1CRFA

Cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN II
publication title Cardiotoxin II from Taiwan cobra venom, Naja naja atra. Structure in solution and comparison among homologous cardiotoxins.
pubmed rcsb
source organism Naja atra
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1crfA00
1KTZB 1NORA 1KS6A 2JVEA 2H7ZA 3QB4B 1NXBA 1CVOA 4P7UA 4XJJA 1NYUA 3KFDI 1LXGA 1MAHF 4AEAA 2MUPA 3FEVA 2BTXA 2MJ4A 1CODA 3HH7A 1IDLA 4RUDA 2I9BE 2H62D 2QJBC 2BHIA 2QC1A 4FAOE 3U73U 2H5FA 1CDTA 3EBXA 1M9ZA 1I02A 1ABTA 2LCRA 4FAOC 1QKEA 4QTIU 1HC9A 2CCXA 1MR6A 1LSIA 1CREA 2J8BA 3NDSA 1TGXA 4IYEA 2MHYA 1JE9A 2CDXA 2L03A 1CHVS 2H7ZB 1CRFA 3BT2U 2MJYA 1G6MA 1FFJA 2OFSA 3KFDE 1S4YA 1JBDA 1KFHA 3U74U 1HAJA 2PJYC 1ES7B 2H64C 3NH7A 1COEA 1HOYA 2NBTA 1CCQA 2UWRA 5DZ5A 1CDQA 1F94A 2JQPA 1KC4A 1QKDA 4BIKB 1NTXA 1KBAA 2CTXA 1TFSA 2MUOA 1REWC 5DU1A 4ZQYA 1HAAA 1VB0A 2FD6U 5IMTD 2MJ0A 3BT1U 1BXPA 1FSCA 2K3GA 1CDSA 4UY2C 4DO8A 4LFTA 1IDHA 1V6PA 1IDGA 1FRAA 5DO6A 2L5SA 1F8UB 3VTSA 1ONJA 2VLWA 1LX5B 2PJYB 1YWHA 2MFAA 4OM4A 1NYSA 1KXIA 1L4WA 2H64B 1UG4A 1BTEA 2GOOC 1LJZA 1TXBA 2GOOB 1DRSA 1FSSB 1FF4A 2H62C 2QJAC 3EVSC 1PLOA 3LAQU 1W6BA 2ERAA 1CB9A 1XT3A 4BDTB 2X8BB 2LA1A 1RL5A 2H8UA 1CXNA 1KBTA 1CXOA 1B41B 1FASA 2UX2A 6EBXA 1CDRA 1ZADA 1ERGA 2QJ9C 4EY8B 1ERAA 2CRSA 1HC9B 3NEQA 3PLCA 5EBXA 2ABXA 1IQ9A 1KL8A 1RGJA 1CTXA 2HLQA 5IMYC 1KBSA 1QM7A 1IJCA 1JGKA 1H0JA 1IDIA 2HLRA 2N99A 1KU6B 4HQPF 1NTNA 1IK8A 2CRTA 4OM5A 1IKCA 1LXHA 3ERAA 1NEAA 1TXAA
chains in the Genus database with same CATH superfamily
1KTZB 1NORA 1KS6A 2JVEA 2H7ZA 3QB4B 1NXBA 1CVOA 4P7UA 4XJJA 1NYUA 3KFDI 1LXGA 1MAHF 4AEAA 2MUPA 3FEVA 4KSNA 2BTXA 2MJ4A 1CODA 3HH7A 1IDLA 4RUDA 2I9BE 2H62D 2QJBC 2BHIA 2QC1A 4FAOE 3U73U 2H5FA 1CDTA 3EBXA 1M9ZA 1I02A 1ABTA 2LCRA 4FAOC 1QKEA 4QTIU 1HC9A 2CCXA 1MR6A 1LSIA 1CREA 2J8BA 3NDSA 1TGXA 4IYEA 2MHYA 1JE9A 2CDXA 2L03A 1CHVS 2H7ZB 