3EVSC

Crystal structure of the gdf-5:bmp receptor ib complex.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
85
Chain Sequence
ILRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 5
publication title Crystal structure analysis reveals a spring-loaded latch as molecular mechanism for GDF-5-type I receptor specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/transferase receptor
total genus 16
structure length 85
sequence length 85
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3evsC00
3KFDE 1YWHA 2MUOA 1S4YA 2JQPA 2H7ZB 4OM4A 2MUPA 1HOYA 1LXHA 2OFSA 1REWC 1BTEA 1FF4A 5DU1A 2GOOC 1TGXA 2N99A 3LAQU 4BDTB 1KU6B 1VB0A 1XT3A 4LFTA 1BXPA 1KC4A 2UX2A 1CB9A 2X8BB 1HC9B 1NTNA 1CODA 1ABTA 1JGKA 1KL8A 2ERAA 4P7UA 1KS6A 1KBAA 2CRSA 1LSIA 1I02A 1RGJA 1LJZA 2H7ZA 4OM5A 1MAHF 3VTSA 6EBXA 2PJYC 1CCQA 1L4WA 1CDSA 4BIKB 1IDLA 3FEVA 1KTZB 2PJYB 1W6BA 2H5FA 3U73U 5DZ5A 2FD6U 3NDSA 2JVEA 1NXBA 2L5SA 2MHYA 5IMYC 4DO8A 4EY8B 1QKDA 1FSCA 2NBTA 1TFSA 3NEQA 4HQPF 1V6PA 3EBXA 1CHVS 1NYUA 1QKEA 1HC9A 4UY2C 1CDQA 1F94A 1CREA 3U74U 1FRAA 3KFDI 1HAJA 1NTXA 2QJAC 4QTIU 3PLCA 2CDXA 5IMTD 3QB4B 1ERAA 3ERAA 2CCXA 1ERGA 1FFJA 1KBSA 2BTXA 1NEAA 2HLRA 1CDTA 4ZQYA 2UWRA 1NORA 2QJ9C 5EBXA 2LA1A 1RL5A 1IJCA 2H62C 1HAAA 1MR6A 2MJ0A 1ES7B 1M9ZA 2BHIA 1CVOA 1PLOA 3EVSC 1F8UB 1ONJA 1ZADA 2J8BA 2VLWA 3BT2U 4FAOC 2MJYA 1TXBA 2ABXA 2H64C 1CXOA 1JE9A 4XJJA 2LCRA 2H64B 1IK8A 2QC1A 2L03A 1H0JA 1LX5B 1QM7A 2QJBC 2MJ4A 1CXNA 2CRTA 3HH7A 1FSSB 1TXAA 1IKCA 2H62D 2HLQA 1NYSA 4AEAA 1CRFA 1KXIA 1CTXA 1IDIA 2MFAA 4RUDA 2CTXA 1UG4A 2GOOB 2K3GA 1IQ9A 1IDHA 1DRSA 2H8UA 1JBDA 2I9BE 5DO6A 4FAOE 3NH7A 1COEA 1KBTA 1G6MA 3BT1U 1LXGA 4IYEA 1CDRA 1B41B 1IDGA 1FASA 1KFHA
chains in the Genus database with same CATH superfamily
