3EVSC

Crystal structure of the gdf-5:bmp receptor ib complex.
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
85
structure length
85
Chain Sequence
ILRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGMPVVTSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/transferase receptor
molecule keywords Growth/differentiation factor 5
publication title Crystal structure analysis reveals a spring-loaded latch as molecular mechanism for GDF-5-type I receptor specificity.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 85
sequence length 85
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3evsC00
2H64B 6EBXA 4OM4A 1H0JA 1REWC 1MR6A 4OM5A 5DO6A 1W6BA 4AEAA 1LXHA 2CRSA 1IKCA 1JE9A 1ONJA 1QM7A 1KU6B 3HH7A 1HAJA 3KFDI 1QKEA 1TFSA 2CDXA 1CDTA 1NEAA 1IQ9A 1KBTA 3FEVA 1XT3A 2FD6U 1KS6A 4FAOE 1ERAA 4ZQYA 2H7ZB 2JQPA 3LAQU 1NORA 4BIKB 2ABXA 2QJBC 1FSCA 2H5FA 4DO8A 4IYEA 1RL5A 1FRAA 1PLOA 1CCQA 1G6MA 2GOOB 1NXBA 2CRTA 2L03A 1CB9A 3NH7A 5DZ5A 1CODA 5EBXA 1F94A 1IJCA 3VTSA 1CXNA 1FSSB 1NYSA 1BTEA 2H64C 1BXPA 1LSIA 1HC9B 2VLWA 1KBSA 3NDSA 1IDLA 1IDGA 1TXAA 2JVEA 1IDHA 3U73U 1CHVS 1ZADA 1FFJA 2PJYB 4EY8B 4FAOC 1B41B 2H62D 3PLCA 1CDRA 1F8UB 1UG4A 1YWHA 1LXGA 1CREA 3BT1U 1CRFA 1ES7B 2HLQA 2H8UA 1RGJA 1QKDA 1HAAA 2H7ZA 2MJYA 1M9ZA 1NYUA 3NEQA 1FASA 2QC1A 4HQPF 4BDTB 1KFHA 4RUDA 1CVOA 1CXOA 2GOOC 1LX5B 2MHYA 3EBXA 1KXIA 1CTXA 2J8BA 2MFAA 1HOYA 2ERAA 5IMYC 1JBDA 1CDSA 1NTNA 2QJ9C 2X8BB 4XJJA 2BTXA 5IMTD 1L4WA 1LJZA 2BHIA 2MJ4A 2MJ0A 2H62C 1V6PA 1VB0A 2QJAC 3EVSC 4LFTA 1KTZB 2MUPA 1HC9A 3BT2U 1IDIA 1TGXA 1ABTA 2CTXA 2L5SA 1KBAA 2LCRA 2UWRA 1COEA 2PJYC 2MUOA 1JGKA 3QB4B 2I9BE 1NTXA 1KL8A 3U74U 1ERGA 1I02A 1IK8A 4UY2C 2UX2A 1FF4A 3ERAA 1KC4A 2N99A 1CDQA 2HLRA 2CCXA 2NBTA 3KFDE 4QTIU 1MAHF 2K3GA 2OFSA 1DRSA 5DU1A 1S4YA 2LA1A 4P7UA 1TXBA
chains in the Genus database with same CATH superfamily
