4KSNA

C-terminal domain of sdbc protein from legionella pneumophila.
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
65
structure length
65
Chain Sequence
DTHLADLYLLKYDTGLGVYESFICKYLEDSNDYIASHPQKLSLDEMPRPLESETVSLRQLIVSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title C-terminal domain of SdbC protein from Legionella pneumophila.
rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Structural genomics, unknown function
molecule keywords SdbC
total genus 3
structure length 65
sequence length 65
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.20 Mainly Beta Ribbon CD59 CD59 4ksnA00
4KSNA
chains in the Genus database with same CATH superfamily
4XJJA 4KSNA 1LSIA 2VLWA 1COEA 1HC9A 2BHIA 1IDLA 3KFDI 1CREA 3QB4B 1MAHF 3NDSA 4IYEA 1TXAA 1CXOA 1TFSA 1NTXA 1RL5A 1ERGA 4BDTB 1M9ZA 4BIKB 1LX5B 1KS6A 4OM5A 2MUOA 2QJAC 2MJ4A 3LAQU 3NH7A 2H5FA 2L03A 3BT1U 1BTEA 3U74U 1HC9B 1ABTA 1B41B 1JE9A 2H7ZB 1YWHA 3PLCA 2ERAA 2QJBC 1TXBA 1KL8A 1BXPA 1KU6B 3FEVA 2MJYA 1IJCA 1TGXA 1NXBA 2CRSA 4DO8A 2QJ9C 3EVSC 3NEQA 5IMYC 1IDGA 2MUPA 3VTSA 1CDTA 1CVOA 1UG4A 1L4WA 1I02A 1CODA 2CRTA 1ONJA 2OFSA 2H7ZA 3KFDE 1KXIA 1F8UB 1NTNA 2HLRA 2H62D 2NBTA 5DZ5A 1HAJA 1CDRA 1REWC 2MFAA 4ZQYA 1W6BA 4EY8B 2I9BE 1JGKA 1FRAA 1CCQA 1LJZA 2ABXA 2LCRA 1CXNA 1FASA 2PJYC 2CDXA 2GOOC 2X8BB 1HOYA 2BTXA 1NORA 1KBTA 1KFHA 1F94A 4AEAA 3EBXA 1H0JA 3U73U 1NYUA 1IDIA 5IMTD 2CTXA 2PJYB 1FF4A 1ERAA 3ERAA 1FFJA 2MHYA 4RUDA 1IK8A 5EBXA 1VB0A 2K3GA 3BT2U 2HLQA 3HH7A 2J8BA 1KBSA 2H64B 1FSCA 5DU1A 1PLOA 1KTZB 1V6PA 1JBDA 1CB9A 1DRSA 2H62C 1RGJA 1XT3A 2H64C 4P7UA 1G6MA 4FAOE 2LA1A 1QM7A 2MJ0A 1CRFA 1IDHA 2N99A 4LFTA 1CDSA 1KC4A 1ES7B 2L5SA 2QC1A 1HAAA 6EBXA 4OM4A 1CTXA 2GOOB 4QTIU 2UX2A 1LXHA 1IKCA 1FSSB 1NEAA 2UWRA 2JQPA 1S4YA 1QKEA 5DO6A 4UY2C 1QKDA 2CCXA 4HQPF 1ZADA 4FAOC 1CHVS 1CDQA 2JVEA 2FD6U 2H8UA 1IQ9A 1NYSA 1LXGA 1MR6A 1KBAA
chains in the Genus database with same CATH topology
4XJJA 4KSNA 1LSIA 2VLWA 1COEA 1HC9A 2BHIA 1IDLA 3KFDI 1CREA 3QB4B 1MAHF 3NDSA 4IYEA 1TXAA 1CXOA 1TFSA 1NTXA 1RL5A 1ERGA 4BDTB 1M9ZA 4BIKB 1LX5B 1KS6A 4OM5A 2MUOA 2QJAC 2MJ4A 3LAQU 3NH7A 2H5FA 2L03A 3BT1U 1BTEA 3U74U 1HC9B 1ABTA 1B41B 1JE9A 2H7ZB 1YWHA 3PLCA 2ERAA 2QJBC 1TXBA 1KL8A 1BXPA 1KU6B 3FEVA 2MJYA 1IJCA 1TGXA 1NXBA 2CRSA 4DO8A 2QJ9C 3EVSC 3NEQA 