3KFDE 1YWHA 2MUOA 1S4YA 2JQPA 2H7ZB 4OM4A 2MUPA 1HOYA 1LXHA 2OFSA 1REWC 1BTEA 1FF4A 5DU1A 2GOOC 1TGXA 2N99A 3LAQU 4BDTB 1KU6B 1VB0A 4KSNA 1XT3A 4LFTA 1BXPA 1KC4A 2UX2A 1CB9A 2X8BB 1HC9B 1NTNA 1CODA 1ABTA 1JGKA 1KL8A 2ERAA 4P7UA 1KS6A 1KBAA 2CRSA 1LSIA 1I02A 1RGJA 1LJZA 2H7ZA 4OM5A 1MAHF 3VTSA 6EBXA 2PJYC 1CCQA 1L4WA 1CDSA 4BIKB 1IDLA 3FEVA 1KTZB 2PJYB 1W6BA 2H5FA 3U73U 5DZ5A 2FD6U 3NDSA 2JVEA 1NXBA 2L5SA 2MHYA 5IMYC 4DO8A 4EY8B 1QKDA 1FSCA 2NBTA 1TFSA 3NEQA 4HQPF 1V6PA 3EBXA 1CHVS 1NYUA 1QKEA 1HC9A 4UY2C 1CDQA 1F94A 1CREA 3U74U 1FRAA 3KFDI 1HAJA 1NTXA 2QJAC 4QTIU 3PLCA 2CDXA 5IMTD 3QB4B 1ERAA 3ERAA 2CCXA 1ERGA 1FFJA 1KBSA 2BTXA 1NEAA 2HLRA 1CDTA 4ZQYA 2UWRA 1NORA 2QJ9C 5EBXA 2LA1A 1RL5A 1IJCA 2H62C 1HAAA 1MR6A 2MJ0A 1ES7B 1M9ZA 2BHIA 1CVOA 1PLOA 3EVSC 1F8UB 1ONJA 1ZADA 2J8BA 2VLWA 3BT2U 4FAOC 2MJYA 1TXBA 2ABXA 2H64C 1CXOA 1JE9A 4XJJA 2LCRA 2H64B 1IK8A 2QC1A 2L03A 1H0JA 1LX5B 1QM7A 2QJBC 2MJ4A 1CXNA 2CRTA 3HH7A 1FSSB 1TXAA 1IKCA 2H62D 2HLQA 1NYSA 4AEAA 1CRFA 1KXIA 1CTXA 1IDIA 2MFAA 4RUDA 2CTXA 1UG4A 2GOOB 2K3GA 1IQ9A 1IDHA 1DRSA 2H8UA 1JBDA 2I9BE 5DO6A 4FAOE 3NH7A 1COEA 1KBTA 1G6MA 3BT1U 1LXGA 4IYEA 1CDRA 1B41B 1IDGA 1FASA 1KFHA
chains in the Genus database with same CATH topology
3KFDE 1YWHA 2MUOA 1S4YA 2JQPA 2H7ZB 4OM4A 2MUPA 1HOYA 1LXHA 2OFSA 1REWC 1BTEA 1FF4A 5DU1A 2GOOC 1TGXA 2N99A 3LAQU 4BDTB 1KU6B 1VB0A 4KSNA 1XT3A 4LFTA 1BXPA 1KC4A 2UX2A 1CB9A 2X8BB 1HC9B 1NTNA 1CODA 1ABTA 1JGKA 1KL8A 2ERAA 4P7UA 1KS6A 1KBAA 2CRSA 1LSIA 1I02A 1RGJA 1LJZA 2H7ZA 4OM5A 1MAHF 3VTSA 6EBXA 2PJYC 1CCQA 1L4WA 1CDSA 4BIKB 1IDLA 3FEVA 1KTZB 2PJYB 1W6BA 2H5FA 3U73U 5DZ5A 2FD6U 3NDSA 2JVEA 1NXBA 2L5SA 2MHYA 5IMYC 4DO8A 4EY8B 1QKDA 1FSCA 2NBTA 1TFSA 3NEQA 4HQPF 1V6PA 3EBXA 1CHVS 1NYUA 1QKEA 1HC9A 4UY2C 1CDQA 1F94A 1CREA 3U74U 1FRAA 3KFDI 1HAJA 1NTXA 2QJAC 4QTIU 3PLCA 2CDXA 5IMTD 3QB4B 1ERAA 3ERAA 2CCXA 1ERGA 1FFJA 1KBSA 2BTXA 1NEAA 2HLRA 1CDTA 4ZQYA 2UWRA 1NORA 2QJ9C 5EBXA 2LA1A 1RL5A 1IJCA 2H62C 1HAAA 1MR6A 2MJ0A 1ES7B 1M9ZA 2BHIA 1CVOA 1PLOA 3EVSC 1F8UB 1ONJA 1ZADA 2J8BA 2VLWA 3BT2U 4FAOC 2MJYA 1TXBA 2ABXA 2H64C 1CXOA 1JE9A 4XJJA 2LCRA 2H64B 