2CRTA

Cardiotoxin iii from taiwan cobra (naja naja atra) determination of structure in solution and comparison with short neurotoxins
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cardiotoxin III from the Taiwan cobra (Naja naja atra). Determination of structure in solution and comparison with short neurotoxins.
pubmed doi rcsb
source organism Naja atra
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN III
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2crtA00
3BT2U 2MJ4A 2MUPA 4FAOE 1CB9A 1UG4A 2H62C 2MJ0A 3U73U 1IK8A 2QC1A 1ZADA 2CTXA 1KBAA 1LJZA 1CDRA 1IQ9A 1QKDA 2H5FA 2X8BB 2CRTA 4UY2C 1CDQA 1CVOA 2CCXA 4BIKB 1F94A 4OM5A 2LA1A 2H64B 2NBTA 1W6BA 1MAHF 1CRFA 4P7UA 1NXBA 1KBSA 2OFSA 5IMYC 1TXAA 2UWRA 3PLCA 2N99A 3LAQU 1FSCA 4LFTA 1REWC 1HOYA 2MFAA 4RUDA 1DRSA 4OM4A 1ES7B 2FD6U 1CCQA 2CDXA 3EBXA 3NEQA 1HAAA 3QB4B 1FFJA 2LCRA 1FF4A 1CDSA 1RGJA 1JGKA 2PJYB 1QM7A 3NDSA 1I02A 1KFHA 2QJ9C 1G6MA 2BHIA 1HC9A 6EBXA 1TGXA 1F8UB 1IDHA 4QTIU 2H7ZB 1JE9A 2ABXA 1NTNA 1COEA 2MUOA 1NORA 1QKEA 2ERAA 2J8BA 1CXNA 1M9ZA 1ERGA 1NEAA 1NYSA 2JVEA 4HQPF 2GOOC 5EBXA 1YWHA 1KL8A 1CHVS 4FAOC 1FRAA 1L4WA 4AEAA 1CODA 4BDTB 2QJAC 2GOOB 1S4YA 1HC9B 1NYUA 1TFSA 3FEVA 1KC4A 1FASA 1FSSB 1ERAA 1KTZB 5IMTD 3VTSA 1LSIA 2I9BE 1MR6A 2HLRA 4XJJA 2MHYA 2PJYC 1BTEA 1XT3A 4IYEA 1KS6A 2H8UA 2L03A 1IDLA 2UX2A 3KFDI 1PLOA 3EVSC 1CTXA 1LX5B 2JQPA 1CXOA 1ABTA 1ONJA 1TXBA 2K3GA 1V6PA 1NTXA 2HLQA 1LXHA 3HH7A 1KU6B 5DU1A 2L5SA 1JBDA 2VLWA 2H64C 1IDIA 1VB0A 2H62D 4EY8B 2QJBC 1BXPA 1H0JA 3U74U 1KXIA 2BTXA 3BT1U 4DO8A 4ZQYA 1RL5A 1IKCA 1IJCA 2MJYA 1LXGA 3KFDE 3NH7A 2H7ZA 1KBTA 1CDTA 1CREA 5DO6A 5DZ5A 1IDGA 3ERAA 1HAJA 2CRSA 1B41B
chains in the Genus database with same CATH superfamily