2H64B 6EBXA 4OM4A 1H0JA 1REWC 1MR6A 4OM5A 5DO6A 1W6BA 4AEAA 1LXHA 2CRSA 1IKCA 1JE9A 1ONJA 1QM7A 1KU6B 3HH7A 1HAJA 3KFDI 1QKEA 1TFSA 2CDXA 1CDTA 1NEAA 1IQ9A 1KBTA 3FEVA 1XT3A 2FD6U 1KS6A 4FAOE 1ERAA 4ZQYA 2H7ZB 2JQPA 3LAQU 1NORA 4BIKB 2ABXA 2QJBC 1FSCA 2H5FA 4DO8A 4IYEA 1RL5A 1FRAA 1PLOA 1CCQA 1G6MA 2GOOB 1NXBA 2CRTA 2L03A 1CB9A 3NH7A 5DZ5A 1CODA 5EBXA 1F94A 1IJCA 3VTSA 1CXNA 1FSSB 1NYSA 1BTEA 2H64C 1BXPA 1LSIA 1HC9B 2VLWA 1KBSA 3NDSA 1IDLA 1IDGA 1TXAA 2JVEA 1IDHA 3U73U 1CHVS 1ZADA 1FFJA 2PJYB 4EY8B 4FAOC 1B41B 2H62D 3PLCA 1CDRA 1F8UB 1UG4A 1YWHA 1LXGA 1CREA 3BT1U 1CRFA 1ES7B 2HLQA 2H8UA 1RGJA 1QKDA 1HAAA 2H7ZA 2MJYA 1M9ZA 1NYUA 3NEQA 1FASA 2QC1A 4HQPF 4BDTB 1KFHA 4RUDA 1CVOA 1CXOA 2GOOC 1LX5B 2MHYA 3EBXA 1KXIA 1CTXA 2J8BA 2MFAA 1HOYA 2ERAA 5IMYC 1JBDA 1CDSA 1NTNA 2QJ9C 2X8BB 4XJJA 2BTXA 5IMTD 1L4WA 1LJZA 2BHIA 2MJ4A 2MJ0A 2H62C 1V6PA 1VB0A 2QJAC 3EVSC 4LFTA 1KTZB 2MUPA 1HC9A 3BT2U 1IDIA 1TGXA 1ABTA 2CTXA 2L5SA 1KBAA 2LCRA 2UWRA 1COEA 2PJYC 2MUOA 1JGKA 3QB4B 2I9BE 1NTXA 1KL8A 3U74U 1ERGA 4KSNA 1I02A 1IK8A 4UY2C 2UX2A 1FF4A 3ERAA 1KC4A 2N99A 1CDQA 2HLRA 2CCXA 2NBTA 3KFDE 4QTIU 1MAHF 2K3GA 2OFSA 1DRSA 5DU1A 1S4YA 2LA1A 4P7UA 1TXBA
chains in the Genus database with same CATH topology
2H64B 6EBXA 4OM4A 1H0JA 1REWC 1MR6A 4OM5A 5DO6A 1W6BA 4AEAA 1LXHA 2CRSA 1IKCA 1JE9A 1ONJA 1QM7A 1KU6B 3HH7A 1HAJA 3KFDI 1QKEA 1TFSA 2CDXA 1CDTA 1NEAA 1IQ9A 1KBTA 3FEVA 1XT3A 2FD6U 1KS6A 4FAOE 1ERAA 4ZQYA 2H7ZB 2JQPA 3LAQU 1NORA 4BIKB 2ABXA 2QJBC 1FSCA 2H5FA 4DO8A 4IYEA 1RL5A 1FRAA 1PLOA 1CCQA 1G6MA 2GOOB 1NXBA 2CRTA 2L03A 1CB9A 3NH7A 5DZ5A 1CODA 5EBXA 1F94A 1IJCA 3VTSA 1CXNA 1FSSB 1NYSA 1BTEA 2H64C 1BXPA 1LSIA 1HC9B 2VLWA 1KBSA 3NDSA 1IDLA 1IDGA 1TXAA 2JVEA 1IDHA 3U73U 1CHVS 1ZADA 1FFJA 2PJYB 4EY8B 4FAOC 1B41B 2H62D 3PLCA 1CDRA 1F8UB 1UG4A 1YWHA 1LXGA 1CREA 3BT1U 1CRFA 1ES7B 2HLQA 2H8UA 1RGJA 1QKDA 1HAAA 2H7ZA 2MJYA 1M9ZA 1NYUA 3NEQA 1FASA 2QC1A 4HQPF 4BDTB 1KFHA 4RUDA 1CVOA 1CXOA 2GOOC 1LX5B 2MHYA 3EBXA 1KXIA 1CTXA 2J8BA 2MFAA 1HOYA 2ERAA 5IMYC 1JBDA 1CDSA 1NTNA 2QJ9C 2X8BB 4XJJA 