1CXOA

Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organization suggests the existence of a possible phospholipid binding site.
pubmed doi rcsb
source organism Naja nigricollis
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN GAMMA
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cxoA00
1IDIA 1I02A 2HLRA 2MJ4A 2MHYA 2UX2A 2X8BB 1TXBA 2H7ZB 1COEA 1ONJA 3BT1U 1BXPA 1LX5B 1CVOA 1CXOA 1FRAA 1HC9B 1QKDA 1NYSA 3LAQU 2L5SA 1HAJA 1CODA 2CDXA 1FSCA 3PLCA 4EY8B 5EBXA 3VTSA 2ABXA 2LCRA 4DO8A 1KFHA 4HQPF 1TXAA 4QTIU 1IJCA 1CRFA 1CREA 1IDGA 2MFAA 3NH7A 3U73U 2PJYC 3KFDE 2CRTA 5DU1A 1IK8A 2FD6U 2NBTA 1RGJA 1ERAA 2QC1A 1ES7B 1KS6A 1LSIA 2MUOA 1TGXA 1H0JA 1CDRA 2UWRA 2H62D 3HH7A 1FASA 1PLOA 2MJYA 1CDQA 1REWC 5DZ5A 2CRSA 2JQPA 1RL5A 4AEAA 2GOOB 2CCXA 1BTEA 2OFSA 4UY2C 1NXBA 4XJJA 2H8UA 4BDTB 4IYEA 2MUPA 4RUDA 1S4YA 1IKCA 2QJ9C 2PJYB 2H64C 1NTXA 1LXGA 1CHVS 1CCQA 1G6MA 1QM7A 2H7ZA 1ZADA 1IQ9A 1CB9A 2J8BA 1YWHA 1JBDA 1HC9A 1KXIA 3EBXA 1KL8A 2ERAA 2CTXA 3NDSA 1ERGA 1IDLA 1CDSA 4OM5A 1HOYA 4ZQYA 5IMYC 2N99A 1KTZB 2VLWA 2GOOC 1TFSA 1W6BA 4FAOE 1KBAA 1KU6B 1MAHF 1MR6A 1FSSB 2I9BE 3ERAA 1B41B 1NYUA 1UG4A 2LA1A 4FAOC 2BTXA 3EVSC 1XT3A 1CDTA 1KBTA 1NEAA 1JGKA 3KFDI 1FF4A 2QJBC 4LFTA 1NTNA 2QJAC 3U74U 1KC4A 1ABTA 2MJ0A 2JVEA 1HAAA 3BT2U 4BIKB 1NORA 1LJZA 3NEQA 1F8UB 1DRSA 1L4WA 5IMTD 2L03A 3FEVA 3QB4B 1F94A 2BHIA 1QKEA 1CTXA 1M9ZA 1CXNA 6EBXA 1FFJA 2H5FA 4OM4A 1IDHA 1LXHA 1V6PA 5DO6A 4P7UA 2K3GA 2H64B 1JE9A 2H62C 2HLQA 1KBSA 1VB0A
chains in the Genus database with same CATH superfamily
1IDIA 1I02A 2HLRA 2MJ4A 2MHYA 2UX2A 2X8BB 1TXBA 2H7ZB 1COEA 1ONJA 3BT1U 1BXPA 1LX5B 1CVOA 1CXOA 1FRAA 1HC9B 1QKDA 1NYSA 3LAQU 2L5SA 1HAJA 1CODA 2CDXA 1FSCA 3PLCA 4EY8B 5EBXA 3VTSA 2ABXA 2LCRA 4DO8A 1KFHA 4HQPF 1TXAA 4QTIU 1IJCA 1CRFA 1CREA 1IDGA 2MFAA 3NH7A 3U73U 2PJYC 3KFDE 2CRTA 5DU1A 1IK8A 2FD6U 2NBTA 1RGJA 1ERAA 2QC1A 1ES7B 1KS6A 1LSIA 2MUOA 1TGXA 1H0JA 1CDRA 2UWRA 2H62D 3HH7A 1FASA 1PLOA 2MJYA 1CDQA 1REWC 5DZ5A 2CRSA 2JQPA 1RL5A 4AEAA 2GOOB 2CCXA 1BTEA 2OFSA 4UY2C 1NXBA 4XJJA 2H8UA 4BDTB 4IYEA 2MUPA 4RUDA 1S4YA 