1HC9A

Alpha-bungarotoxin complexed with high affinity peptide
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin/peptide
molecule keywords ALPHA-BUNGAROTOXIN ISOFORM V31
publication title The Binding Site of Acetylcholine Receptor as Visualized in the X-Ray Structure of a Complex between Alpha-Bungarotoxin and a Mimotope Peptide.
pubmed doi rcsb
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1hc9A00
1VB0A 3NEQA 4HQPF 3PLCA 3BT2U 2UX2A 1ERGA 2PJYB 1G6MA 1CB9A 1IK8A 1KS6A 1CTXA 3ERAA 2ERAA 2MJ4A 2K3GA 1RGJA 1M9ZA 1CDRA 2CTXA 1B41B 5IMTD 1KC4A 1ZADA 1FSCA 1L4WA 1UG4A 1KBSA 4P7UA 1IDHA 1HAJA 4RUDA 5DO6A 1CREA 2CRTA 4BIKB 1I02A 2H62C 2MFAA 2H64C 1IDGA 1CCQA 1KBAA 1NYSA 2CDXA 2H7ZA 3U74U 1CXOA 1KFHA 1IQ9A 2MJYA 2I9BE 1DRSA 4EY8B 1TXAA 1LXGA 2N99A 2QC1A 1XT3A 2UWRA 3KFDI 1IKCA 2VLWA 4BDTB 1CHVS 1REWC 1KL8A 1NTXA 2LCRA 1FSSB 3HH7A 4IYEA 4OM5A 4FAOE 1HC9A 1CXNA 1ES7B 1F8UB 1LSIA 1ABTA 1NORA 3EVSC 3U73U 1QKDA 1CVOA 2MUOA 2QJ9C 1LXHA 2CCXA 2MUPA 1H0JA 1F94A 2L03A 1CDTA 1CDSA 1BTEA 3NH7A 1LX5B 1NYUA 1CODA 1HAAA 1IDIA 1RL5A 1QKEA 3KFDE 4QTIU 2LA1A 2GOOC 6EBXA 5IMYC 1NTNA 2H64B 2BHIA 1S4YA 1FF4A 2H5FA 1JE9A 3QB4B 4DO8A 2JQPA 1TXBA 2PJYC 1JGKA 2HLQA 2MHYA 2J8BA 2OFSA 4FAOC 1LJZA 1MAHF 4LFTA 2L5SA 2QJAC 3BT1U 5DZ5A 1HOYA 2BTXA 1ONJA 1MR6A 2NBTA 1KTZB 1KXIA 4OM4A 2ABXA 1FFJA 1NXBA 1KBTA 1QM7A 1FRAA 3FEVA 1CDQA 1JBDA 5EBXA 2FD6U 1V6PA 1YWHA 2X8BB 3NDSA 1COEA 2H7ZB 4ZQYA 2JVEA 4AEAA 2MJ0A 4XJJA 3VTSA 1BXPA 4UY2C 1IJCA 1PLOA 1IDLA 1FASA 2H8UA 1KU6B 1TGXA 2QJBC 2HLRA 1CRFA 3LAQU 1ERAA 1HC9B 1TFSA 2GOOB 3EBXA 2H62D 1NEAA 2CRSA 1W6BA 5DU1A
chains in the Genus database with same CATH superfamily
