1HC9A

Alpha-bungarotoxin complexed with high affinity peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-BUNGAROTOXIN ISOFORM V31
publication title The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
pubmed doi rcsb
molecule tags Toxin/peptide
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hc9A00
2MUOA 1XT3A 2MJYA 2FD6U 4LFTA 1QM7A 4BDTB 4DO8A 1IJCA 1QKEA 1JE9A 4RUDA 1KL8A 1NYUA 3NH7A 5DU1A 5IMTD 1G6MA 3PLCA 4FAOC 3NEQA 1JBDA 1RGJA 2QJBC 2BTXA 3LAQU 1LX5B 1F8UB 1S4YA 2QC1A 4IYEA 1FASA 1ONJA 2H64C 2L5SA 3BT2U 4ZQYA 3U74U 1ZADA 2LCRA 2K3GA 1CTXA 1CVOA 1IDGA 1LJZA 1CDSA 1BTEA 1HC9A 1V6PA 2PJYC 1JGKA 1VB0A 1W6BA 2HLQA 3KFDE 1TGXA 1COEA 2CCXA 2H8UA 4OM4A 1MR6A 1CDTA 3EBXA 1FRAA 2L03A 1IQ9A 2H62D 1FSSB 2H62C 2H7ZA 1IK8A 2JVEA 2I9BE 1F94A 1CODA 2VLWA 2GOOB 3NDSA 4OM5A 3HH7A 1KBTA 5DO6A 2JQPA 4QTIU 4HQPF 5IMYC 2ABXA 1UG4A 1LXGA 2HLRA 1KC4A 1CREA 1CHVS 2MFAA 2QJAC 1KTZB 1NTNA 2MUPA 1KBSA 1CXNA 3FEVA 3U73U 1ES7B 1CCQA 1QKDA 1KU6B 3EVSC 3BT1U 4BIKB 1PLOA 1KBAA 1MAHF 1KXIA 1TXAA 1FFJA 1BXPA 2CDXA 2CRSA 3KFDI 3VTSA 2H64B 1NTXA 4UY2C 1TXBA 2N99A 2NBTA 4AEAA 2CTXA 2UWRA 4EY8B 1NYSA 2OFSA 1ERAA 1NEAA 2MJ4A 1CRFA 1KFHA 1DRSA 4P7UA 4XJJA 2MHYA 2X8BB 2ERAA 1CDQA 6EBXA 1REWC 2LA1A 3QB4B 1CXOA 1NORA 1IDLA 1B41B 3ERAA 1HOYA 5EBXA 1IDIA 1RL5A 1CDRA 2J8BA 1FSCA 4FAOE 2MJ0A 1IKCA 1LSIA 1FF4A 1HC9B 2GOOC 1ERGA 1KS6A 1LXHA 1TFSA 2UX2A 1IDHA 1HAAA 1ABTA 1H0JA 1L4WA 2QJ9C 1HAJA 1NXBA 5DZ5A 1I02A 2H5FA 1YWHA 2CRTA 1CB9A 2H7ZB 2PJYB 2BHIA 1M9ZA
chains in the Genus database with same CATH superfamily
2MUOA 1XT3A 2MJYA 2FD6U 4LFTA 1QM7A 4BDTB 4DO8A 1IJCA 1QKEA 1JE9A 4RUDA 1KL8A 1NYUA 3NH7A 5DU1A 5IMTD 1G6MA 3PLCA 4FAOC 3NEQA 1JBDA 1RGJA 2QJBC 2BTXA 3LAQU 1LX5B 4KSNA 1F8UB 1S4YA 2QC1A 4IYEA 1FASA 1ONJA 2H64C 2L5SA 3BT2U 4ZQYA 3U74U 1ZADA 2LCRA 2K3GA 1CTXA 1CVOA 1IDGA 1LJZA 1CDSA 1BTEA 1HC9A 1V6PA 2PJYC 1JGKA 1VB0A 1W6BA 2HLQA 