5IMYC 1IDGA 2MUPA 3VTSA 1CDTA 1CVOA 1UG4A 1L4WA 1I02A 1CODA 2CRTA 1ONJA 2OFSA 2H7ZA 3KFDE 1KXIA 1F8UB 1NTNA 2HLRA 2H62D 2NBTA 5DZ5A 1HAJA 1CDRA 1REWC 2MFAA 4ZQYA 1W6BA 4EY8B 2I9BE 1JGKA 1FRAA 1CCQA 1LJZA 2ABXA 2LCRA 1CXNA 1FASA 2PJYC 2CDXA 2GOOC 2X8BB 1HOYA 2BTXA 1NORA 1KBTA 1KFHA 1F94A 4AEAA 3EBXA 1H0JA 3U73U 1NYUA 1IDIA 5IMTD 2CTXA 2PJYB 1FF4A 1ERAA 3ERAA 1FFJA 2MHYA 4RUDA 1IK8A 5EBXA 1VB0A 2K3GA 3BT2U 2HLQA 3HH7A 2J8BA 1KBSA 2H64B 1FSCA 5DU1A 1PLOA 1KTZB 1V6PA 1JBDA 1CB9A 1DRSA 2H62C 1RGJA 1XT3A 2H64C 4P7UA 1G6MA 4FAOE 2LA1A 1QM7A 2MJ0A 1CRFA 1IDHA 2N99A 4LFTA 1CDSA 1KC4A 1ES7B 2L5SA 2QC1A 1HAAA 6EBXA 4OM4A 1CTXA 2GOOB 4QTIU 2UX2A 1LXHA 1IKCA 1FSSB 1NEAA 2UWRA 2JQPA 1S4YA 1QKEA 5DO6A 4UY2C 1QKDA 2CCXA 4HQPF 1ZADA 4FAOC 1CHVS 1CDQA 2JVEA 2FD6U 2H8UA 1IQ9A 1NYSA 1LXGA 1MR6A 1KBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KSN A; 
#chains in the Genus database with same CATH topology
 4XJJ A;  4KSN A;  1LSI A;  2VLW A;  1COE A;  1HC9 A;  2BHI A;  1IDL A;  3KFD I;  1CRE A;  3QB4 B;  1MAH F;  3NDS A;  4IYE A;  1TXA A;  1CXO A;  1TFS A;  1NTX A;  1RL5 A;  1ERG A;  4BDT B;  1M9Z A;  4BIK B;  1LX5 B;  1KS6 A;  4OM5 A;  2MUO A;  2QJA C;  2MJ4 A;  3LAQ U;  3NH7 A;  2H5F A;  2L03 A;  3BT1 U;  1BTE A;  3U74 U;  1HC9 B;  1ABT A;  1B41 B;  1JE9 A;  2H7Z B;  1YWH A;  3PLC A;  2ERA A;  2QJB C;  1TXB A;  1KL8 A;  1BXP A;  1KU6 B;  3FEV A;  2MJY A;  1IJC A;  1TGX A;  1NXB A;  2CRS A;  4DO8 A;  2QJ9 C;  3EVS C;  3NEQ A;  5IMY C;  1IDG A;  2MUP A;  3VTS A;  1CDT A;  1CVO A;  1UG4 A;  1L4W A;  1I02 A;  1COD A;  2CRT A;  1ONJ A;  2OFS A;  2H7Z A;  3KFD E;  1KXI A;  1F8U B;  1NTN A;  2HLR A;  2H62 D;  2NBT A;  5DZ5 A;  1HAJ A;  1CDR A;  1REW C;  2MFA A;  4ZQY A;  1W6B A;  4EY8 B;  2I9B E;  1JGK A;  1FRA A;  1CCQ A;  1LJZ A;  2ABX A;  2LCR A;  1CXN A;  1FAS A;  2PJY C;  2CDX A;  2GOO C;  2X8B B;  1HOY A;  2BTX A;  1NOR A;  1KBT A;  1KFH A;  1F94 A;  4AEA A;  3EBX A;  1H0J A;  3U73 U;  1NYU A;  1IDI A;  5IMT D;  2CTX A;  2PJY B;  1FF4 A;  1ERA A;  3ERA A;  1FFJ A;  2MHY A;  4RUD A;  1IK8 A;  5EBX A;  1VB0 A;  2K3G A;  3BT2 U;  2HLQ A;  3HH7 A;  2J8B A;  1KBS A;  2H64 B;  1FSC A;  5DU1 A;  1PLO A;  1KTZ B;  1V6P A;  1JBD A;  1CB9 A;  1DRS A;  2H62 C;  1RGJ A;  1XT3 A;  2H64 C;  4P7U A;  1G6M A;  4FAO