A;  1KS6 A;  1FSC A;  1BXP A;  2N99 A;  1NYU A;  2L5S A;  3NH7 A;  5IMT D;  1NYS A;  1NTN A;  1ZAD A;  1JE9 A;  1JGK A;  3PLC A;  1CDS A;  1ES7 B;  2L03 A;  1BTE A;  2ABX A;  2X8B B;  2H5F A;  1LJZ A;  1HAA A;  2UWR A;  1IDG A;  1CXO A;  1RL5 A;  3BT1 U;  1ONJ A;  2K3G A;  3QB4 B;  1TGX A;  1FF4 A;  2CCX A;  2H7Z B;  5DO6 A;  1IKC A;  2MJ4 A;  2QJB C;  3ERA A;  1ERA A;  4HQP F;  1ABT A;  3EVS C;  2CTX A;  1L4W A;  1IDL A;  3VTS A;  1FAS A;  2ERA A;  2HLQ A;  2JVE A;  2QJA C;  1HAJ A;  1IQ9 A;  2CRS A;  1KC4 A;  3NDS A;  1B41 B;  2UX2 A;  1CDT A;  1F94 A;  1S4Y A;  1IJC A;  2H62 C;  1VB0 A;  4BIK B;  1MR6 A;  1CB9 A;  3KFD I;  1QM7 A;  3NEQ A;  1CDR A;  4KSN A;  2OFS A;  4EY8 B;  2LCR A;  3LAQ U;  1QKD A;  2MJY A;  2MJ0 A;  2NBT A;  2FD6 U;  1FSS B;  4LFT A;  4OM4 A;  2CRT A;  3FEV A;  1I02 A;  1KBA A;  2H64 B;  2H8U A;  5EBX A;  2QJ9 C;  1IDI A; 
#chains in the Genus database with same CATH homology
 1H0J A;  4P7U A;  2MFA A;  1ERG A;  1PLO A;  1CDQ A;  1COE A;  1CCQ A;  2BHI A;  1NXB A;  2J8B A;  1KTZ B;  1COD A;  2CDX A;  2MUO A;  4OM5 A;  2PJY B;  1TXB A;  2I9B E;  3EBX A;  1LXH A;  3HH7 A;  4ZQY A;  1NOR A;  1CRE A;  5DZ5 A;  4QTI U;  4BDT B;  1V6P A;  1NTX A;  4IYE A;  1KU6 B;  2MUP A;  2QC1 A;  4FAO E;  2H64 C;  2H7Z A;  1FFJ A;  4UY2 C;  1LX5 B;  4RUD A;  1NEA A;  1JBD A;  1QKE A;  3U73 U;  1G6M A;  2H62 D;  1HC9 A;  1KL8 A;  4FAO C;  1FRA A;  2BTX A;  2GOO B;  1KBT A;  1YWH A;  3BT2 U;  1M9Z A;  1TFS A;  1XT3 A;  2PJY C;  6EBX A;  1LSI A;  1DRS A;  1CRF A;  1UG4 A;  2VLW A;  5IMY C;  3KFD E;  1KFH A;  4AEA A;  1W6B A;  2JQP A;  1CHV S;  2HLR A;  1IDH A;  1KBS A;  4DO8 A;  2MHY A;  1LXG A;  2LA1 A;  1CTX A;  4XJJ A;  1MAH F;  1F8U B;  1HC9 B;  1CXN A;  2GOO C;  1IK8 A;  1RGJ A;  3U74 U;  1CVO A;  1HOY A;  1REW C;  1KXI A;  1TXA A;  5DU1 A;  1KS6 A;  1FSC A;  1BXP A;  2N99 A;  1NYU A;  2L5S A;  3NH7 A;  5IMT D;  1NYS A;  1NTN A;  1ZAD A;  1JE9 A;  1JGK A;  3PLC A;  1CDS A;  1ES7 B;  2L03 A;  1BTE A;  2ABX A;  2X8B B;  2H5F A;  1LJZ A;  1HAA A;  2UWR A;  1IDG A;  1CXO A;  1RL5 A;  3BT1 U;  1ONJ A;  2K3G A;  3QB4 B;  1TGX A;  1FF4 A;  2CCX A;  2H7Z B;  5DO6 A;  1IKC A;  2MJ4 A;  2QJB C;  3ERA A;  1ERA A;  4HQP F;  1ABT A;  3EVS C;  2CTX A;  1L4W A;  1IDL A;  3VTS A;  1FAS A;  2ERA A;  2HLQ A;  2JVE A;  2QJA C;  1HAJ A;  1IQ9 A;  2CRS A;  1KC4 A;  3NDS A;  1B41 B;  2UX2 A;  1CDT A;  1F94 A;  1S4Y A;  1IJC A;  2H62 C;  1VB0 A;  4BIK B;  1MR6 A;  1CB9 A;  3KFD I;  1QM7 A;  3NEQ A;  1CDR A;  4KSN A;  2OFS A;  4EY8 B;  2LCR A;  3LAQ U;  1QKD A;  2MJY A;  2MJ0 A;  2NBT A;  2FD6 U;  1FSS B;  4LFT A;  4OM4 A;  2CRT A;  3FEV A;  1I02 A;  1KBA A;  2H64 B;  2H8U A;  5EBX A;  2QJ9 C;  1IDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...