3KFDE 1TGXA 1COEA 2CCXA 2H8UA 4OM4A 1MR6A 1CDTA 3EBXA 1FRAA 2L03A 1IQ9A 2H62D 1FSSB 2H62C 2H7ZA 1IK8A 2JVEA 2I9BE 1F94A 1CODA 2VLWA 2GOOB 3NDSA 4OM5A 3HH7A 1KBTA 5DO6A 2JQPA 4QTIU 4HQPF 5IMYC 2ABXA 1UG4A 1LXGA 2HLRA 1KC4A 1CREA 1CHVS 2MFAA 2QJAC 1KTZB 1NTNA 2MUPA 1KBSA 1CXNA 3FEVA 3U73U 1ES7B 1CCQA 1QKDA 1KU6B 3EVSC 3BT1U 4BIKB 1PLOA 1KBAA 1MAHF 1KXIA 1TXAA 1FFJA 1BXPA 2CDXA 2CRSA 3KFDI 3VTSA 2H64B 1NTXA 4UY2C 1TXBA 2N99A 2NBTA 4AEAA 2CTXA 2UWRA 4EY8B 1NYSA 2OFSA 1ERAA 1NEAA 2MJ4A 1CRFA 1KFHA 1DRSA 4P7UA 4XJJA 2MHYA 2X8BB 2ERAA 1CDQA 6EBXA 1REWC 2LA1A 3QB4B 1CXOA 1NORA 1IDLA 1B41B 3ERAA 1HOYA 5EBXA 1IDIA 1RL5A 1CDRA 2J8BA 1FSCA 4FAOE 2MJ0A 1IKCA 1LSIA 1FF4A 1HC9B 2GOOC 1ERGA 1KS6A 1LXHA 1TFSA 2UX2A 1IDHA 1HAAA 1ABTA 1H0JA 1L4WA 2QJ9C 1HAJA 1NXBA 5DZ5A 1I02A 2H5FA 1YWHA 2CRTA 1CB9A 2H7ZB 2PJYB 2BHIA 1M9ZA
chains in the Genus database with same CATH topology
2MUOA 1XT3A 2MJYA 2FD6U 4LFTA 1QM7A 4BDTB 4DO8A 1IJCA 1QKEA 1JE9A 4RUDA 1KL8A 1NYUA 3NH7A 5DU1A 5IMTD 1G6MA 3PLCA 4FAOC 3NEQA 1JBDA 1RGJA 2QJBC 2BTXA 3LAQU 1LX5B 4KSNA 1F8UB 1S4YA 2QC1A 4IYEA 1FASA 1ONJA 2H64C 2L5SA 3BT2U 4ZQYA 3U74U 1ZADA 2LCRA 2K3GA 1CTXA 1CVOA 1IDGA 1LJZA 1CDSA 1BTEA 1HC9A 1V6PA 2PJYC 1JGKA 1VB0A 1W6BA 2HLQA 3KFDE 1TGXA 1COEA 2CCXA 2H8UA 4OM4A 1MR6A 1CDTA 3EBXA 1FRAA 2L03A 1IQ9A 2H62D 1FSSB 2H62C 2H7ZA 1IK8A 2JVEA 2I9BE 1F94A 1CODA 2VLWA 2GOOB 3NDSA 4OM5A 3HH7A 1KBTA 5DO6A 2JQPA 4QTIU 4HQPF 5IMYC 2ABXA 1UG4A 1LXGA 2HLRA 1KC4A 1CREA 1CHVS 2MFAA 2QJAC 1KTZB 1NTNA 2MUPA 1KBSA 1CXNA 3FEVA 3U73U 1ES7B 1CCQA 1QKDA 1KU6B 3EVSC 3BT1U 4BIKB 1PLOA 1KBAA 1MAHF 1KXIA 1TXAA 1FFJA 1BXPA 2CDXA 2CRSA 3KFDI 3VTSA 2H64B 1NTXA 4UY2C 1TXBA 2N99A 2NBTA 4AEAA 2CTXA 2UWRA 4EY8B 1NYSA 2OFSA 1ERAA 1NEAA 2MJ4A 1CRFA 1KFHA 1DRSA 4P7UA 4XJJA 2MHYA 2X8BB 2ERAA 1CDQA 6EBXA 1REWC 2LA1A 3QB4B 1CXOA 1NORA 1IDLA 1B41B 3ERAA 1HOYA 5EBXA 1IDIA 1RL5A 1CDRA 2J8BA 1FSCA 4FAOE 