1IKCA 2QJ9C 2PJYB 2H64C 1NTXA 1LXGA 1CHVS 1CCQA 1G6MA 1QM7A 2H7ZA 1ZADA 1IQ9A 1CB9A 2J8BA 1YWHA 1JBDA 1HC9A 1KXIA 3EBXA 1KL8A 2ERAA 2CTXA 3NDSA 1ERGA 1IDLA 1CDSA 4OM5A 1HOYA 4ZQYA 5IMYC 2N99A 1KTZB 2VLWA 2GOOC 1TFSA 1W6BA 4FAOE 1KBAA 1KU6B 1MAHF 1MR6A 1FSSB 4KSNA 2I9BE 3ERAA 1B41B 1NYUA 1UG4A 2LA1A 4FAOC 2BTXA 3EVSC 1XT3A 1CDTA 1KBTA 1NEAA 1JGKA 3KFDI 1FF4A 2QJBC 4LFTA 1NTNA 2QJAC 3U74U 1KC4A 1ABTA 2MJ0A 2JVEA 1HAAA 3BT2U 4BIKB 1NORA 1LJZA 3NEQA 1F8UB 1DRSA 1L4WA 5IMTD 2L03A 3FEVA 3QB4B 1F94A 2BHIA 1QKEA 1CTXA 1M9ZA 1CXNA 6EBXA 1FFJA 2H5FA 4OM4A 1IDHA 1LXHA 1V6PA 5DO6A 4P7UA 2K3GA 2H64B 1JE9A 2H62C 2HLQA 1KBSA 1VB0A
chains in the Genus database with same CATH topology
1IDIA 1I02A 2HLRA 2MJ4A 2MHYA 2UX2A 2X8BB 1TXBA 2H7ZB 1COEA 1ONJA 3BT1U 1BXPA 1LX5B 1CVOA 1CXOA 1FRAA 1HC9B 1QKDA 1NYSA 3LAQU 2L5SA 1HAJA 1CODA 2CDXA 1FSCA 3PLCA 4EY8B 5EBXA 3VTSA 2ABXA 2LCRA 4DO8A 1KFHA 4HQPF 1TXAA 4QTIU 1IJCA 1CRFA 1CREA 1IDGA 2MFAA 3NH7A 3U73U 2PJYC 3KFDE 2CRTA 5DU1A 1IK8A 2FD6U 2NBTA 1RGJA 1ERAA 2QC1A 1ES7B 1KS6A 1LSIA 2MUOA 1TGXA 1H0JA 1CDRA 2UWRA 2H62D 3HH7A 1FASA 1PLOA 2MJYA 1CDQA 1REWC 5DZ5A 2CRSA 2JQPA 1RL5A 4AEAA 2GOOB 2CCXA 1BTEA 2OFSA 4UY2C 1NXBA 4XJJA 2H8UA 4BDTB 4IYEA 2MUPA 4RUDA 1S4YA 1IKCA 2QJ9C 2PJYB 2H64C 1NTXA 1LXGA 1CHVS 1CCQA 1G6MA 1QM7A 2H7ZA 1ZADA 1IQ9A 1CB9A 2J8BA 1YWHA 1JBDA 1HC9A 1KXIA 3EBXA 1KL8A 2ERAA 2CTXA 3NDSA 1ERGA 1IDLA 1CDSA 4OM5A 1HOYA 4ZQYA 5IMYC 2N99A 1KTZB 2VLWA 2GOOC 1TFSA 1W6BA 4FAOE 1KBAA 1KU6B 1MAHF 1MR6A 1FSSB 4KSNA 2I9BE 3ERAA 1B41B 1NYUA 1UG4A 2LA1A 4FAOC 2BTXA 3EVSC 1XT3A 1CDTA 1KBTA 1NEAA 1JGKA 3KFDI 1FF4A 2QJBC 4LFTA 1NTNA 2QJAC 3U74U 1KC4A 1ABTA 2MJ0A 2JVEA 1HAAA 3BT2U 4BIKB 1NORA 1LJZA 3NEQA 1F8UB 1DRSA 1L4WA 5IMTD 2L03A 3FEVA 3QB4B 1F94A 2BHIA 1QKEA 1CTXA 1M9ZA 1CXNA 6EBXA 1FFJA 2H5FA 4OM4A 1IDHA 1LXHA 1V6PA 5DO6A 4P7UA 2K3GA 2H64B 1JE9A 2H62C 2HLQA 1KBSA 1VB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDI A;  1I02 A;  2HLR A;  2MJ4 A;  2MHY A;  2UX2 A;  2X8B B;  1TXB A;  2H7Z B;  1COE A;  1ONJ A;  3BT1 U;  1BXP A;  1LX5 B;  1CVO A;  1CXO A;  1FRA A;  