1CRFA 3BT2U 2MJYA 1G6MA 1FFJA 2OFSA 3KFDE 1S4YA 1JBDA 1KFHA 3U74U 1HAJA 2PJYC 1ES7B 2H64C 3NH7A 1COEA 1HOYA 2NBTA 1CCQA 2UWRA 5DZ5A 1CDQA 1F94A 2JQPA 1KC4A 1QKDA 4BIKB 1NTXA 1KBAA 2CTXA 1TFSA 2MUOA 1REWC 5DU1A 4ZQYA 1HAAA 1VB0A 2FD6U 5IMTD 2MJ0A 3BT1U 1BXPA 1FSCA 2K3GA 1CDSA 4UY2C 4DO8A 4LFTA 1IDHA 1V6PA 1IDGA 1FRAA 5DO6A 2L5SA 1F8UB 3VTSA 1ONJA 2VLWA 1LX5B 2PJYB 1YWHA 2MFAA 4OM4A 1NYSA 1KXIA 1L4WA 2H64B 1UG4A 1BTEA 2GOOC 1LJZA 1TXBA 2GOOB 1DRSA 1FSSB 1FF4A 2H62C 2QJAC 3EVSC 1PLOA 3LAQU 1W6BA 2ERAA 1CB9A 1XT3A 4BDTB 2X8BB 2LA1A 1RL5A 2H8UA 1CXNA 1KBTA 1CXOA 1B41B 1FASA 2UX2A 6EBXA 1CDRA 1ZADA 1ERGA 2QJ9C 4EY8B 1ERAA 2CRSA 1HC9B 3NEQA 3PLCA 5EBXA 2ABXA 1IQ9A 1KL8A 1RGJA 1CTXA 2HLQA 5IMYC 1KBSA 1QM7A 1IJCA 1JGKA 1H0JA 1IDIA 2HLRA 2N99A 1KU6B 4HQPF 1NTNA 1IK8A 2CRTA 4OM5A 1IKCA 1LXHA 3ERAA 1NEAA 1TXAA
chains in the Genus database with same CATH topology
1KTZB 1NORA 1KS6A 2JVEA 2H7ZA 3QB4B 1NXBA 1CVOA 4P7UA 4XJJA 1NYUA 3KFDI 1LXGA 1MAHF 4AEAA 2MUPA 3FEVA 4KSNA 2BTXA 2MJ4A 1CODA 3HH7A 1IDLA 4RUDA 2I9BE 2H62D 2QJBC 2BHIA 2QC1A 4FAOE 3U73U 2H5FA 1CDTA 3EBXA 1M9ZA 1I02A 1ABTA 2LCRA 4FAOC 1QKEA 4QTIU 1HC9A 2CCXA 1MR6A 1LSIA 1CREA 2J8BA 3NDSA 1TGXA 4IYEA 2MHYA 1JE9A 2CDXA 2L03A 1CHVS 2H7ZB 1CRFA 3BT2U 2MJYA 1G6MA 1FFJA 2OFSA 3KFDE 1S4YA 1JBDA 1KFHA 3U74U 1HAJA 2PJYC 1ES7B 2H64C 3NH7A 1COEA 1HOYA 2NBTA 1CCQA 2UWRA 5DZ5A 1CDQA 1F94A 2JQPA 1KC4A 1QKDA 4BIKB 1NTXA 1KBAA 2CTXA 1TFSA 2MUOA 1REWC 5DU1A 4ZQYA 1HAAA 1VB0A 2FD6U 5IMTD 2MJ0A 3BT1U 1BXPA 1FSCA 2K3GA 1CDSA 4UY2C 4DO8A 4LFTA 1IDHA 1V6PA 1IDGA 1FRAA 5DO6A 2L5SA 1F8UB 3VTSA 1ONJA 2VLWA 1LX5B 2PJYB 1YWHA 2MFAA 4OM4A 1NYSA 1KXIA 1L4WA 2H64B 1UG4A 1BTEA 2GOOC 1LJZA 1TXBA 2GOOB 1DRSA 1FSSB 1FF4A 2H62C 2QJAC 3EVSC 1PLOA 3LAQU 1W6BA 2ERAA 1CB9A 1XT3A 4BDTB 2X8BB 2LA1A 1RL5A 2H8UA 1CXNA 1KBTA 1CXOA 1B41B 1FASA 2UX2A 6EBXA 1CDRA 1ZADA 1ERGA 2QJ9C 4EY8B 1ERAA 2CRSA 1HC9B 3NEQA 