2MJ0A 1IKCA 1LSIA 1FF4A 1HC9B 2GOOC 1ERGA 1KS6A 1LXHA 1TFSA 2UX2A 1IDHA 1HAAA 1ABTA 1H0JA 1L4WA 2QJ9C 1HAJA 1NXBA 5DZ5A 1I02A 2H5FA 1YWHA 2CRTA 1CB9A 2H7ZB 2PJYB 2BHIA 1M9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUO A;  1XT3 A;  2MJY A;  2FD6 U;  4LFT A;  1QM7 A;  4BDT B;  4DO8 A;  1IJC A;  1QKE A;  1JE9 A;  4RUD A;  1KL8 A;  1NYU A;  3NH7 A;  5DU1 A;  5IMT D;  1G6M A;  3PLC A;  4FAO C;  3NEQ A;  1JBD A;  1RGJ A;  2QJB C;  2BTX A;  3LAQ U;  1LX5 B;  1F8U B;  1S4Y A;  2QC1 A;  4IYE A;  1FAS A;  1ONJ A;  2H64 C;  2L5S A;  3BT2 U;  4ZQY A;  3U74 U;  1ZAD A;  2LCR A;  2K3G A;  1CTX A;  1CVO A;  1IDG A;  1LJZ A;  1CDS A;  1BTE A;  1HC9 A;  1V6P A;  2PJY C;  1JGK A;  1VB0 A;  1W6B A;  2HLQ A;  3KFD E;  1TGX A;  1COE A;  2CCX A;  2H8U A;  4OM4 A;  1MR6 A;  1CDT A;  3EBX A;  1FRA A;  2L03 A;  1IQ9 A;  2H62 D;  1FSS B;  2H62 C;  2H7Z A;  1IK8 A;  2JVE A;  2I9B E;  1F94 A;  1COD A;  2VLW A;  2GOO B;  3NDS A;  4OM5 A;  3HH7 A;  1KBT A;  5DO6 A;  2JQP A;  4QTI U;  4HQP F;  5IMY C;  2ABX A;  1UG4 A;  1LXG A;  2HLR A;  1KC4 A;  1CRE A;  1CHV S;  2MFA A;  2QJA C;  1KTZ B;  1NTN A;  2MUP A;  1KBS A;  1CXN A;  3FEV A;  3U73 U;  1ES7 B;  1CCQ A;  1QKD A;  1KU6 B;  3EVS C;  3BT1 U;  4BIK B;  1PLO A;  1KBA A;  1MAH F;  1KXI A;  1TXA A;  1FFJ A;  1BXP A;  2CDX A;  2CRS A;  3KFD I;  3VTS A;  2H64 B;  1NTX A;  4UY2 C;  1TXB A;  2N99 A;  2NBT A;  4AEA A;  2CTX A;  2UWR A;  4EY8 B;  1NYS A;  2OFS A;  1ERA A;  1NEA A;  2MJ4 A;  1CRF A;  1KFH A;  1DRS A;  4P7U A;  4XJJ A;  2MHY A;  2X8B B;  2ERA A;  1CDQ A;  6EBX A;  1REW C;  2LA1 A;  3QB4 B;  1CXO A;  1NOR A;  1IDL A;  1B41 B;  3ERA A;  1HOY A;  5EBX A;  1IDI A;  1RL5 A;  1CDR A;  2J8B A;  1FSC A;  4FAO E;  2MJ0 A;  1IKC A;  1LSI A;  1FF4 A;  1HC9 B;  2GOO C;  1ERG A;  1KS6 A;  1LXH A;  1TFS A;  2UX2 A;  1IDH A;  1HAA A;  1ABT A;  1H0J A;  1L4W A;  2QJ9 C;  1HAJ A;  1NXB A;  5DZ5 A;  1I02 A;  2H5F A;  1YWH A;  2CRT A;  1CB9 A;  2H7Z B;  2PJY B;  2BHI A;  1M9Z A; 
