1HC9A

Alpha-bungarotoxin complexed with high affinity peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
pubmed doi rcsb
molecule tags Toxin/peptide
molecule keywords ALPHA-BUNGAROTOXIN ISOFORM V31
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hc9A00
1LSIA 1H0JA 1IDHA 4BDTB 3QB4B 2CCXA 2FD6U 1RL5A 1TXBA 1LXGA 2L03A 2QJBC 5IMYC 1HAJA 2UWRA 3VTSA 1KBAA 2L5SA 4DO8A 2H7ZB 1ONJA 5DO6A 2CRSA 2H5FA 1ERGA 4ZQYA 1NYUA 1ABTA 6EBXA 4UY2C 3EBXA 1NORA 2X8BB 1CVOA 2H64B 1HC9B 3U74U 1NTXA 1IQ9A 3U73U 1BTEA 1KTZB 1FSSB 1W6BA 2JVEA 2CRTA 2HLRA 1HOYA 1FASA 2VLWA 2J8BA 1IDGA 4P7UA 2ABXA 1FFJA 1I02A 3KFDE 1DRSA 3NH7A 2GOOC 4XJJA 1IKCA 1CODA 1FF4A 2LCRA 1ES7B 5DZ5A 1ZADA 2ERAA 5IMTD 3ERAA 4QTIU 4OM4A 1V6PA 2CDXA 2UX2A 1MR6A 4IYEA 1KS6A 4FAOC 1LX5B 1XT3A 1QM7A 3BT1U 4AEAA 1CREA 1NYSA 4RUDA 1NXBA 1CTXA 3LAQU 1PLOA 1CRFA 1FSCA 1TGXA 2MFAA 1KC4A 1KFHA 2MUOA 1L4WA 1KXIA 1B41B 2BHIA 1IK8A 2CTXA 1IDIA 2MJ4A 2H7ZA 4LFTA 1G6MA 1F8UB 1QKDA 1JBDA 2H8UA 1CXNA 1QKEA 4OM5A 3FEVA 1BXPA 2HLQA 2N99A 3EVSC 1COEA 1FRAA 1ERAA 3NDSA 1UG4A 1S4YA 3NEQA 2QC1A 1JE9A 2MJ0A 1CB9A 4FAOE 1HC9A 2QJ9C 5EBXA 2I9BE 1VB0A 3HH7A 1IJCA 1CDSA 1M9ZA 1RGJA 4HQPF 1KBSA 2MJYA 5DU1A 2MHYA 2H62D 1CCQA 1HAAA 1JGKA 1MAHF 1TXAA 1KBTA 2PJYC 2BTXA 2H64C 1LXHA 1KU6B 1NTNA 2NBTA 1CDQA 4EY8B 1F94A 2MUPA 4BIKB 1CDRA 2JQPA 1LJZA 1IDLA 1CHVS 1NEAA 1KL8A 2QJAC 1YWHA 2H62C 1REWC 1TFSA 1CXOA 3PLCA 2GOOB 2K3GA 3BT2U 3KFDI 1CDTA 2PJYB 2OFSA 2LA1A
chains in the Genus database with same CATH superfamily
1LSIA 1H0JA 1IDHA 4BDTB 3QB4B 2CCXA 2FD6U 1RL5A 1TXBA 1LXGA 2L03A 2QJBC 5IMYC 1HAJA 2UWRA 3VTSA 1KBAA 2L5SA 4DO8A 2H7ZB 1ONJA 5DO6A 2CRSA 2H5FA 1ERGA 4ZQYA 1NYUA 1ABTA 6EBXA 4UY2C 3EBXA 1NORA 2X8BB 1CVOA 2H64B 1HC9B 3U74U 1NTXA 1IQ9A 3U73U 1BTEA 1KTZB 1FSSB 1W6BA 2JVEA 2CRTA 2HLRA 1HOYA 1FASA 2VLWA 2J8BA 1IDGA 4P7UA 2ABXA 1FFJA 1I02A 3KFDE 1DRSA 3NH7A 2GOOC 4XJJA 1IKCA 