1VB0A 3NEQA 4HQPF 3PLCA 3BT2U 2UX2A 1ERGA 2PJYB 1G6MA 1CB9A 1IK8A 1KS6A 1CTXA 3ERAA 2ERAA 2MJ4A 2K3GA 1RGJA 1M9ZA 1CDRA 2CTXA 1B41B 5IMTD 1KC4A 1ZADA 1FSCA 1L4WA 1UG4A 1KBSA 4P7UA 1IDHA 1HAJA 4RUDA 5DO6A 1CREA 2CRTA 4BIKB 1I02A 2H62C 2MFAA 2H64C 1IDGA 1CCQA 1KBAA 1NYSA 2CDXA 2H7ZA 3U74U 1CXOA 1KFHA 1IQ9A 2MJYA 2I9BE 1DRSA 4EY8B 1TXAA 1LXGA 2N99A 2QC1A 1XT3A 2UWRA 3KFDI 1IKCA 2VLWA 4BDTB 1CHVS 1REWC 1KL8A 1NTXA 2LCRA 1FSSB 3HH7A 4IYEA 4OM5A 4FAOE 1HC9A 1CXNA 1ES7B 4KSNA 1F8UB 1LSIA 1ABTA 1NORA 3EVSC 3U73U 1QKDA 1CVOA 2MUOA 2QJ9C 1LXHA 2CCXA 2MUPA 1H0JA 1F94A 2L03A 1CDTA 1CDSA 1BTEA 3NH7A 1LX5B 1NYUA 1CODA 1HAAA 1IDIA 1RL5A 1QKEA 3KFDE 4QTIU 2LA1A 2GOOC 6EBXA 5IMYC 1NTNA 2H64B 2BHIA 1S4YA 1FF4A 2H5FA 1JE9A 3QB4B 4DO8A 2JQPA 1TXBA 2PJYC 1JGKA 2HLQA 2MHYA 2J8BA 2OFSA 4FAOC 1LJZA 1MAHF 4LFTA 2L5SA 2QJAC 3BT1U 5DZ5A 1HOYA 2BTXA 1ONJA 1MR6A 2NBTA 1KTZB 1KXIA 4OM4A 2ABXA 1FFJA 1NXBA 1KBTA 1QM7A 1FRAA 3FEVA 1CDQA 1JBDA 5EBXA 2FD6U 1V6PA 1YWHA 2X8BB 3NDSA 1COEA 2H7ZB 4ZQYA 2JVEA 4AEAA 2MJ0A 4XJJA 3VTSA 1BXPA 4UY2C 1IJCA 1PLOA 1IDLA 1FASA 2H8UA 1KU6B 1TGXA 2QJBC 2HLRA 1CRFA 3LAQU 1ERAA 1HC9B 1TFSA 2GOOB 3EBXA 2H62D 1NEAA 2CRSA 1W6BA 5DU1A
chains in the Genus database with same CATH topology
1VB0A 3NEQA 4HQPF 3PLCA 3BT2U 2UX2A 1ERGA 2PJYB 1G6MA 1CB9A 1IK8A 1KS6A 1CTXA 3ERAA 2ERAA 2MJ4A 2K3GA 1RGJA 1M9ZA 1CDRA 2CTXA 1B41B 5IMTD 1KC4A 1ZADA 1FSCA 1L4WA 1UG4A 1KBSA 4P7UA 1IDHA 1HAJA 4RUDA 5DO6A 1CREA 2CRTA 4BIKB 1I02A 2H62C 2MFAA 2H64C 1IDGA 1CCQA 1KBAA 1NYSA 2CDXA 2H7ZA 3U74U 1CXOA 1KFHA 1IQ9A 2MJYA 2I9BE 1DRSA 4EY8B 1TXAA 1LXGA 2N99A 2QC1A 1XT3A 2UWRA 3KFDI 1IKCA 2VLWA 4BDTB 1CHVS 1REWC 1KL8A 1NTXA 2LCRA 1FSSB 3HH7A 4IYEA 4OM5A 4FAOE 1HC9A 1CXNA 1ES7B 4KSNA 1F8UB 1LSIA 1ABTA 1NORA 3EVSC 3U73U 1QKDA 1CVOA 2MUOA 2QJ9C 1LXHA 2CCXA 2MUPA 1H0JA 1F94A 2L03A 1CDTA 1CDSA 1BTEA 3NH7A 1LX5B 1NYUA 1CODA 1HAAA 1IDIA 1RL5A 1QKEA 3KFDE 4QTIU 2LA1A 2GOOC 6EBXA 5IMYC 1NTNA 2H64B 2BHIA 1S4YA 1FF4A 2H5FA 1JE9A 3QB4B 4DO8A 2JQPA 1TXBA 2PJYC 1JGKA 2HLQA 2MHYA 2J8BA 2OFSA 4FAOC 1LJZA 1MAHF 4LFTA 2L5SA 2QJAC 3BT1U 5DZ5A 1HOYA 2BTXA 1ONJA 1MR6A 2NBTA 1KTZB 1KXIA 4OM4A 2ABXA 1FFJA 1NXBA 1KBTA 1QM7A 1FRAA 3FEVA 1CDQA 