#chains in the Genus database with same CATH topology
 2MUO A;  1XT3 A;  2MJY A;  2FD6 U;  4LFT A;  1QM7 A;  4BDT B;  4DO8 A;  1IJC A;  1QKE A;  1JE9 A;  4RUD A;  1KL8 A;  1NYU A;  3NH7 A;  5DU1 A;  5IMT D;  1G6M A;  3PLC A;  4FAO C;  3NEQ A;  1JBD A;  1RGJ A;  2QJB C;  2BTX A;  3LAQ U;  1LX5 B;  4KSN A;  1F8U B;  1S4Y A;  2QC1 A;  4IYE A;  1FAS A;  1ONJ A;  2H64 C;  2L5S A;  3BT2 U;  4ZQY A;  3U74 U;  1ZAD A;  2LCR A;  2K3G A;  1CTX A;  1CVO A;  1IDG A;  1LJZ A;  1CDS A;  1BTE A;  1HC9 A;  1V6P A;  2PJY C;  1JGK A;  1VB0 A;  1W6B A;  2HLQ A;  3KFD E;  1TGX A;  1COE A;  2CCX A;  2H8U A;  4OM4 A;  1MR6 A;  1CDT A;  3EBX A;  1FRA A;  2L03 A;  1IQ9 A;  2H62 D;  1FSS B;  2H62 C;  2H7Z A;  1IK8 A;  2JVE A;  2I9B E;  1F94 A;  1COD A;  2VLW A;  2GOO B;  3NDS A;  4OM5 A;  3HH7 A;  1KBT A;  5DO6 A;  2JQP A;  4QTI U;  4HQP F;  5IMY C;  2ABX A;  1UG4 A;  1LXG A;  2HLR A;  1KC4 A;  1CRE A;  1CHV S;  2MFA A;  2QJA C;  1KTZ B;  1NTN A;  2MUP A;  1KBS A;  1CXN A;  3FEV A;  3U73 U;  1ES7 B;  1CCQ A;  1QKD A;  1KU6 B;  3EVS C;  3BT1 U;  4BIK B;  1PLO A;  1KBA A;  1MAH F;  1KXI A;  1TXA A;  1FFJ A;  1BXP A;  2CDX A;  2CRS A;  3KFD I;  3VTS A;  2H64 B;  1NTX A;  4UY2 C;  1TXB A;  2N99 A;  2NBT A;  4AEA A;  2CTX A;  2UWR A;  4EY8 B;  1NYS A;  2OFS A;  1ERA A;  1NEA A;  2MJ4 A;  1CRF A;  1KFH A;  1DRS A;  4P7U A;  4XJJ A;  2MHY A;  2X8B B;  2ERA A;  1CDQ A;  6EBX A;  1REW C;  2LA1 A;  3QB4 B;  1CXO A;  1NOR A;  1IDL A;  1B41 B;  3ERA A;  1HOY A;  5EBX A;  1IDI A;  1RL5 A;  1CDR A;  2J8B A;  1FSC A;  4FAO E;  2MJ0 A;  1IKC A;  1LSI A;  1FF4 A;  1HC9 B;  2GOO C;  1ERG A;  1KS6 A;  1LXH A;  1TFS A;  2UX2 A;  1IDH A;  1HAA A;  1ABT A;  1H0J A;  1L4W A;  2QJ9 C;  1HAJ A;  1NXB A;  5DZ5 A;  1I02 A;  2H5F A;  1YWH A;  2CRT A;  1CB9 A;  2H7Z B;  2PJY B;  2BHI A;  1M9Z A; 