1HC9 B;  1QKD A;  1NYS A;  3LAQ U;  2L5S A;  1HAJ A;  1COD A;  2CDX A;  1FSC A;  3PLC A;  4EY8 B;  5EBX A;  3VTS A;  2ABX A;  2LCR A;  4DO8 A;  1KFH A;  4HQP F;  1TXA A;  4QTI U;  1IJC A;  1CRF A;  1CRE A;  1IDG A;  2MFA A;  3NH7 A;  3U73 U;  2PJY C;  3KFD E;  2CRT A;  5DU1 A;  1IK8 A;  2FD6 U;  2NBT A;  1RGJ A;  1ERA A;  2QC1 A;  1ES7 B;  1KS6 A;  1LSI A;  2MUO A;  1TGX A;  1H0J A;  1CDR A;  2UWR A;  2H62 D;  3HH7 A;  1FAS A;  1PLO A;  2MJY A;  1CDQ A;  1REW C;  5DZ5 A;  2CRS A;  2JQP A;  1RL5 A;  4AEA A;  2GOO B;  2CCX A;  1BTE A;  2OFS A;  4UY2 C;  1NXB A;  4XJJ A;  2H8U A;  4BDT B;  4IYE A;  2MUP A;  4RUD A;  1S4Y A;  1IKC A;  2QJ9 C;  2PJY B;  2H64 C;  1NTX A;  1LXG A;  1CHV S;  1CCQ A;  1G6M A;  1QM7 A;  2H7Z A;  1ZAD A;  1IQ9 A;  1CB9 A;  2J8B A;  1YWH A;  1JBD A;  1HC9 A;  1KXI A;  3EBX A;  1KL8 A;  2ERA A;  2CTX A;  3NDS A;  1ERG A;  1IDL A;  1CDS A;  4OM5 A;  1HOY A;  4ZQY A;  5IMY C;  2N99 A;  1KTZ B;  2VLW A;  2GOO C;  1TFS A;  1W6B A;  4FAO E;  1KBA A;  1KU6 B;  1MAH F;  1MR6 A;  1FSS B;  2I9B E;  3ERA A;  1B41 B;  1NYU A;  1UG4 A;  2LA1 A;  4FAO C;  2BTX A;  3EVS C;  1XT3 A;  1CDT A;  1KBT A;  1NEA A;  1JGK A;  3KFD I;  1FF4 A;  2QJB C;  4LFT A;  1NTN A;  2QJA C;  3U74 U;  1KC4 A;  1ABT A;  2MJ0 A;  2JVE A;  1HAA A;  3BT2 U;  4BIK B;  1NOR A;  1LJZ A;  3NEQ A;  1F8U B;  1DRS A;  1L4W A;  5IMT D;  2L03 A;  3FEV A;  3QB4 B;  1F94 A;  2BHI A;  1QKE A;  1CTX A;  1M9Z A;  1CXN A;  6EBX A;  1FFJ A;  2H5F A;  4OM4 A;  1IDH A;  1LXH A;  1V6P A;  5DO6 A;  4P7U A;  2K3G A;  2H64 B;  1JE9 A;  2H62 C;  2HLQ A;  1KBS A;  1VB0 A; 
#chains in the Genus database with same CATH topology
 1IDI A;  1I02 A;  2HLR A;  2MJ4 A;  2MHY A;  2UX2 A;  2X8B B;  1TXB A;  2H7Z B;  1COE A;  1ONJ A;  3BT1 U;  1BXP A;  1LX5 B;  1CVO A;  1CXO A;  1FRA A;  1HC9 B;  1QKD A;  1NYS A;  3LAQ U;  2L5S A;  1HAJ A;  1COD A;  2CDX A;  1FSC A;  3PLC A;  4EY8 B;  5EBX A;  3VTS A;  2ABX A;  2LCR A;  4DO8 A;  1KFH A;  4HQP F;  1TXA A;  4QTI U;  1IJC A;  1CRF A;  1CRE A;  1IDG A;  2MFA A;  3NH7 A;  3U73 U;  2PJY C;  3KFD