E;  2LA1 A;  1QM7 A;  2MJ0 A;  1CRF A;  1IDH A;  2N99 A;  4LFT A;  1CDS A;  1KC4 A;  1ES7 B;  2L5S A;  2QC1 A;  1HAA A;  6EBX A;  4OM4 A;  1CTX A;  2GOO B;  4QTI U;  2UX2 A;  1LXH A;  1IKC A;  1FSS B;  1NEA A;  2UWR A;  2JQP A;  1S4Y A;  1QKE A;  5DO6 A;  4UY2 C;  1QKD A;  2CCX A;  4HQP F;  1ZAD A;  4FAO C;  1CHV S;  1CDQ A;  2JVE A;  2FD6 U;  2H8U A;  1IQ9 A;  1NYS A;  1LXG A;  1MR6 A;  1KBA A; 
#chains in the Genus database with same CATH homology
 4XJJ A;  4KSN A;  1LSI A;  2VLW A;  1COE A;  1HC9 A;  2BHI A;  1IDL A;  3KFD I;  1CRE A;  3QB4 B;  1MAH F;  3NDS A;  4IYE A;  1TXA A;  1CXO A;  1TFS A;  1NTX A;  1RL5 A;  1ERG A;  4BDT B;  1M9Z A;  4BIK B;  1LX5 B;  1KS6 A;  4OM5 A;  2MUO A;  2QJA C;  2MJ4 A;  3LAQ U;  3NH7 A;  2H5F A;  2L03 A;  3BT1 U;  1BTE A;  3U74 U;  1HC9 B;  1ABT A;  1B41 B;  1JE9 A;  2H7Z B;  1YWH A;  3PLC A;  2ERA A;  2QJB C;  1TXB A;  1KL8 A;  1BXP A;  1KU6 B;  3FEV A;  2MJY A;  1IJC A;  1TGX A;  1NXB A;  2CRS A;  4DO8 A;  2QJ9 C;  3EVS C;  3NEQ A;  5IMY C;  1IDG A;  2MUP A;  3VTS A;  1CDT A;  1CVO A;  1UG4 A;  1L4W A;  1I02 A;  1COD A;  2CRT A;  1ONJ A;  2OFS A;  2H7Z A;  3KFD E;  1KXI A;  1F8U B;  1NTN A;  2HLR A;  2H62 D;  2NBT A;  5DZ5 A;  1HAJ A;  1CDR A;  1REW C;  2MFA A;  4ZQY A;  1W6B A;  4EY8 B;  2I9B E;  1JGK A;  1FRA A;  1CCQ A;  1LJZ A;  2ABX A;  2LCR A;  1CXN A;  1FAS A;  2PJY C;  2CDX A;  2GOO C;  2X8B B;  1HOY A;  2BTX A;  1NOR A;  1KBT A;  1KFH A;  1F94 A;  4AEA A;  3EBX A;  1H0J A;  3U73 U;  1NYU A;  1IDI A;  5IMT D;  2CTX A;  2PJY B;  1FF4 A;  1ERA A;  3ERA A;  1FFJ A;  2MHY A;  4RUD A;  1IK8 A;  5EBX A;  1VB0 A;  2K3G A;  3BT2 U;  2HLQ A;  3HH7 A;  2J8B A;  1KBS A;  2H64 B;  1FSC A;  5DU1 A;  1PLO A;  1KTZ B;  1V6P A;  1JBD A;  1CB9 A;  1DRS A;  2H62 C;  1RGJ A;  1XT3 A;  2H64 C;  4P7U A;  1G6M A;  4FAO E;  2LA1 A;  1QM7 A;  2MJ0 A;  1CRF A;  1IDH A;  2N99 A;  4LFT A;  1CDS A;  1KC4 A;  1ES7 B;  2L5S A;  2QC1 A;  1HAA A;  6EBX A;  4OM4 A;  1CTX A;  2GOO B;  4QTI U;  2UX2 A;  1LXH A;  1IKC A;  1FSS B;  1NEA A;  2UWR A;  2JQP A;  1S4Y A;  1QKE A;  5DO6 A;  4UY2 C;  1QKD A;  2CCX A;  4HQP F;  1ZAD A;  4FAO C;  1CHV S;  1CDQ A;  2JVE A;  2FD6 U;  2H8U A;  1IQ9 A;  1NYS A;  1LXG A;  1MR6 A;  1KBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...