1IK8A 2QC1A 2L03A 1H0JA 1LX5B 1QM7A 2QJBC 2MJ4A 1CXNA 2CRTA 3HH7A 1FSSB 1TXAA 1IKCA 2H62D 2HLQA 1NYSA 4AEAA 1CRFA 1KXIA 1CTXA 1IDIA 2MFAA 4RUDA 2CTXA 1UG4A 2GOOB 2K3GA 1IQ9A 1IDHA 1DRSA 2H8UA 1JBDA 2I9BE 5DO6A 4FAOE 3NH7A 1COEA 1KBTA 1G6MA 3BT1U 1LXGA 4IYEA 1CDRA 1B41B 1IDGA 1FASA 1KFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KFD E;  1YWH A;  2MUO A;  1S4Y A;  2JQP A;  2H7Z B;  4OM4 A;  2MUP A;  1HOY A;  1LXH A;  2OFS A;  1REW C;  1BTE A;  1FF4 A;  5DU1 A;  2GOO C;  1TGX A;  2N99 A;  3LAQ U;  4BDT B;  1KU6 B;  1VB0 A;  1XT3 A;  4LFT A;  1BXP A;  1KC4 A;  2UX2 A;  1CB9 A;  2X8B B;  1HC9 B;  1NTN A;  1COD A;  1ABT A;  1JGK A;  1KL8 A;  2ERA A;  4P7U A;  1KS6 A;  1KBA A;  2CRS A;  1LSI A;  1I02 A;  1RGJ A;  1LJZ A;  2H7Z A;  4OM5 A;  1MAH F;  3VTS A;  6EBX A;  2PJY C;  1CCQ A;  1L4W A;  1CDS A;  4BIK B;  1IDL A;  3FEV A;  1KTZ B;  2PJY B;  1W6B A;  2H5F A;  3U73 U;  5DZ5 A;  2FD6 U;  3NDS A;  2JVE A;  1NXB A;  2L5S A;  2MHY A;  5IMY C;  4DO8 A;  4EY8 B;  1QKD A;  1FSC A;  2NBT A;  1TFS A;  3NEQ A;  4HQP F;  1V6P A;  3EBX A;  1CHV S;  1NYU A;  1QKE A;  1HC9 A;  4UY2 C;  1CDQ A;  1F94 A;  1CRE A;  3U74 U;  1FRA A;  3KFD I;  1HAJ A;  1NTX A;  2QJA C;  4QTI U;  3PLC A;  2CDX A;  5IMT D;  3QB4 B;  1ERA A;  3ERA A;  2CCX A;  1ERG A;  1FFJ A;  1KBS A;  2BTX A;  1NEA A;  2HLR A;  1CDT A;  4ZQY A;  2UWR A;  1NOR A;  2QJ9 C;  5EBX A;  2LA1 A;  1RL5 A;  1IJC A;  2H62 C;  1HAA A;  1MR6 A;  2MJ0 A;  1ES7 B;  1M9Z A;  2BHI A;  1CVO A;  1PLO A;  3EVS C;  1F8U B;  1ONJ A;  1ZAD A;  2J8B A;  2VLW A;  3BT2 U;  4FAO C;  2MJY A;  1TXB A;  2ABX A;  2H64 C;  1CXO A;  1JE9 A;  4XJJ A;  2LCR A;  2H64 B;  1IK8 A;  2QC1 A;  2L03 A;  1H0J A;  1LX5 B;  1QM7 A;  2QJB C;  2MJ4 A;  1CXN A;  2CRT A;  3HH7 A;  1FSS B;  1TXA A;  1IKC A;  2H62 D;  2HLQ A;  1NYS A;  4AEA A;  1CRF A;  1KXI A;  1CTX A;  1IDI A;  2MFA A;  4RUD A;  2CTX A;  1UG4 A;  2GOO B;  2K3G A;  1IQ9 A;  1IDH A;  1DRS A;  2H8U A;  1JBD A;  2I9B E;  5DO6 A;  4FAO E;  3NH7 A;  1COE A;  1KBT A;  1G6M A;  3BT1 U;  1LXG A;  4IYE A;  1CDR A;  1B41 B;  1IDG A;  1FAS A;  1KFH A; 