3PLCA 5EBXA 2ABXA 1IQ9A 1KL8A 1RGJA 1CTXA 2HLQA 5IMYC 1KBSA 1QM7A 1IJCA 1JGKA 1H0JA 1IDIA 2HLRA 2N99A 1KU6B 4HQPF 1NTNA 1IK8A 2CRTA 4OM5A 1IKCA 1LXHA 3ERAA 1NEAA 1TXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KTZ B;  1NOR A;  1KS6 A;  2JVE A;  2H7Z A;  3QB4 B;  1NXB A;  1CVO A;  4P7U A;  4XJJ A;  1NYU A;  3KFD I;  1LXG A;  1MAH F;  4AEA A;  2MUP A;  3FEV A;  2BTX A;  2MJ4 A;  1COD A;  3HH7 A;  1IDL A;  4RUD A;  2I9B E;  2H62 D;  2QJB C;  2BHI A;  2QC1 A;  4FAO E;  3U73 U;  2H5F A;  1CDT A;  3EBX A;  1M9Z A;  1I02 A;  1ABT A;  2LCR A;  4FAO C;  1QKE A;  4QTI U;  1HC9 A;  2CCX A;  1MR6 A;  1LSI A;  1CRE A;  2J8B A;  3NDS A;  1TGX A;  4IYE A;  2MHY A;  1JE9 A;  2CDX A;  2L03 A;  1CHV S;  2H7Z B;  1CRF A;  3BT2 U;  2MJY A;  1G6M A;  1FFJ A;  2OFS A;  3KFD E;  1S4Y A;  1JBD A;  1KFH A;  3U74 U;  1HAJ A;  2PJY C;  1ES7 B;  2H64 C;  3NH7 A;  1COE A;  1HOY A;  2NBT A;  1CCQ A;  2UWR A;  5DZ5 A;  1CDQ A;  1F94 A;  2JQP A;  1KC4 A;  1QKD A;  4BIK B;  1NTX A;  1KBA A;  2CTX A;  1TFS A;  2MUO A;  1REW C;  5DU1 A;  4ZQY A;  1HAA A;  1VB0 A;  2FD6 U;  5IMT D;  2MJ0 A;  3BT1 U;  1BXP A;  1FSC A;  2K3G A;  1CDS A;  4UY2 C;  4DO8 A;  4LFT A;  1IDH A;  1V6P A;  1IDG A;  1FRA A;  5DO6 A;  2L5S A;  1F8U B;  3VTS A;  1ONJ A;  2VLW A;  1LX5 B;  2PJY B;  1YWH A;  2MFA A;  4OM4 A;  1NYS A;  1KXI A;  1L4W A;  2H64 B;  1UG4 A;  1BTE A;  2GOO C;  1LJZ A;  1TXB A;  2GOO B;  1DRS A;  1FSS B;  1FF4 A;  2H62 C;  2QJA C;  3EVS C;  1PLO A;  3LAQ U;  1W6B A;  2ERA A;  1CB9 A;  1XT3 A;  4BDT B;  2X8B B;  2LA1 A;  1RL5 A;  2H8U A;  1CXN A;  1KBT A;  1CXO A;  1B41 B;  1FAS A;  2UX2 A;  6EBX A;  1CDR A;  1ZAD A;  1ERG A;  2QJ9 C;  4EY8 B;  1ERA A;  2CRS A;  1HC9 B;  3NEQ A;  3PLC A;  5EBX A;  2ABX A;  1IQ9 A;  1KL8 A;  1RGJ A;  1CTX A;  2HLQ A;  5IMY C;  1KBS A;  1QM7 A;  1IJC A;  1JGK A;  1H0J A;  1IDI A;  2HLR A;  2N99 A;  1KU6 B;  4HQP F;  1NTN A;  1IK8 A;  2CRT A;  4OM5 A;  1IKC A;  1LXH A;  3ERA A;  1NEA A;  1TXA A; 