2BTXA 5IMTD 1L4WA 1LJZA 2BHIA 2MJ4A 2MJ0A 2H62C 1V6PA 1VB0A 2QJAC 3EVSC 4LFTA 1KTZB 2MUPA 1HC9A 3BT2U 1IDIA 1TGXA 1ABTA 2CTXA 2L5SA 1KBAA 2LCRA 2UWRA 1COEA 2PJYC 2MUOA 1JGKA 3QB4B 2I9BE 1NTXA 1KL8A 3U74U 1ERGA 4KSNA 1I02A 1IK8A 4UY2C 2UX2A 1FF4A 3ERAA 1KC4A 2N99A 1CDQA 2HLRA 2CCXA 2NBTA 3KFDE 4QTIU 1MAHF 2K3GA 2OFSA 1DRSA 5DU1A 1S4YA 2LA1A 4P7UA 1TXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H64 B;  6EBX A;  4OM4 A;  1H0J A;  1REW C;  1MR6 A;  4OM5 A;  5DO6 A;  1W6B A;  4AEA A;  1LXH A;  2CRS A;  1IKC A;  1JE9 A;  1ONJ A;  1QM7 A;  1KU6 B;  3HH7 A;  1HAJ A;  3KFD I;  1QKE A;  1TFS A;  2CDX A;  1CDT A;  1NEA A;  1IQ9 A;  1KBT A;  3FEV A;  1XT3 A;  2FD6 U;  1KS6 A;  4FAO E;  1ERA A;  4ZQY A;  2H7Z B;  2JQP A;  3LAQ U;  1NOR A;  4BIK B;  2ABX A;  2QJB C;  1FSC A;  2H5F A;  4DO8 A;  4IYE A;  1RL5 A;  1FRA A;  1PLO A;  1CCQ A;  1G6M A;  2GOO B;  1NXB A;  2CRT A;  2L03 A;  1CB9 A;  3NH7 A;  5DZ5 A;  1COD A;  5EBX A;  1F94 A;  1IJC A;  3VTS A;  1CXN A;  1FSS B;  1NYS A;  1BTE A;  2H64 C;  1BXP A;  1LSI A;  1HC9 B;  2VLW A;  1KBS A;  3NDS A;  1IDL A;  1IDG A;  1TXA A;  2JVE A;  1IDH A;  3U73 U;  1CHV S;  1ZAD A;  1FFJ A;  2PJY B;  4EY8 B;  4FAO C;  1B41 B;  2H62 D;  3PLC A;  1CDR A;  1F8U B;  1UG4 A;  1YWH A;  1LXG A;  1CRE A;  3BT1 U;  1CRF A;  1ES7 B;  2HLQ A;  2H8U A;  1RGJ A;  1QKD A;  1HAA A;  2H7Z A;  2MJY A;  1M9Z A;  1NYU A;  3NEQ A;  1FAS A;  2QC1 A;  4HQP F;  4BDT B;  1KFH A;  4RUD A;  1CVO A;  1CXO A;  2GOO C;  1LX5 B;  2MHY A;  3EBX A;  1KXI A;  1CTX A;  2J8B A;  2MFA A;  1HOY A;  2ERA A;  5IMY C;  1JBD A;  1CDS A;  1NTN A;  2QJ9 C;  2X8B B;  4XJJ A;  2BTX A;  5IMT D;  1L4W A;  1LJZ A;  2BHI A;  2MJ4 A;  2MJ0 A;  2H62 C;  1V6P A;  1VB0 A;  2QJA C;  3EVS C;  4LFT A;  1KTZ B;  2MUP A;  1HC9 A;  3BT2 U;  1IDI A;  1TGX A;  1ABT A;  2CTX A;  2L5S A;  1KBA A;  2LCR A;  2UWR A;  1COE A;  2PJY C;  2MUO A;  1JGK A;  3QB4 B;  2I9B E;  1NTX A;  1KL8 A;  3U74 U;  1ERG A;  1I02 A;  1IK8 A;  4UY2 C;  2UX2 A;  1FF4 A;  3ERA A;  1KC4 A;  2N99 A;  1CDQ A;  2HLR A;  2CCX A;  2NBT A;  3KFD E;  4QTI U;  1MAH F;  2K3G A;  2OFS A;  1DRS A;  5DU1 A;  1S4Y A;  2LA1 A;  4P7U A;  1TXB A; 