1CODA 1FF4A 2LCRA 1ES7B 5DZ5A 1ZADA 2ERAA 5IMTD 3ERAA 4QTIU 4OM4A 1V6PA 2CDXA 2UX2A 1MR6A 4IYEA 1KS6A 4FAOC 1LX5B 1XT3A 1QM7A 3BT1U 4AEAA 1CREA 1NYSA 4RUDA 1NXBA 1CTXA 3LAQU 1PLOA 1CRFA 1FSCA 1TGXA 2MFAA 1KC4A 1KFHA 2MUOA 1L4WA 1KXIA 1B41B 2BHIA 1IK8A 2CTXA 1IDIA 2MJ4A 2H7ZA 4LFTA 1G6MA 1F8UB 1QKDA 1JBDA 2H8UA 1CXNA 1QKEA 4OM5A 3FEVA 1BXPA 2HLQA 2N99A 3EVSC 1COEA 1FRAA 1ERAA 3NDSA 1UG4A 1S4YA 3NEQA 2QC1A 1JE9A 2MJ0A 1CB9A 4FAOE 1HC9A 2QJ9C 5EBXA 2I9BE 1VB0A 3HH7A 1IJCA 1CDSA 1M9ZA 1RGJA 4HQPF 4KSNA 1KBSA 2MJYA 5DU1A 2MHYA 2H62D 1CCQA 1HAAA 1JGKA 1MAHF 1TXAA 1KBTA 2PJYC 2BTXA 2H64C 1LXHA 1KU6B 1NTNA 2NBTA 1CDQA 4EY8B 1F94A 2MUPA 4BIKB 1CDRA 2JQPA 1LJZA 1IDLA 1CHVS 1NEAA 1KL8A 2QJAC 1YWHA 2H62C 1REWC 1TFSA 1CXOA 3PLCA 2GOOB 2K3GA 3BT2U 3KFDI 1CDTA 2PJYB 2OFSA 2LA1A
chains in the Genus database with same CATH topology
1LSIA 1H0JA 1IDHA 4BDTB 3QB4B 2CCXA 2FD6U 1RL5A 1TXBA 1LXGA 2L03A 2QJBC 5IMYC 1HAJA 2UWRA 3VTSA 1KBAA 2L5SA 4DO8A 2H7ZB 1ONJA 5DO6A 2CRSA 2H5FA 1ERGA 4ZQYA 1NYUA 1ABTA 6EBXA 4UY2C 3EBXA 1NORA 2X8BB 1CVOA 2H64B 1HC9B 3U74U 1NTXA 1IQ9A 3U73U 1BTEA 1KTZB 1FSSB 1W6BA 2JVEA 2CRTA 2HLRA 1HOYA 1FASA 2VLWA 2J8BA 1IDGA 4P7UA 2ABXA 1FFJA 1I02A 3KFDE 1DRSA 3NH7A 2GOOC 4XJJA 1IKCA 1CODA 1FF4A 2LCRA 1ES7B 5DZ5A 1ZADA 2ERAA 5IMTD 3ERAA 4QTIU 4OM4A 1V6PA 2CDXA 2UX2A 1MR6A 4IYEA 1KS6A 4FAOC 1LX5B 1XT3A 1QM7A 3BT1U 4AEAA 1CREA 1NYSA 4RUDA 1NXBA 1CTXA 3LAQU 1PLOA 1CRFA 1FSCA 1TGXA 2MFAA 1KC4A 1KFHA 2MUOA 1L4WA 1KXIA 1B41B 2BHIA 1IK8A 2CTXA 1IDIA 2MJ4A 2H7ZA 4LFTA 1G6MA 1F8UB 1QKDA 1JBDA 2H8UA 1CXNA 1QKEA 4OM5A 3FEVA 1BXPA 2HLQA 2N99A 3EVSC 1COEA 1FRAA 1ERAA 3NDSA 1UG4A 1S4YA 3NEQA 2QC1A 1JE9A 2MJ0A 1CB9A 4FAOE 1HC9A 2QJ9C 5EBXA 2I9BE 1VB0A 3HH7A 1IJCA 1CDSA 1M9ZA 1RGJA 4HQPF 4KSNA 1KBSA 2MJYA 5DU1A 2MHYA 2H62D 1CCQA 1HAAA 1JGKA 1MAHF 1TXAA 1KBTA 2PJYC 2BTXA 2H64C 1LXHA 1KU6B 1NTNA 2NBTA 1CDQA 4EY8B 1F94A 2MUPA 