1JBDA 5EBXA 2FD6U 1V6PA 1YWHA 2X8BB 3NDSA 1COEA 2H7ZB 4ZQYA 2JVEA 4AEAA 2MJ0A 4XJJA 3VTSA 1BXPA 4UY2C 1IJCA 1PLOA 1IDLA 1FASA 2H8UA 1KU6B 1TGXA 2QJBC 2HLRA 1CRFA 3LAQU 1ERAA 1HC9B 1TFSA 2GOOB 3EBXA 2H62D 1NEAA 2CRSA 1W6BA 5DU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VB0 A;  3NEQ A;  4HQP F;  3PLC A;  3BT2 U;  2UX2 A;  1ERG A;  2PJY B;  1G6M A;  1CB9 A;  1IK8 A;  1KS6 A;  1CTX A;  3ERA A;  2ERA A;  2MJ4 A;  2K3G A;  1RGJ A;  1M9Z A;  1CDR A;  2CTX A;  1B41 B;  5IMT D;  1KC4 A;  1ZAD A;  1FSC A;  1L4W A;  1UG4 A;  1KBS A;  4P7U A;  1IDH A;  1HAJ A;  4RUD A;  5DO6 A;  1CRE A;  2CRT A;  4BIK B;  1I02 A;  2H62 C;  2MFA A;  2H64 C;  1IDG A;  1CCQ A;  1KBA A;  1NYS A;  2CDX A;  2H7Z A;  3U74 U;  1CXO A;  1KFH A;  1IQ9 A;  2MJY A;  2I9B E;  1DRS A;  4EY8 B;  1TXA A;  1LXG A;  2N99 A;  2QC1 A;  1XT3 A;  2UWR A;  3KFD I;  1IKC A;  2VLW A;  4BDT B;  1CHV S;  1REW C;  1KL8 A;  1NTX A;  2LCR A;  1FSS B;  3HH7 A;  4IYE A;  4OM5 A;  4FAO E;  1HC9 A;  1CXN A;  1ES7 B;  1F8U B;  1LSI A;  1ABT A;  1NOR A;  3EVS C;  3U73 U;  1QKD A;  1CVO A;  2MUO A;  2QJ9 C;  1LXH A;  2CCX A;  2MUP A;  1H0J A;  1F94 A;  2L03 A;  1CDT A;  1CDS A;  1BTE A;  3NH7 A;  1LX5 B;  1NYU A;  1COD A;  1HAA A;  1IDI A;  1RL5 A;  1QKE A;  3KFD E;  4QTI U;  2LA1 A;  2GOO C;  6EBX A;  5IMY C;  1NTN A;  2H64 B;  2BHI A;  1S4Y A;  1FF4 A;  2H5F A;  1JE9 A;  3QB4 B;  4DO8 A;  2JQP A;  1TXB A;  2PJY C;  1JGK A;  2HLQ A;  2MHY A;  2J8B A;  2OFS A;  4FAO C;  1LJZ A;  1MAH F;  4LFT A;  2L5S A;  2QJA C;  3BT1 U;  5DZ5 A;  1HOY A;  2BTX A;  1ONJ A;  1MR6 A;  2NBT A;  1KTZ B;  1KXI A;  4OM4 A;  2ABX A;  1FFJ A;  1NXB A;  1KBT A;  1QM7 A;  1FRA A;  3FEV A;  1CDQ A;  1JBD A;  5EBX A;  2FD6 U;  1V6P A;  1YWH A;  2X8B B;  3NDS A;  1COE A;  2H7Z B;  4ZQY A;  2JVE A;  4AEA A;  2MJ0 A;  4XJJ A;  3VTS A;  1BXP A;  4UY2 C;  1IJC A;  1PLO A;  1IDL A;  1FAS A;  2H8U A;  1KU6 B;  1TGX A;  2QJB C;  2HLR A;  1CRF A;  3LAQ U;  1ERA A;  1HC9 B;  1TFS A;  2GOO B;  3EBX A;  2H62 D;  1NEA A;  2CRS A;  1W6B A;  5DU1 A; 