#chains in the Genus database with same CATH topology
 1KTZ B;  1NOR A;  1KS6 A;  2JVE A;  2H7Z A;  3QB4 B;  1NXB A;  1CVO A;  4P7U A;  4XJJ A;  1NYU A;  3KFD I;  1LXG A;  1MAH F;  4AEA A;  2MUP A;  3FEV A;  4KSN A;  2BTX A;  2MJ4 A;  1COD A;  3HH7 A;  1IDL A;  4RUD A;  2I9B E;  2H62 D;  2QJB C;  2BHI A;  2QC1 A;  4FAO E;  3U73 U;  2H5F A;  1CDT A;  3EBX A;  1M9Z A;  1I02 A;  1ABT A;  2LCR A;  4FAO C;  1QKE A;  4QTI U;  1HC9 A;  2CCX A;  1MR6 A;  1LSI A;  1CRE A;  2J8B A;  3NDS A;  1TGX A;  4IYE A;  2MHY A;  1JE9 A;  2CDX A;  2L03 A;  1CHV S;  2H7Z B;  1CRF A;  3BT2 U;  2MJY A;  1G6M A;  1FFJ A;  2OFS A;  3KFD E;  1S4Y A;  1JBD A;  1KFH A;  3U74 U;  1HAJ A;  2PJY C;  1ES7 B;  2H64 C;  3NH7 A;  1COE A;  1HOY A;  2NBT A;  1CCQ A;  2UWR A;  5DZ5 A;  1CDQ A;  1F94 A;  2JQP A;  1KC4 A;  1QKD A;  4BIK B;  1NTX A;  1KBA A;  2CTX A;  1TFS A;  2MUO A;  1REW C;  5DU1 A;  4ZQY A;  1HAA A;  1VB0 A;  2FD6 U;  5IMT D;  2MJ0 A;  3BT1 U;  1BXP A;  1FSC A;  2K3G A;  1CDS A;  4UY2 C;  4DO8 A;  4LFT A;  1IDH A;  1V6P A;  1IDG A;  1FRA A;  5DO6 A;  2L5S A;  1F8U B;  3VTS A;  1ONJ A;  2VLW A;  1LX5 B;  2PJY B;  1YWH A;  2MFA A;  4OM4 A;  1NYS A;  1KXI A;  1L4W A;  2H64 B;  1UG4 A;  1BTE A;  2GOO C;  1LJZ A;  1TXB A;  2GOO B;  1DRS A;  1FSS B;  1FF4 A;  2H62 C;  2QJA C;  3EVS C;  1PLO A;  3LAQ U;  1W6B A;  2ERA A;  1CB9 A;  1XT3 A;  4BDT B;  2X8B B;  2LA1 A;  1RL5 A;  2H8U A;  1CXN A;  1KBT A;  1CXO A;  1B41 B;  1FAS A;  2UX2 A;  6EBX A;  1CDR A;  1ZAD A;  1ERG A;  2QJ9 C;  4EY8 B;  1ERA A;  2CRS A;  1HC9 B;  3NEQ A;  3PLC A;  5EBX A;  2ABX A;  1IQ9 A;  1KL8 A;  1RGJ A;  1CTX A;  2HLQ A;  5IMY C;  1KBS A;  1QM7 A;  1IJC A;  1JGK A;  1H0J A;  1IDI A;  2HLR A;  2N99 A;  1KU6 B;  4HQP F;  1NTN A;  1IK8 A;  2CRT A;  4OM5 A;  1IKC A;  1LXH A;  3ERA A;  1NEA A;  1TXA A; 