3BT2U 2MJ4A 2MUPA 4FAOE 1CB9A 1UG4A 2H62C 2MJ0A 3U73U 1IK8A 2QC1A 1ZADA 2CTXA 1KBAA 1LJZA 1CDRA 1IQ9A 1QKDA 2H5FA 2X8BB 2CRTA 4UY2C 1CDQA 1CVOA 2CCXA 4BIKB 1F94A 4OM5A 2LA1A 2H64B 2NBTA 1W6BA 1MAHF 1CRFA 4P7UA 1NXBA 4KSNA 1KBSA 2OFSA 5IMYC 1TXAA 2UWRA 3PLCA 2N99A 3LAQU 1FSCA 4LFTA 1REWC 1HOYA 2MFAA 4RUDA 1DRSA 4OM4A 1ES7B 2FD6U 1CCQA 2CDXA 3EBXA 3NEQA 1HAAA 3QB4B 1FFJA 2LCRA 1FF4A 1CDSA 1RGJA 1JGKA 2PJYB 1QM7A 3NDSA 1I02A 1KFHA 2QJ9C 1G6MA 2BHIA 1HC9A 6EBXA 1TGXA 1F8UB 1IDHA 4QTIU 2H7ZB 1JE9A 2ABXA 1NTNA 1COEA 2MUOA 1NORA 1QKEA 2ERAA 2J8BA 1CXNA 1M9ZA 1ERGA 1NEAA 1NYSA 2JVEA 4HQPF 2GOOC 5EBXA 1YWHA 1KL8A 1CHVS 4FAOC 1FRAA 1L4WA 4AEAA 1CODA 4BDTB 2QJAC 2GOOB 1S4YA 1HC9B 1NYUA 1TFSA 3FEVA 1KC4A 1FASA 1FSSB 1ERAA 1KTZB 5IMTD 3VTSA 1LSIA 2I9BE 1MR6A 2HLRA 4XJJA 2MHYA 2PJYC 1BTEA 1XT3A 4IYEA 1KS6A 2H8UA 2L03A 1IDLA 2UX2A 3KFDI 1PLOA 3EVSC 1CTXA 1LX5B 2JQPA 1CXOA 1ABTA 1ONJA 1TXBA 2K3GA 1V6PA 1NTXA 2HLQA 1LXHA 3HH7A 1KU6B 5DU1A 2L5SA 1JBDA 2VLWA 2H64C 1IDIA 1VB0A 2H62D 4EY8B 2QJBC 1BXPA 1H0JA 3U74U 1KXIA 2BTXA 3BT1U 4DO8A 4ZQYA 1RL5A 1IKCA 1IJCA 2MJYA 1LXGA 3KFDE 3NH7A 2H7ZA 1KBTA 1CDTA 1CREA 5DO6A 5DZ5A 1IDGA 3ERAA 1HAJA 2CRSA 1B41B
chains in the Genus database with same CATH topology
3BT2U 2MJ4A 2MUPA 4FAOE 1CB9A 1UG4A 2H62C 2MJ0A 3U73U 1IK8A 2QC1A 1ZADA 2CTXA 1KBAA 1LJZA 1CDRA 1IQ9A 1QKDA 2H5FA 2X8BB 2CRTA 4UY2C 1CDQA 1CVOA 2CCXA 4BIKB 1F94A 4OM5A 2LA1A 2H64B 2NBTA 1W6BA 1MAHF 1CRFA 4P7UA 1NXBA 4KSNA 1KBSA 2OFSA 5IMYC 1TXAA 2UWRA 3PLCA 2N99A 3LAQU 1FSCA 4LFTA 1REWC 1HOYA 2MFAA 4RUDA 1DRSA 4OM4A 1ES7B 2FD6U 1CCQA 2CDXA 3EBXA 3NEQA 1HAAA 3QB4B 1FFJA 2LCRA 1FF4A 1CDSA 1RGJA 1JGKA 2PJYB 1QM7A 3NDSA 1I02A 1KFHA 2QJ9C 1G6MA 2BHIA 1HC9A 6EBXA 1TGXA 1F8UB 1IDHA 4QTIU 2H7ZB 1JE9A 2ABXA 1NTNA 1COEA 2MUOA 1NORA 1QKEA 2ERAA 2J8BA 1CXNA 1M9ZA 1ERGA 1NEAA 1NYSA 2JVEA 4HQPF 2GOOC 5EBXA 1YWHA 1KL8A 1CHVS 4FAOC 1FRAA 1L4WA 4AEAA 1CODA 4BDTB 2QJAC 2GOOB 1S4YA 1HC9B 1NYUA 1TFSA 3FEVA 1KC4A 1FASA 1FSSB 1ERAA 1KTZB 5IMTD 3VTSA 1LSIA 2I9BE 1MR6A 2HLRA 4XJJA 2MHYA 2PJYC 1BTEA 1XT3A 4IYEA 1KS6A 2H8UA 2L03A 1IDLA 2UX2A 3KFDI 1PLOA 3EVSC 1CTXA 1LX5B 2JQPA 1CXOA 1ABTA 