#chains in the Genus database with same CATH topology
 1VB0 A;  3NEQ A;  4HQP F;  3PLC A;  3BT2 U;  2UX2 A;  1ERG A;  2PJY B;  1G6M A;  1CB9 A;  1IK8 A;  1KS6 A;  1CTX A;  3ERA A;  2ERA A;  2MJ4 A;  2K3G A;  1RGJ A;  1M9Z A;  1CDR A;  2CTX A;  1B41 B;  5IMT D;  1KC4 A;  1ZAD A;  1FSC A;  1L4W A;  1UG4 A;  1KBS A;  4P7U A;  1IDH A;  1HAJ A;  4RUD A;  5DO6 A;  1CRE A;  2CRT A;  4BIK B;  1I02 A;  2H62 C;  2MFA A;  2H64 C;  1IDG A;  1CCQ A;  1KBA A;  1NYS A;  2CDX A;  2H7Z A;  3U74 U;  1CXO A;  1KFH A;  1IQ9 A;  2MJY A;  2I9B E;  1DRS A;  4EY8 B;  1TXA A;  1LXG A;  2N99 A;  2QC1 A;  1XT3 A;  2UWR A;  3KFD I;  1IKC A;  2VLW A;  4BDT B;  1CHV S;  1REW C;  1KL8 A;  1NTX A;  2LCR A;  1FSS B;  3HH7 A;  4IYE A;  4OM5 A;  4FAO E;  1HC9 A;  1CXN A;  1ES7 B;  4KSN A;  1F8U B;  1LSI A;  1ABT A;  1NOR A;  3EVS C;  3U73 U;  1QKD A;  1CVO A;  2MUO A;  2QJ9 C;  1LXH A;  2CCX A;  2MUP A;  1H0J A;  1F94 A;  2L03 A;  1CDT A;  1CDS A;  1BTE A;  3NH7 A;  1LX5 B;  1NYU A;  1COD A;  1HAA A;  1IDI A;  1RL5 A;  1QKE A;  3KFD E;  4QTI U;  2LA1 A;  2GOO C;  6EBX A;  5IMY C;  1NTN A;  2H64 B;  2BHI A;  1S4Y A;  1FF4 A;  2H5F A;  1JE9 A;  3QB4 B;  4DO8 A;  2JQP A;  1TXB A;  2PJY C;  1JGK A;  2HLQ A;  2MHY A;  2J8B A;  2OFS A;  4FAO C;  1LJZ A;  1MAH F;  4LFT A;  2L5S A;  2QJA C;  3BT1 U;  5DZ5 A;  1HOY A;  2BTX A;  1ONJ A;  1MR6 A;  2NBT A;  1KTZ B;  1KXI A;  4OM4 A;  2ABX A;  1FFJ A;  1NXB A;  1KBT A;  1QM7 A;  1FRA A;  3FEV A;  1CDQ A;  1JBD A;  5EBX A;  2FD6 U;  1V6P A;  1YWH A;  2X8B B;  3NDS A;  1COE A;  2H7Z B;  4ZQY A;  2JVE A;  4AEA A;  2MJ0 A;  4XJJ A;  3VTS A;  1BXP A;  4UY2 C;  1IJC A;  1PLO A;  1IDL A;  1FAS A;  2H8U A;  1KU6 B;  1TGX A;  2QJB C;  2HLR A;  1CRF A;  3LAQ U;  1ERA A;  1HC9 B;  1TFS A;  2GOO B;  3EBX A;  2H62 D;  1NEA A;  2CRS A;  1W6B A;  5DU1 A; 