#chains in the Genus database with same CATH topology
 3KFD E;  1YWH A;  2MUO A;  1S4Y A;  2JQP A;  2H7Z B;  4OM4 A;  2MUP A;  1HOY A;  1LXH A;  2OFS A;  1REW C;  1BTE A;  1FF4 A;  5DU1 A;  2GOO C;  1TGX A;  2N99 A;  3LAQ U;  4BDT B;  1KU6 B;  1VB0 A;  4KSN A;  1XT3 A;  4LFT A;  1BXP A;  1KC4 A;  2UX2 A;  1CB9 A;  2X8B B;  1HC9 B;  1NTN A;  1COD A;  1ABT A;  1JGK A;  1KL8 A;  2ERA A;  4P7U A;  1KS6 A;  1KBA A;  2CRS A;  1LSI A;  1I02 A;  1RGJ A;  1LJZ A;  2H7Z A;  4OM5 A;  1MAH F;  3VTS A;  6EBX A;  2PJY C;  1CCQ A;  1L4W A;  1CDS A;  4BIK B;  1IDL A;  3FEV A;  1KTZ B;  2PJY B;  1W6B A;  2H5F A;  3U73 U;  5DZ5 A;  2FD6 U;  3NDS A;  2JVE A;  1NXB A;  2L5S A;  2MHY A;  5IMY C;  4DO8 A;  4EY8 B;  1QKD A;  1FSC A;  2NBT A;  1TFS A;  3NEQ A;  4HQP F;  1V6P A;  3EBX A;  1CHV S;  1NYU A;  1QKE A;  1HC9 A;  4UY2 C;  1CDQ A;  1F94 A;  1CRE A;  3U74 U;  1FRA A;  3KFD I;  1HAJ A;  1NTX A;  2QJA C;  4QTI U;  3PLC A;  2CDX A;  5IMT D;  3QB4 B;  1ERA A;  3ERA A;  2CCX A;  1ERG A;  1FFJ A;  1KBS A;  2BTX A;  1NEA A;  2HLR A;  1CDT A;  4ZQY A;  2UWR A;  1NOR A;  2QJ9 C;  5EBX A;  2LA1 A;  1RL5 A;  1IJC A;  2H62 C;  1HAA A;  1MR6 A;  2MJ0 A;  1ES7 B;  1M9Z A;  2BHI A;  1CVO A;  1PLO A;  3EVS C;  1F8U B;  1ONJ A;  1ZAD A;  2J8B A;  2VLW A;  3BT2 U;  4FAO C;  2MJY A;  1TXB A;  2ABX A;  2H64 C;  1CXO A;  1JE9 A;  4XJJ A;  2LCR A;  2H64 B;  1IK8 A;  2QC1 A;  2L03 A;  1H0J A;  1LX5 B;  1QM7 A;  2QJB C;  2MJ4 A;  1CXN A;  2CRT A;  3HH7 A;  1FSS B;  1TXA A;  1IKC A;  2H62 D;  2HLQ A;  1NYS A;  4AEA A;  1CRF A;  1KXI A;  1CTX A;  1IDI A;  2MFA A;  4RUD A;  2CTX A;  1UG4 A;  2GOO B;  2K3G A;  1IQ9 A;  1IDH A;  1DRS A;  2H8U A;  1JBD A;  2I9B E;  5DO6 A;  4FAO E;  3NH7 A;  1COE A;  1KBT A;  1G6M A;  3BT1 U;  1LXG A;  4IYE A;  1CDR A;  1B41 B;  1IDG A;  1FAS A;  1KFH A; 