#chains in the Genus database with same CATH topology
 2H64 B;  6EBX A;  4OM4 A;  1H0J A;  1REW C;  1MR6 A;  4OM5 A;  5DO6 A;  1W6B A;  4AEA A;  1LXH A;  2CRS A;  1IKC A;  1JE9 A;  1ONJ A;  1QM7 A;  1KU6 B;  3HH7 A;  1HAJ A;  3KFD I;  1QKE A;  1TFS A;  2CDX A;  1CDT A;  1NEA A;  1IQ9 A;  1KBT A;  3FEV A;  1XT3 A;  2FD6 U;  1KS6 A;  4FAO E;  1ERA A;  4ZQY A;  2H7Z B;  2JQP A;  3LAQ U;  1NOR A;  4BIK B;  2ABX A;  2QJB C;  1FSC A;  2H5F A;  4DO8 A;  4IYE A;  1RL5 A;  1FRA A;  1PLO A;  1CCQ A;  1G6M A;  2GOO B;  1NXB A;  2CRT A;  2L03 A;  1CB9 A;  3NH7 A;  5DZ5 A;  1COD A;  5EBX A;  1F94 A;  1IJC A;  3VTS A;  1CXN A;  1FSS B;  1NYS A;  1BTE A;  2H64 C;  1BXP A;  1LSI A;  1HC9 B;  2VLW A;  1KBS A;  3NDS A;  1IDL A;  1IDG A;  1TXA A;  2JVE A;  1IDH A;  3U73 U;  1CHV S;  1ZAD A;  1FFJ A;  2PJY B;  4EY8 B;  4FAO C;  1B41 B;  2H62 D;  3PLC A;  1CDR A;  1F8U B;  1UG4 A;  1YWH A;  1LXG A;  1CRE A;  3BT1 U;  1CRF A;  1ES7 B;  2HLQ A;  2H8U A;  1RGJ A;  1QKD A;  1HAA A;  2H7Z A;  2MJY A;  1M9Z A;  1NYU A;  3NEQ A;  1FAS A;  2QC1 A;  4HQP F;  4BDT B;  1KFH A;  4RUD A;  1CVO A;  1CXO A;  2GOO C;  1LX5 B;  2MHY A;  3EBX A;  1KXI A;  1CTX A;  2J8B A;  2MFA A;  1HOY A;  2ERA A;  5IMY C;  1JBD A;  1CDS A;  1NTN A;  2QJ9 C;  2X8B B;  4XJJ A;  2BTX A;  5IMT D;  1L4W A;  1LJZ A;  2BHI A;  2MJ4 A;  2MJ0 A;  2H62 C;  1V6P A;  1VB0 A;  2QJA C;  3EVS C;  4LFT A;  1KTZ B;  2MUP A;  1HC9 A;  3BT2 U;  1IDI A;  1TGX A;  1ABT A;  2CTX A;  2L5S A;  1KBA A;  2LCR A;  2UWR A;  1COE A;  2PJY C;  2MUO A;  1JGK A;  3QB4 B;  2I9B E;  1NTX A;  1KL8 A;  3U74 U;  1ERG A;  4KSN A;  1I02 A;  1IK8 A;  4UY2 C;  2UX2 A;  1FF4 A;  3ERA A;  1KC4 A;  2N99 A;  1CDQ A;  2HLR A;  2CCX A;  2NBT A;  3KFD E;  4QTI U;  1MAH F;  2K3G A;  2OFS A;  1DRS A;  5DU1 A;  1S4Y A;  2LA1 A;  4P7U A;  1TXB A; 