#chains in the Genus database with same CATH homology
 1KTZ B;  1NOR A;  1KS6 A;  2JVE A;  2H7Z A;  3QB4 B;  1NXB A;  1CVO A;  4P7U A;  4XJJ A;  1NYU A;  3KFD I;  1LXG A;  1MAH F;  4AEA A;  2MUP A;  3FEV A;  4KSN A;  2BTX A;  2MJ4 A;  1COD A;  3HH7 A;  1IDL A;  4RUD A;  2I9B E;  2H62 D;  2QJB C;  2BHI A;  2QC1 A;  4FAO E;  3U73 U;  2H5F A;  1CDT A;  3EBX A;  1M9Z A;  1I02 A;  1ABT A;  2LCR A;  4FAO C;  1QKE A;  4QTI U;  1HC9 A;  2CCX A;  1MR6 A;  1LSI A;  1CRE A;  2J8B A;  3NDS A;  1TGX A;  4IYE A;  2MHY A;  1JE9 A;  2CDX A;  2L03 A;  1CHV S;  2H7Z B;  1CRF A;  3BT2 U;  2MJY A;  1G6M A;  1FFJ A;  2OFS A;  3KFD E;  1S4Y A;  1JBD A;  1KFH A;  3U74 U;  1HAJ A;  2PJY C;  1ES7 B;  2H64 C;  3NH7 A;  1COE A;  1HOY A;  2NBT A;  1CCQ A;  2UWR A;  5DZ5 A;  1CDQ A;  1F94 A;  2JQP A;  1KC4 A;  1QKD A;  4BIK B;  1NTX A;  1KBA A;  2CTX A;  1TFS A;  2MUO A;  1REW C;  5DU1 A;  4ZQY A;  1HAA A;  1VB0 A;  2FD6 U;  5IMT D;  2MJ0 A;  3BT1 U;  1BXP A;  1FSC A;  2K3G A;  1CDS A;  4UY2 C;  4DO8 A;  4LFT A;  1IDH A;  1V6P A;  1IDG A;  1FRA A;  5DO6 A;  2L5S A;  1F8U B;  3VTS A;  1ONJ A;  2VLW A;  1LX5 B;  2PJY B;  1YWH A;  2MFA A;  4OM4 A;  1NYS A;  1KXI A;  1L4W A;  2H64 B;  1UG4 A;  1BTE A;  2GOO C;  1LJZ A;  1TXB A;  2GOO B;  1DRS A;  1FSS B;  1FF4 A;  2H62 C;  2QJA C;  3EVS C;  1PLO A;  3LAQ U;  1W6B A;  2ERA A;  1CB9 A;  1XT3 A;  4BDT B;  2X8B B;  2LA1 A;  1RL5 A;  2H8U A;  1CXN A;  1KBT A;  1CXO A;  1B41 B;  1FAS A;  2UX2 A;  6EBX A;  1CDR A;  1ZAD A;  1ERG A;  2QJ9 C;  4EY8 B;  1ERA A;  2CRS A;  1HC9 B;  3NEQ A;  3PLC A;  5EBX A;  2ABX A;  1IQ9 A;  1KL8 A;  1RGJ A;  1CTX A;  2HLQ A;  5IMY C;  1KBS A;  1QM7 A;  1IJC A;  1JGK A;  1H0J A;  1IDI A;  2HLR A;  2N99 A;  1KU6 B;  4HQP F;  1NTN A;  1IK8 A;  2CRT A;  4OM5 A;  1IKC A;  1LXH A;  3ERA A;  1NEA A;  1TXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...