4KSNA

C-terminal domain of sdbc protein from legionella pneumophila.
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
65
structure length
65
Chain Sequence
DTHLADLYLLKYDTGLGVYESFICKYLEDSNDYIASHPQKLSLDEMPRPLESETVSLRQLIVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords SdbC
publication title C-terminal domain of SdbC protein from Legionella pneumophila.
rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 3
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.20 Mainly Beta Ribbon CD59 CD59 4ksnA00
4KSNA
chains in the Genus database with same CATH superfamily
2PJYC 1KS6A 1LX5B 2UWRA 2ABXA 2QJAC 2OFSA 1FRAA 1F8UB 4P7UA 1ES7B 1HOYA 2I9BE 6EBXA 1NTNA 1ZADA 2PJYB 3KFDE 1CCQA 4DO8A 1CODA 2MFAA 3U73U 2LCRA 2H62C 2LA1A 2GOOB 1YWHA 1IDLA 1CXNA 2L5SA 3HH7A 1L4WA 1CVOA 4BDTB 1HC9A 4BIKB 1IKCA 2HLRA 2ERAA 3ERAA 3LAQU 2MHYA 2CRTA 1MR6A 1IJCA 1KBSA 1IQ9A 1CREA 1NEAA 1FF4A 1CXOA 1JE9A 4FAOE 1FASA 1CRFA 1TXAA 2JQPA 2BHIA 1B41B 1QKDA 1NTXA 2MUOA 1XT3A 1LXGA 1KTZB 4UY2C 1CB9A 1IK8A 1H0JA 1CHVS 1ONJA 2H62D 1HC9B 1IDGA 4FAOC 2K3GA 2MJ4A 2CTXA 1KC4A 1TGXA 3KFDI 2H64C 1BXPA 1RL5A 3NEQA 2CRSA 4OM4A 1HAAA 1KFHA 2QJBC 1JBDA 3QB4B 1KU6B 1NYUA 1TFSA 2BTXA 1JGKA 2HLQA 1NXBA 2FD6U 1CDRA 1KBTA 4OM5A 5IMYC 1ABTA 1RGJA 2H8UA 2H5FA 1IDIA 5IMTD 1CTXA 4LFTA 3NDSA 3NH7A 2QJ9C 1DRSA 2UX2A 1ERAA 4RUDA 3BT1U 1CDSA 1KXIA 3PLCA 2QC1A 1IDHA 3BT2U 1UG4A 4XJJA 4HQPF 2VLWA 4KSNA 1FSSB 3U74U 1CDTA 1BTEA 1M9ZA 1F94A 2GOOC 2MJYA 1KL8A 1COEA 2J8BA 1MAHF 1HAJA 1S4YA 1FSCA 1W6BA 2MJ0A 5EBXA 5DU1A 3EVSC 2CCXA 1TXBA 5DZ5A 1PLOA 1LSIA 4IYEA 1G6MA 4ZQYA 1CDQA 5DO6A 2JVEA 1I02A 1LJZA 3EBXA 1QM7A 1QKEA 2H64B 1NYSA 2CDXA 2NBTA 2MUPA 2H7ZA 2X8BB 3FEVA 1ERGA 1V6PA 1KBAA 2H7ZB 1REWC 4QTIU 1VB0A 2L03A 3VTSA 2N99A 1FFJA 1NORA 1LXHA 4EY8B 4AEAA
chains in the Genus database with same CATH topology
2PJYC 1KS6A 1LX5B 2UWRA 2ABXA 2QJAC 2OFSA 1FRAA 1F8UB 4P7UA 1ES7B 1HOYA 2I9BE 6EBXA 1NTNA 1ZADA 2PJYB 3KFDE 1CCQA 4DO8A 1CODA 2MFAA 3U73U 2LCRA 2H62C 2LA1A 2GOOB 1YWHA 1IDLA 1CXNA 2L5SA 3HH7A 1L4WA 1CVOA 4BDTB 1HC9A 4BIKB 1IKCA 2HLRA 2ERAA 3ERAA 3LAQU 2MHYA 2CRTA 1MR6A 1IJCA 1KBSA 1IQ9A 1CREA 1NEAA 1FF4A 1CXOA 1JE9A 4FAOE 1FASA 1CRFA 1TXAA 2JQPA 2BHIA 1B41B 1QKDA 1NTXA 2MUOA 1XT3A 1LXGA 1KTZB 4UY2C 1CB9A 1IK8A 