#chains in the Genus database with same CATH homology
 2H64 B;  6EBX A;  4OM4 A;  1H0J A;  1REW C;  1MR6 A;  4OM5 A;  5DO6 A;  1W6B A;  4AEA A;  1LXH A;  2CRS A;  1IKC A;  1JE9 A;  1ONJ A;  1QM7 A;  1KU6 B;  3HH7 A;  1HAJ A;  3KFD I;  1QKE A;  1TFS A;  2CDX A;  1CDT A;  1NEA A;  1IQ9 A;  1KBT A;  3FEV A;  1XT3 A;  2FD6 U;  1KS6 A;  4FAO E;  1ERA A;  4ZQY A;  2H7Z B;  2JQP A;  3LAQ U;  1NOR A;  4BIK B;  2ABX A;  2QJB C;  1FSC A;  2H5F A;  4DO8 A;  4IYE A;  1RL5 A;  1FRA A;  1PLO A;  1CCQ A;  1G6M A;  2GOO B;  1NXB A;  2CRT A;  2L03 A;  1CB9 A;  3NH7 A;  5DZ5 A;  1COD A;  5EBX A;  1F94 A;  1IJC A;  3VTS A;  1CXN A;  1FSS B;  1NYS A;  1BTE A;  2H64 C;  1BXP A;  1LSI A;  1HC9 B;  2VLW A;  1KBS A;  3NDS A;  1IDL A;  1IDG A;  1TXA A;  2JVE A;  1IDH A;  3U73 U;  1CHV S;  1ZAD A;  1FFJ A;  2PJY B;  4EY8 B;  4FAO C;  1B41 B;  2H62 D;  3PLC A;  1CDR A;  1F8U B;  1UG4 A;  1YWH A;  1LXG A;  1CRE A;  3BT1 U;  1CRF A;  1ES7 B;  2HLQ A;  2H8U A;  1RGJ A;  1QKD A;  1HAA A;  2H7Z A;  2MJY A;  1M9Z A;  1NYU A;  3NEQ A;  1FAS A;  2QC1 A;  4HQP F;  4BDT B;  1KFH A;  4RUD A;  1CVO A;  1CXO A;  2GOO C;  1LX5 B;  2MHY A;  3EBX A;  1KXI A;  1CTX A;  2J8B A;  2MFA A;  1HOY A;  2ERA A;  5IMY C;  1JBD A;  1CDS A;  1NTN A;  2QJ9 C;  2X8B B;  4XJJ A;  2BTX A;  5IMT D;  1L4W A;  1LJZ A;  2BHI A;  2MJ4 A;  2MJ0 A;  2H62 C;  1V6P A;  1VB0 A;  2QJA C;  3EVS C;  4LFT A;  1KTZ B;  2MUP A;  1HC9 A;  3BT2 U;  1IDI A;  1TGX A;  1ABT A;  2CTX A;  2L5S A;  1KBA A;  2LCR A;  2UWR A;  1COE A;  2PJY C;  2MUO A;  1JGK A;  3QB4 B;  2I9B E;  1NTX A;  1KL8 A;  3U74 U;  1ERG A;  4KSN A;  1I02 A;  1IK8 A;  4UY2 C;  2UX2 A;  1FF4 A;  3ERA A;  1KC4 A;  2N99 A;  1CDQ A;  2HLR A;  2CCX A;  2NBT A;  3KFD E;  4QTI U;  1MAH F;  2K3G A;  2OFS A;  1DRS A;  5DU1 A;  1S4Y A;  2LA1 A;  4P7U A;  1TXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...