#chains in the Genus database with same CATH homology
 1VB0 A;  3NEQ A;  4HQP F;  3PLC A;  3BT2 U;  2UX2 A;  1ERG A;  2PJY B;  1G6M A;  1CB9 A;  1IK8 A;  1KS6 A;  1CTX A;  3ERA A;  2ERA A;  2MJ4 A;  2K3G A;  1RGJ A;  1M9Z A;  1CDR A;  2CTX A;  1B41 B;  5IMT D;  1KC4 A;  1ZAD A;  1FSC A;  1L4W A;  1UG4 A;  1KBS A;  4P7U A;  1IDH A;  1HAJ A;  4RUD A;  5DO6 A;  1CRE A;  2CRT A;  4BIK B;  1I02 A;  2H62 C;  2MFA A;  2H64 C;  1IDG A;  1CCQ A;  1KBA A;  1NYS A;  2CDX A;  2H7Z A;  3U74 U;  1CXO A;  1KFH A;  1IQ9 A;  2MJY A;  2I9B E;  1DRS A;  4EY8 B;  1TXA A;  1LXG A;  2N99 A;  2QC1 A;  1XT3 A;  2UWR A;  3KFD I;  1IKC A;  2VLW A;  4BDT B;  1CHV S;  1REW C;  1KL8 A;  1NTX A;  2LCR A;  1FSS B;  3HH7 A;  4IYE A;  4OM5 A;  4FAO E;  1HC9 A;  1CXN A;  1ES7 B;  4KSN A;  1F8U B;  1LSI A;  1ABT A;  1NOR A;  3EVS C;  3U73 U;  1QKD A;  1CVO A;  2MUO A;  2QJ9 C;  1LXH A;  2CCX A;  2MUP A;  1H0J A;  1F94 A;  2L03 A;  1CDT A;  1CDS A;  1BTE A;  3NH7 A;  1LX5 B;  1NYU A;  1COD A;  1HAA A;  1IDI A;  1RL5 A;  1QKE A;  3KFD E;  4QTI U;  2LA1 A;  2GOO C;  6EBX A;  5IMY C;  1NTN A;  2H64 B;  2BHI A;  1S4Y A;  1FF4 A;  2H5F A;  1JE9 A;  3QB4 B;  4DO8 A;  2JQP A;  1TXB A;  2PJY C;  1JGK A;  2HLQ A;  2MHY A;  2J8B A;  2OFS A;  4FAO C;  1LJZ A;  1MAH F;  4LFT A;  2L5S A;  2QJA C;  3BT1 U;  5DZ5 A;  1HOY A;  2BTX A;  1ONJ A;  1MR6 A;  2NBT A;  1KTZ B;  1KXI A;  4OM4 A;  2ABX A;  1FFJ A;  1NXB A;  1KBT A;  1QM7 A;  1FRA A;  3FEV A;  1CDQ A;  1JBD A;  5EBX A;  2FD6 U;  1V6P A;  1YWH A;  2X8B B;  3NDS A;  1COE A;  2H7Z B;  4ZQY A;  2JVE A;  4AEA A;  2MJ0 A;  4XJJ A;  3VTS A;  1BXP A;  4UY2 C;  1IJC A;  1PLO A;  1IDL A;  1FAS A;  2H8U A;  1KU6 B;  1TGX A;  2QJB C;  2HLR A;  1CRF A;  3LAQ U;  1ERA A;  1HC9 B;  1TFS A;  2GOO B;  3EBX A;  2H62 D;  1NEA A;  2CRS A;  1W6B A;  5DU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...