4BIKB 1CDRA 2JQPA 1LJZA 1IDLA 1CHVS 1NEAA 1KL8A 2QJAC 1YWHA 2H62C 1REWC 1TFSA 1CXOA 3PLCA 2GOOB 2K3GA 3BT2U 3KFDI 1CDTA 2PJYB 2OFSA 2LA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSI A;  1H0J A;  1IDH A;  4BDT B;  3QB4 B;  2CCX A;  2FD6 U;  1RL5 A;  1TXB A;  1LXG A;  2L03 A;  2QJB C;  5IMY C;  1HAJ A;  2UWR A;  3VTS A;  1KBA A;  2L5S A;  4DO8 A;  2H7Z B;  1ONJ A;  5DO6 A;  2CRS A;  2H5F A;  1ERG A;  4ZQY A;  1NYU A;  1ABT A;  6EBX A;  4UY2 C;  3EBX A;  1NOR A;  2X8B B;  1CVO A;  2H64 B;  1HC9 B;  3U74 U;  1NTX A;  1IQ9 A;  3U73 U;  1BTE A;  1KTZ B;  1FSS B;  1W6B A;  2JVE A;  2CRT A;  2HLR A;  1HOY A;  1FAS A;  2VLW A;  2J8B A;  1IDG A;  4P7U A;  2ABX A;  1FFJ A;  1I02 A;  3KFD E;  1DRS A;  3NH7 A;  2GOO C;  4XJJ A;  1IKC A;  1COD A;  1FF4 A;  2LCR A;  1ES7 B;  5DZ5 A;  1ZAD A;  2ERA A;  5IMT D;  3ERA A;  4QTI U;  4OM4 A;  1V6P A;  2CDX A;  2UX2 A;  1MR6 A;  4IYE A;  1KS6 A;  4FAO C;  1LX5 B;  1XT3 A;  1QM7 A;  3BT1 U;  4AEA A;  1CRE A;  1NYS A;  4RUD A;  1NXB A;  1CTX A;  3LAQ U;  1PLO A;  1CRF A;  1FSC A;  1TGX A;  2MFA A;  1KC4 A;  1KFH A;  2MUO A;  1L4W A;  1KXI A;  1B41 B;  2BHI A;  1IK8 A;  2CTX A;  1IDI A;  2MJ4 A;  2H7Z A;  4LFT A;  1G6M A;  1F8U B;  1QKD A;  1JBD A;  2H8U A;  1CXN A;  1QKE A;  4OM5 A;  3FEV A;  1BXP A;  2HLQ A;  2N99 A;  3EVS C;  1COE A;  1FRA A;  1ERA A;  3NDS A;  1UG4 A;  1S4Y A;  3NEQ A;  2QC1 A;  1JE9 A;  2MJ0 A;  1CB9 A;  4FAO E;  1HC9 A;  2QJ9 C;  5EBX A;  2I9B E;  1VB0 A;  3HH7 A;  1IJC A;  1CDS A;  1M9Z A;  1RGJ A;  4HQP F;  1KBS A;  2MJY A;  5DU1 A;  2MHY A;  2H62 D;  1CCQ A;  1HAA A;  1JGK A;  1MAH F;  1TXA A;  1KBT A;  2PJY C;  2BTX A;  2H64 C;  1LXH A;  1KU6 B;  1NTN A;  2NBT A;  1CDQ A;  4EY8 B;  1F94 A;  2MUP A;  4BIK B;  1CDR A;  2JQP A;  1LJZ A;  1IDL A;  1CHV S;  1NEA A;  1KL8 A;  2QJA C;  1YWH A;  2H62 C;  1REW C;  1TFS A;  1CXO A;  3PLC A;  2GOO B;  2K3G A;  3BT2 U;  3KFD I;  1CDT A;  2PJY B;  2OFS A;  2LA1 A; 