1H0JA 1CHVS 1ONJA 2H62D 1HC9B 1IDGA 4FAOC 2K3GA 2MJ4A 2CTXA 1KC4A 1TGXA 3KFDI 2H64C 1BXPA 1RL5A 3NEQA 2CRSA 4OM4A 1HAAA 1KFHA 2QJBC 1JBDA 3QB4B 1KU6B 1NYUA 1TFSA 2BTXA 1JGKA 2HLQA 1NXBA 2FD6U 1CDRA 1KBTA 4OM5A 5IMYC 1ABTA 1RGJA 2H8UA 2H5FA 1IDIA 5IMTD 1CTXA 4LFTA 3NDSA 3NH7A 2QJ9C 1DRSA 2UX2A 1ERAA 4RUDA 3BT1U 1CDSA 1KXIA 3PLCA 2QC1A 1IDHA 3BT2U 1UG4A 4XJJA 4HQPF 2VLWA 4KSNA 1FSSB 3U74U 1CDTA 1BTEA 1M9ZA 1F94A 2GOOC 2MJYA 1KL8A 1COEA 2J8BA 1MAHF 1HAJA 1S4YA 1FSCA 1W6BA 2MJ0A 5EBXA 5DU1A 3EVSC 2CCXA 1TXBA 5DZ5A 1PLOA 1LSIA 4IYEA 1G6MA 4ZQYA 1CDQA 5DO6A 2JVEA 1I02A 1LJZA 3EBXA 1QM7A 1QKEA 2H64B 1NYSA 2CDXA 2NBTA 2MUPA 2H7ZA 2X8BB 3FEVA 1ERGA 1V6PA 1KBAA 2H7ZB 1REWC 4QTIU 1VB0A 2L03A 3VTSA 2N99A 1FFJA 1NORA 1LXHA 4EY8B 4AEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSN A; 
#chains in the Genus database with same CATH topology
 2PJY C;  1KS6 A;  1LX5 B;  2UWR A;  2ABX A;  2QJA C;  2OFS A;  1FRA A;  1F8U B;  4P7U A;  1ES7 B;  1HOY A;  2I9B E;  6EBX A;  1NTN A;  1ZAD A;  2PJY B;  3KFD E;  1CCQ A;  4DO8 A;  1COD A;  2MFA A;  3U73 U;  2LCR A;  2H62 C;  2LA1 A;  2GOO B;  1YWH A;  1IDL A;  1CXN A;  2L5S A;  3HH7 A;  1L4W A;  1CVO A;  4BDT B;  1HC9 A;  4BIK B;  1IKC A;  2HLR A;  2ERA A;  3ERA A;  3LAQ U;  2MHY A;  2CRT A;  1MR6 A;  1IJC A;  1KBS A;  1IQ9 A;  1CRE A;  1NEA A;  1FF4 A;  1CXO A;  1JE9 A;  4FAO E;  1FAS A;  1CRF A;  1TXA A;  2JQP A;  2BHI A;  1B41 B;  1QKD A;  1NTX A;  2MUO A;  1XT3 A;  1LXG A;  1KTZ B;  4UY2 C;  1CB9 A;  1IK8 A;  1H0J A;  1CHV S;  1ONJ A;  2H62 D;  1HC9 B;  1IDG A;  4FAO C;  2K3G A;  2MJ4 A;  2CTX A;  1KC4 A;  1TGX A;  3KFD I;  2H64 C;  1BXP A;  1RL5 A;  3NEQ A;  2CRS A;  4OM4 A;  1HAA A;  1KFH A;  2QJB C;  1JBD A;  3QB4 B;  1KU6 B;  1NYU A;  1TFS A;  2BTX A;  1JGK A;  2HLQ A;  1NXB A;  2FD6 U;  1CDR A;  1KBT A;  4OM5 A;  5IMY C;  1ABT A;  1RGJ A;  2H8U A;  2H5F A;  1IDI A;  5IMT D;  1CTX A;  4LFT A;  3NDS A;  3NH7 A;  2QJ9 C;  1DRS A;  2UX2 A;  1ERA A;  4RUD A;  3BT1 U;  1CDS A;  1KXI A;  3PLC A;  2QC1 A;  1IDH A;  3BT2 U;  1UG4 A;  4XJJ A;  4HQP F;  2VLW A;  4KSN A;  1FSS B;  3U74 U;  1CDT A;  1BTE A;  1M9Z A;  1F94 A;  2GOO C;  2MJY A;  1KL8 A;  1COE A;  2J8B A;  1MAH F;  1HAJ A;  1S4Y A;  1FSC A;  1W6B A;  2MJ0 A;  5EBX A;  