#chains in the Genus database with same CATH homology
 3KFD E;  1YWH A;  2MUO A;  1S4Y A;  2JQP A;  2H7Z B;  4OM4 A;  2MUP A;  1HOY A;  1LXH A;  2OFS A;  1REW C;  1BTE A;  1FF4 A;  5DU1 A;  2GOO C;  1TGX A;  2N99 A;  3LAQ U;  4BDT B;  1KU6 B;  1VB0 A;  4KSN A;  1XT3 A;  4LFT A;  1BXP A;  1KC4 A;  2UX2 A;  1CB9 A;  2X8B B;  1HC9 B;  1NTN A;  1COD A;  1ABT A;  1JGK A;  1KL8 A;  2ERA A;  4P7U A;  1KS6 A;  1KBA A;  2CRS A;  1LSI A;  1I02 A;  1RGJ A;  1LJZ A;  2H7Z A;  4OM5 A;  1MAH F;  3VTS A;  6EBX A;  2PJY C;  1CCQ A;  1L4W A;  1CDS A;  4BIK B;  1IDL A;  3FEV A;  1KTZ B;  2PJY B;  1W6B A;  2H5F A;  3U73 U;  5DZ5 A;  2FD6 U;  3NDS A;  2JVE A;  1NXB A;  2L5S A;  2MHY A;  5IMY C;  4DO8 A;  4EY8 B;  1QKD A;  1FSC A;  2NBT A;  1TFS A;  3NEQ A;  4HQP F;  1V6P A;  3EBX A;  1CHV S;  1NYU A;  1QKE A;  1HC9 A;  4UY2 C;  1CDQ A;  1F94 A;  1CRE A;  3U74 U;  1FRA A;  3KFD I;  1HAJ A;  1NTX A;  2QJA C;  4QTI U;  3PLC A;  2CDX A;  5IMT D;  3QB4 B;  1ERA A;  3ERA A;  2CCX A;  1ERG A;  1FFJ A;  1KBS A;  2BTX A;  1NEA A;  2HLR A;  1CDT A;  4ZQY A;  2UWR A;  1NOR A;  2QJ9 C;  5EBX A;  2LA1 A;  1RL5 A;  1IJC A;  2H62 C;  1HAA A;  1MR6 A;  2MJ0 A;  1ES7 B;  1M9Z A;  2BHI A;  1CVO A;  1PLO A;  3EVS C;  1F8U B;  1ONJ A;  1ZAD A;  2J8B A;  2VLW A;  3BT2 U;  4FAO C;  2MJY A;  1TXB A;  2ABX A;  2H64 C;  1CXO A;  1JE9 A;  4XJJ A;  2LCR A;  2H64 B;  1IK8 A;  2QC1 A;  2L03 A;  1H0J A;  1LX5 B;  1QM7 A;  2QJB C;  2MJ4 A;  1CXN A;  2CRT A;  3HH7 A;  1FSS B;  1TXA A;  1IKC A;  2H62 D;  2HLQ A;  1NYS A;  4AEA A;  1CRF A;  1KXI A;  1CTX A;  1IDI A;  2MFA A;  4RUD A;  2CTX A;  1UG4 A;  2GOO B;  2K3G A;  1IQ9 A;  1IDH A;  1DRS A;  2H8U A;  1JBD A;  2I9B E;  5DO6 A;  4FAO E;  3NH7 A;  1COE A;  1KBT A;  1G6M A;  3BT1 U;  1LXG A;  4IYE A;  1CDR A;  1B41 B;  1IDG A;  1FAS A;  1KFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...