#chains in the Genus database with same CATH topology
 1LSI A;  1H0J A;  1IDH A;  4BDT B;  3QB4 B;  2CCX A;  2FD6 U;  1RL5 A;  1TXB A;  1LXG A;  2L03 A;  2QJB C;  5IMY C;  1HAJ A;  2UWR A;  3VTS A;  1KBA A;  2L5S A;  4DO8 A;  2H7Z B;  1ONJ A;  5DO6 A;  2CRS A;  2H5F A;  1ERG A;  4ZQY A;  1NYU A;  1ABT A;  6EBX A;  4UY2 C;  3EBX A;  1NOR A;  2X8B B;  1CVO A;  2H64 B;  1HC9 B;  3U74 U;  1NTX A;  1IQ9 A;  3U73 U;  1BTE A;  1KTZ B;  1FSS B;  1W6B A;  2JVE A;  2CRT A;  2HLR A;  1HOY A;  1FAS A;  2VLW A;  2J8B A;  1IDG A;  4P7U A;  2ABX A;  1FFJ A;  1I02 A;  3KFD E;  1DRS A;  3NH7 A;  2GOO C;  4XJJ A;  1IKC A;  1COD A;  1FF4 A;  2LCR A;  1ES7 B;  5DZ5 A;  1ZAD A;  2ERA A;  5IMT D;  3ERA A;  4QTI U;  4OM4 A;  1V6P A;  2CDX A;  2UX2 A;  1MR6 A;  4IYE A;  1KS6 A;  4FAO C;  1LX5 B;  1XT3 A;  1QM7 A;  3BT1 U;  4AEA A;  1CRE A;  1NYS A;  4RUD A;  1NXB A;  1CTX A;  3LAQ U;  1PLO A;  1CRF A;  1FSC A;  1TGX A;  2MFA A;  1KC4 A;  1KFH A;  2MUO A;  1L4W A;  1KXI A;  1B41 B;  2BHI A;  1IK8 A;  2CTX A;  1IDI A;  2MJ4 A;  2H7Z A;  4LFT A;  1G6M A;  1F8U B;  1QKD A;  1JBD A;  2H8U A;  1CXN A;  1QKE A;  4OM5 A;  3FEV A;  1BXP A;  2HLQ A;  2N99 A;  3EVS C;  1COE A;  1FRA A;  1ERA A;  3NDS A;  1UG4 A;  1S4Y A;  3NEQ A;  2QC1 A;  1JE9 A;  2MJ0 A;  1CB9 A;  4FAO E;  1HC9 A;  2QJ9 C;  5EBX A;  2I9B E;  1VB0 A;  3HH7 A;  1IJC A;  1CDS A;  1M9Z A;  1RGJ A;  4HQP F;  4KSN A;  1KBS A;  2MJY A;  5DU1 A;  2MHY A;  2H62 D;  1CCQ A;  1HAA A;  1JGK A;  1MAH F;  1TXA A;  1KBT A;  2PJY C;  2BTX A;  2H64 C;  1LXH A;  1KU6 B;  1NTN A;  2NBT A;  1CDQ A;  4EY8 B;  1F94 A;  2MUP A;  4BIK B;  1CDR A;  2JQP A;  1LJZ A;  1IDL A;  1CHV S;  1NEA A;  1KL8 A;  2QJA C;  1YWH A;  2H62 C;  1REW C;  1TFS A;  1CXO A;  3PLC A;  2GOO B;  2K3G A;  3BT2 U;  3KFD I;  1CDT A;  2PJY B;  2OFS A;  2LA1 A; 