5DU1 A;  3EVS C;  2CCX A;  1TXB A;  5DZ5 A;  1PLO A;  1LSI A;  4IYE A;  1G6M A;  4ZQY A;  1CDQ A;  5DO6 A;  2JVE A;  1I02 A;  1LJZ A;  3EBX A;  1QM7 A;  1QKE A;  2H64 B;  1NYS A;  2CDX A;  2NBT A;  2MUP A;  2H7Z A;  2X8B B;  3FEV A;  1ERG A;  1V6P A;  1KBA A;  2H7Z B;  1REW C;  4QTI U;  1VB0 A;  2L03 A;  3VTS A;  2N99 A;  1FFJ A;  1NOR A;  1LXH A;  4EY8 B;  4AEA A; 
#chains in the Genus database with same CATH homology
 2PJY C;  1KS6 A;  1LX5 B;  2UWR A;  2ABX A;  2QJA C;  2OFS A;  1FRA A;  1F8U B;  4P7U A;  1ES7 B;  1HOY A;  2I9B E;  6EBX A;  1NTN A;  1ZAD A;  2PJY B;  3KFD E;  1CCQ A;  4DO8 A;  1COD A;  2MFA A;  3U73 U;  2LCR A;  2H62 C;  2LA1 A;  2GOO B;  1YWH A;  1IDL A;  1CXN A;  2L5S A;  3HH7 A;  1L4W A;  1CVO A;  4BDT B;  1HC9 A;  4BIK B;  1IKC A;  2HLR A;  2ERA A;  3ERA A;  3LAQ U;  2MHY A;  2CRT A;  1MR6 A;  1IJC A;  1KBS A;  1IQ9 A;  1CRE A;  1NEA A;  1FF4 A;  1CXO A;  1JE9 A;  4FAO E;  1FAS A;  1CRF A;  1TXA A;  2JQP A;  2BHI A;  1B41 B;  1QKD A;  1NTX A;  2MUO A;  1XT3 A;  1LXG A;  1KTZ B;  4UY2 C;  1CB9 A;  1IK8 A;  1H0J A;  1CHV S;  1ONJ A;  2H62 D;  1HC9 B;  1IDG A;  4FAO C;  2K3G A;  2MJ4 A;  2CTX A;  1KC4 A;  1TGX A;  3KFD I;  2H64 C;  1BXP A;  1RL5 A;  3NEQ A;  2CRS A;  4OM4 A;  1HAA A;  1KFH A;  2QJB C;  1JBD A;  3QB4 B;  1KU6 B;  1NYU A;  1TFS A;  2BTX A;  1JGK A;  2HLQ A;  1NXB A;  2FD6 U;  1CDR A;  1KBT A;  4OM5 A;  5IMY C;  1ABT A;  1RGJ A;  2H8U A;  2H5F A;  1IDI A;  5IMT D;  1CTX A;  4LFT A;  3NDS A;  3NH7 A;  2QJ9 C;  1DRS A;  2UX2 A;  1ERA A;  4RUD A;  3BT1 U;  1CDS A;  1KXI A;  3PLC A;  2QC1 A;  1IDH A;  3BT2 U;  1UG4 A;  4XJJ A;  4HQP F;  2VLW A;  4KSN A;  1FSS B;  3U74 U;  1CDT A;  1BTE A;  1M9Z A;  1F94 A;  2GOO C;  2MJY A;  1KL8 A;  1COE A;  2J8B A;  1MAH F;  1HAJ A;  1S4Y A;  1FSC A;  1W6B A;  2MJ0 A;  5EBX A;  5DU1 A;  3EVS C;  2CCX A;  1TXB A;  5DZ5 A;  1PLO A;  1LSI A;  4IYE A;  1G6M A;  4ZQY A;  1CDQ A;  5DO6 A;  2JVE A;  1I02 A;  1LJZ A;  3EBX A;  1QM7 A;  1QKE A;  2H64 B;  1NYS A;  2CDX A;  2NBT A;  2MUP A;  2H7Z A;  2X8B B;  3FEV A;  1ERG A;  1V6P A;  1KBA A;  2H7Z B;  1REW C;  4QTI U;  1VB0 A;  2L03 A;  3VTS A;  2N99 A;  1FFJ A;  1NOR A;  1LXH A;  4EY8 B;  4AEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...