1ONJA 1TXBA 2K3GA 1V6PA 1NTXA 2HLQA 1LXHA 3HH7A 1KU6B 5DU1A 2L5SA 1JBDA 2VLWA 2H64C 1IDIA 1VB0A 2H62D 4EY8B 2QJBC 1BXPA 1H0JA 3U74U 1KXIA 2BTXA 3BT1U 4DO8A 4ZQYA 1RL5A 1IKCA 1IJCA 2MJYA 1LXGA 3KFDE 3NH7A 2H7ZA 1KBTA 1CDTA 1CREA 5DO6A 5DZ5A 1IDGA 3ERAA 1HAJA 2CRSA 1B41B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT2 U;  2MJ4 A;  2MUP A;  4FAO E;  1CB9 A;  1UG4 A;  2H62 C;  2MJ0 A;  3U73 U;  1IK8 A;  2QC1 A;  1ZAD A;  2CTX A;  1KBA A;  1LJZ A;  1CDR A;  1IQ9 A;  1QKD A;  2H5F A;  2X8B B;  2CRT A;  4UY2 C;  1CDQ A;  1CVO A;  2CCX A;  4BIK B;  1F94 A;  4OM5 A;  2LA1 A;  2H64 B;  2NBT A;  1W6B A;  1MAH F;  1CRF A;  4P7U A;  1NXB A;  1KBS A;  2OFS A;  5IMY C;  1TXA A;  2UWR A;  3PLC A;  2N99 A;  3LAQ U;  1FSC A;  4LFT A;  1REW C;  1HOY A;  2MFA A;  4RUD A;  1DRS A;  4OM4 A;  1ES7 B;  2FD6 U;  1CCQ A;  2CDX A;  3EBX A;  3NEQ A;  1HAA A;  3QB4 B;  1FFJ A;  2LCR A;  1FF4 A;  1CDS A;  1RGJ A;  1JGK A;  2PJY B;  1QM7 A;  3NDS A;  1I02 A;  1KFH A;  2QJ9 C;  1G6M A;  2BHI A;  1HC9 A;  6EBX A;  1TGX A;  1F8U B;  1IDH A;  4QTI U;  2H7Z B;  1JE9 A;  2ABX A;  1NTN A;  1COE A;  2MUO A;  1NOR A;  1QKE A;  2ERA A;  2J8B A;  1CXN A;  1M9Z A;  1ERG A;  1NEA A;  1NYS A;  2JVE A;  4HQP F;  2GOO C;  5EBX A;  1YWH A;  1KL8 A;  1CHV S;  4FAO C;  1FRA A;  1L4W A;  4AEA A;  1COD A;  4BDT B;  2QJA C;  2GOO B;  1S4Y A;  1HC9 B;  1NYU A;  1TFS A;  3FEV A;  1KC4 A;  1FAS A;  1FSS B;  1ERA A;  1KTZ B;  5IMT D;  3VTS A;  1LSI A;  2I9B E;  1MR6 A;  2HLR A;  4XJJ A;  2MHY A;  2PJY C;  1BTE A;  1XT3 A;  4IYE A;  1KS6 A;  2H8U A;  2L03 A;  1IDL A;  2UX2 A;  3KFD I;  1PLO A;  3EVS C;  1CTX A;  1LX5 B;  2JQP A;  1CXO A;  1ABT A;  1ONJ A;  1TXB A;  2K3G A;  1V6P A;  1NTX A;  2HLQ A;  1LXH A;  3HH7 A;  1KU6 B;  5DU1 A;  2L5S A;  1JBD A;  2VLW A;  2H64 C;  1IDI A;  1VB0 A;  2H62 D;  4EY8 B;  2QJB C;  1BXP A;  1H0J A;  3U74 U;  1KXI A;  2BTX A;  3BT1 U;  4DO8 A;  4ZQY A;  1RL5 A;  1IKC A;  1IJC A;  2MJY A;  1LXG A;  3KFD E;  3NH7 A;  2H7Z A;  1KBT A;  1CDT A;  1CRE A;  5DO6 A;  5DZ5 A;  1IDG A;  3ERA A;  1HAJ A;  2CRS A;  1B41 B; 