#chains in the Genus database with same CATH homology
 2MUO A;  1XT3 A;  2MJY A;  2FD6 U;  4LFT A;  1QM7 A;  4BDT B;  4DO8 A;  1IJC A;  1QKE A;  1JE9 A;  4RUD A;  1KL8 A;  1NYU A;  3NH7 A;  5DU1 A;  5IMT D;  1G6M A;  3PLC A;  4FAO C;  3NEQ A;  1JBD A;  1RGJ A;  2QJB C;  2BTX A;  3LAQ U;  1LX5 B;  4KSN A;  1F8U B;  1S4Y A;  2QC1 A;  4IYE A;  1FAS A;  1ONJ A;  2H64 C;  2L5S A;  3BT2 U;  4ZQY A;  3U74 U;  1ZAD A;  2LCR A;  2K3G A;  1CTX A;  1CVO A;  1IDG A;  1LJZ A;  1CDS A;  1BTE A;  1HC9 A;  1V6P A;  2PJY C;  1JGK A;  1VB0 A;  1W6B A;  2HLQ A;  3KFD E;  1TGX A;  1COE A;  2CCX A;  2H8U A;  4OM4 A;  1MR6 A;  1CDT A;  3EBX A;  1FRA A;  2L03 A;  1IQ9 A;  2H62 D;  1FSS B;  2H62 C;  2H7Z A;  1IK8 A;  2JVE A;  2I9B E;  1F94 A;  1COD A;  2VLW A;  2GOO B;  3NDS A;  4OM5 A;  3HH7 A;  1KBT A;  5DO6 A;  2JQP A;  4QTI U;  4HQP F;  5IMY C;  2ABX A;  1UG4 A;  1LXG A;  2HLR A;  1KC4 A;  1CRE A;  1CHV S;  2MFA A;  2QJA C;  1KTZ B;  1NTN A;  2MUP A;  1KBS A;  1CXN A;  3FEV A;  3U73 U;  1ES7 B;  1CCQ A;  1QKD A;  1KU6 B;  3EVS C;  3BT1 U;  4BIK B;  1PLO A;  1KBA A;  1MAH F;  1KXI A;  1TXA A;  1FFJ A;  1BXP A;  2CDX A;  2CRS A;  3KFD I;  3VTS A;  2H64 B;  1NTX A;  4UY2 C;  1TXB A;  2N99 A;  2NBT A;  4AEA A;  2CTX A;  2UWR A;  4EY8 B;  1NYS A;  2OFS A;  1ERA A;  1NEA A;  2MJ4 A;  1CRF A;  1KFH A;  1DRS A;  4P7U A;  4XJJ A;  2MHY A;  2X8B B;  2ERA A;  1CDQ A;  6EBX A;  1REW C;  2LA1 A;  3QB4 B;  1CXO A;  1NOR A;  1IDL A;  1B41 B;  3ERA A;  1HOY A;  5EBX A;  1IDI A;  1RL5 A;  1CDR A;  2J8B A;  1FSC A;  4FAO E;  2MJ0 A;  1IKC A;  1LSI A;  1FF4 A;  1HC9 B;  2GOO C;  1ERG A;  1KS6 A;  1LXH A;  1TFS A;  2UX2 A;  1IDH A;  1HAA A;  1ABT A;  1H0J A;  1L4W A;  2QJ9 C;  1HAJ A;  1NXB A;  5DZ5 A;  1I02 A;  2H5F A;  1YWH A;  2CRT A;  1CB9 A;  2H7Z B;  2PJY B;  2BHI A;  1M9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...