#chains in the Genus database with same CATH homology
 1LSI A;  1H0J A;  1IDH A;  4BDT B;  3QB4 B;  2CCX A;  2FD6 U;  1RL5 A;  1TXB A;  1LXG A;  2L03 A;  2QJB C;  5IMY C;  1HAJ A;  2UWR A;  3VTS A;  1KBA A;  2L5S A;  4DO8 A;  2H7Z B;  1ONJ A;  5DO6 A;  2CRS A;  2H5F A;  1ERG A;  4ZQY A;  1NYU A;  1ABT A;  6EBX A;  4UY2 C;  3EBX A;  1NOR A;  2X8B B;  1CVO A;  2H64 B;  1HC9 B;  3U74 U;  1NTX A;  1IQ9 A;  3U73 U;  1BTE A;  1KTZ B;  1FSS B;  1W6B A;  2JVE A;  2CRT A;  2HLR A;  1HOY A;  1FAS A;  2VLW A;  2J8B A;  1IDG A;  4P7U A;  2ABX A;  1FFJ A;  1I02 A;  3KFD E;  1DRS A;  3NH7 A;  2GOO C;  4XJJ A;  1IKC A;  1COD A;  1FF4 A;  2LCR A;  1ES7 B;  5DZ5 A;  1ZAD A;  2ERA A;  5IMT D;  3ERA A;  4QTI U;  4OM4 A;  1V6P A;  2CDX A;  2UX2 A;  1MR6 A;  4IYE A;  1KS6 A;  4FAO C;  1LX5 B;  1XT3 A;  1QM7 A;  3BT1 U;  4AEA A;  1CRE A;  1NYS A;  4RUD A;  1NXB A;  1CTX A;  3LAQ U;  1PLO A;  1CRF A;  1FSC A;  1TGX A;  2MFA A;  1KC4 A;  1KFH A;  2MUO A;  1L4W A;  1KXI A;  1B41 B;  2BHI A;  1IK8 A;  2CTX A;  1IDI A;  2MJ4 A;  2H7Z A;  4LFT A;  1G6M A;  1F8U B;  1QKD A;  1JBD A;  2H8U A;  1CXN A;  1QKE A;  4OM5 A;  3FEV A;  1BXP A;  2HLQ A;  2N99 A;  3EVS C;  1COE A;  1FRA A;  1ERA A;  3NDS A;  1UG4 A;  1S4Y A;  3NEQ A;  2QC1 A;  1JE9 A;  2MJ0 A;  1CB9 A;  4FAO E;  1HC9 A;  2QJ9 C;  5EBX A;  2I9B E;  1VB0 A;  3HH7 A;  1IJC A;  1CDS A;  1M9Z A;  1RGJ A;  4HQP F;  4KSN A;  1KBS A;  2MJY A;  5DU1 A;  2MHY A;  2H62 D;  1CCQ A;  1HAA A;  1JGK A;  1MAH F;  1TXA A;  1KBT A;  2PJY C;  2BTX A;  2H64 C;  1LXH A;  1KU6 B;  1NTN A;  2NBT A;  1CDQ A;  4EY8 B;  1F94 A;  2MUP A;  4BIK B;  1CDR A;  2JQP A;  1LJZ A;  1IDL A;  1CHV S;  1NEA A;  1KL8 A;  2QJA C;  1YWH A;  2H62 C;  1REW C;  1TFS A;  1CXO A;  3PLC A;  2GOO B;  2K3G A;  3BT2 U;  3KFD I;  1CDT A;  2PJY B;  2OFS A;  2LA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...