#chains in the Genus database with same CATH topology
 3BT2 U;  2MJ4 A;  2MUP A;  4FAO E;  1CB9 A;  1UG4 A;  2H62 C;  2MJ0 A;  3U73 U;  1IK8 A;  2QC1 A;  1ZAD A;  2CTX A;  1KBA A;  1LJZ A;  1CDR A;  1IQ9 A;  1QKD A;  2H5F A;  2X8B B;  2CRT A;  4UY2 C;  1CDQ A;  1CVO A;  2CCX A;  4BIK B;  1F94 A;  4OM5 A;  2LA1 A;  2H64 B;  2NBT A;  1W6B A;  1MAH F;  1CRF A;  4P7U A;  1NXB A;  4KSN A;  1KBS A;  2OFS A;  5IMY C;  1TXA A;  2UWR A;  3PLC A;  2N99 A;  3LAQ U;  1FSC A;  4LFT A;  1REW C;  1HOY A;  2MFA A;  4RUD A;  1DRS A;  4OM4 A;  1ES7 B;  2FD6 U;  1CCQ A;  2CDX A;  3EBX A;  3NEQ A;  1HAA A;  3QB4 B;  1FFJ A;  2LCR A;  1FF4 A;  1CDS A;  1RGJ A;  1JGK A;  2PJY B;  1QM7 A;  3NDS A;  1I02 A;  1KFH A;  2QJ9 C;  1G6M A;  2BHI A;  1HC9 A;  6EBX A;  1TGX A;  1F8U B;  1IDH A;  4QTI U;  2H7Z B;  1JE9 A;  2ABX A;  1NTN A;  1COE A;  2MUO A;  1NOR A;  1QKE A;  2ERA A;  2J8B A;  1CXN A;  1M9Z A;  1ERG A;  1NEA A;  1NYS A;  2JVE A;  4HQP F;  2GOO C;  5EBX A;  1YWH A;  1KL8 A;  1CHV S;  4FAO C;  1FRA A;  1L4W A;  4AEA A;  1COD A;  4BDT B;  2QJA C;  2GOO B;  1S4Y A;  1HC9 B;  1NYU A;  1TFS A;  3FEV A;  1KC4 A;  1FAS A;  1FSS B;  1ERA A;  1KTZ B;  5IMT D;  3VTS A;  1LSI A;  2I9B E;  1MR6 A;  2HLR A;  4XJJ A;  2MHY A;  2PJY C;  1BTE A;  1XT3 A;  4IYE A;  1KS6 A;  2H8U A;  2L03 A;  1IDL A;  2UX2 A;  3KFD I;  1PLO A;  3EVS C;  1CTX A;  1LX5 B;  2JQP A;  1CXO A;  1ABT A;  1ONJ A;  1TXB A;  2K3G A;  1V6P A;  1NTX A;  2HLQ A;  1LXH A;  3HH7 A;  1KU6 B;  5DU1 A;  2L5S A;  1JBD A;  2VLW A;  2H64 C;  1IDI A;  1VB0 A;  2H62 D;  4EY8 B;  2QJB C;  1BXP A;  1H0J A;  3U74 U;  1KXI A;  2BTX A;  3BT1 U;  4DO8 A;  4ZQY A;  1RL5 A;  1IKC A;  1IJC A;  2MJY A;  1LXG A;  3KFD E;  3NH7 A;  2H7Z A;  1KBT A;  1CDT A;  1CRE A;  5DO6 A;  5DZ5 A;  1IDG A;  3ERA A;  1HAJ A;  2CRS A;  1B41 B; 
#chains in the Genus database with same CATH homology
 3BT2 U;  2MJ4 A;  2MUP A;  4FAO E;  1CB9 A;  1UG4 A;  2H62 C;  2MJ0 A;  3U73 U;  1IK8 A;  2QC1 A;  1ZAD A;  2CTX A;  1KBA A;  1LJZ A;  1CDR A;  1IQ9 A;  1QKD A;  2H5F A;  2X8B B;  2CRT A;  4UY2 C;  1CDQ A;  1CVO A;  2CCX A;  4BIK B;  1F94 A;  4OM5 A;  2LA1 A;  2H64 B;  2NBT A;  1W6B A;  1MAH F;  1CRF A;  4P7U A;  1NXB A;  4KSN A;  1KBS A;  2OFS A;  5IMY C;  1TXA A;  2UWR A;  3PLC A;  2N99 A;  3LAQ U;  1FSC A;  4LFT A;  1REW C;  1HOY A;  2MFA A;  4RUD A;  1DRS A;  4OM4 A;  1ES7 B;  2FD6 U;  1CCQ A;  2CDX A;  3EBX A;  3NEQ A;  1HAA A;  3QB4 B;  1FFJ A;  2LCR A;  1FF4 A;  1CDS A;  1RGJ A;  1JGK A;  2PJY B;  1QM7 A;  3NDS A;  1I02 A;  1KFH A;  2QJ9 C;  1G6M A;  2BHI A;  1HC9 A;  6EBX A;  1TGX A;  1F8U B;  1IDH A;  4QTI U;  2H7Z B;  1JE9 A;  2ABX A;  1NTN A;  1COE A;  2MUO A;  1NOR A;  1QKE A;  2ERA A;  2J8B A;  1CXN A;  1M9Z A;  1ERG A;  1NEA A;  1NYS A;  2JVE A;  4HQP F;  2GOO C;  5EBX A;  1YWH A;  1KL8 A;  1CHV S;  4FAO C;  1FRA A;  1L4W A;  4AEA A;  1COD A;  4BDT B;  2QJA C;  2GOO B;  1S4Y A;  1HC9 B;  1NYU A;  1TFS A;  3FEV A;  1KC4 A;  1FAS A;  1FSS B;  1ERA A;  1KTZ B;  5IMT D;  3VTS A;  1LSI A;  2I9B E;  1MR6 A;  2HLR A;  4XJJ A;  2MHY A;  2PJY C;  1BTE A;  1XT3 A;  4IYE A;  1KS6 A;  2H8U A;  2L03 A;  1IDL A;  2UX2 A;  3KFD I;  1PLO A;  3EVS C;  1CTX A;  1LX5 B;  2JQP A;  1CXO A;  1ABT A;  1ONJ A;  1TXB A;  2K3G A;  1V6P A;  1NTX A;  2HLQ A;  1LXH A;  3HH7 A;  1KU6 B;  5DU1 A;  2L5S A;  1JBD A;  2VLW A;  2H64 C;  1IDI A;  1VB0 A;  2H62 D;  4EY8 B;  2QJB C;  1BXP A;  1H0J A;  3U74 U;  1KXI A;  2BTX A;  3BT1 U;  4DO8 A;  4ZQY A;  1RL5 A;  1IKC A;  1IJC A;  2MJY A;  1LXG A;  3KFD E;  3NH7 A;  2H7Z A;  1KBT A;  1CDT A;  1CRE A;  5DO6 A;  5DZ5 A;  1IDG A;  3ERA A;  1HAJ A;  2CRS A;  1B41 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...