E;  2CRT A;  5DU1 A;  1IK8 A;  2FD6 U;  2NBT A;  1RGJ A;  1ERA A;  2QC1 A;  1ES7 B;  1KS6 A;  1LSI A;  2MUO A;  1TGX A;  1H0J A;  1CDR A;  2UWR A;  2H62 D;  3HH7 A;  1FAS A;  1PLO A;  2MJY A;  1CDQ A;  1REW C;  5DZ5 A;  2CRS A;  2JQP A;  1RL5 A;  4AEA A;  2GOO B;  2CCX A;  1BTE A;  2OFS A;  4UY2 C;  1NXB A;  4XJJ A;  2H8U A;  4BDT B;  4IYE A;  2MUP A;  4RUD A;  1S4Y A;  1IKC A;  2QJ9 C;  2PJY B;  2H64 C;  1NTX A;  1LXG A;  1CHV S;  1CCQ A;  1G6M A;  1QM7 A;  2H7Z A;  1ZAD A;  1IQ9 A;  1CB9 A;  2J8B A;  1YWH A;  1JBD A;  1HC9 A;  1KXI A;  3EBX A;  1KL8 A;  2ERA A;  2CTX A;  3NDS A;  1ERG A;  1IDL A;  1CDS A;  4OM5 A;  1HOY A;  4ZQY A;  5IMY C;  2N99 A;  1KTZ B;  2VLW A;  2GOO C;  1TFS A;  1W6B A;  4FAO E;  1KBA A;  1KU6 B;  1MAH F;  1MR6 A;  1FSS B;  4KSN A;  2I9B E;  3ERA A;  1B41 B;  1NYU A;  1UG4 A;  2LA1 A;  4FAO C;  2BTX A;  3EVS C;  1XT3 A;  1CDT A;  1KBT A;  1NEA A;  1JGK A;  3KFD I;  1FF4 A;  2QJB C;  4LFT A;  1NTN A;  2QJA C;  3U74 U;  1KC4 A;  1ABT A;  2MJ0 A;  2JVE A;  1HAA A;  3BT2 U;  4BIK B;  1NOR A;  1LJZ A;  3NEQ A;  1F8U B;  1DRS A;  1L4W A;  5IMT D;  2L03 A;  3FEV A;  3QB4 B;  1F94 A;  2BHI A;  1QKE A;  1CTX A;  1M9Z A;  1CXN A;  6EBX A;  1FFJ A;  2H5F A;  4OM4 A;  1IDH A;  1LXH A;  1V6P A;  5DO6 A;  4P7U A;  2K3G A;  2H64 B;  1JE9 A;  2H62 C;  2HLQ A;  1KBS A;  1VB0 A; 
#chains in the Genus database with same CATH homology
 1IDI A;  1I02 A;  2HLR A;  2MJ4 A;  2MHY A;  2UX2 A;  2X8B B;  1TXB A;  2H7Z B;  1COE A;  1ONJ A;  3BT1 U;  1BXP A;  1LX5 B;  1CVO A;  1CXO A;  1FRA A;  1HC9 B;  1QKD A;  1NYS A;  3LAQ U;  2L5S A;  1HAJ A;  1COD A;  2CDX A;  1FSC A;  3PLC A;  4EY8 B;  5EBX A;  3VTS A;  2ABX A;  2LCR A;  4DO8 A;  1KFH A;  4HQP F;  1TXA A;  4QTI U;  1IJC A;  1CRF A;  1CRE A;  1IDG A;  2MFA A;  3NH7 A;  3U73 U;  2PJY C;  3KFD E;  2CRT A;  5DU1 A;  1IK8 A;  2FD6 U;  2NBT A;  1RGJ A;  1ERA A;  2QC1 A;  1ES7 B;  1KS6 A;  1LSI A;  2MUO A;  1TGX A;  1H0J A;  1CDR A;  2UWR A;  2H62 D;  3HH7 A;  1FAS A;  1PLO A;  2MJY A;  1CDQ A;  1REW C;  5DZ5 A;  2CRS A;  2JQP A;  1RL5 A;  4AEA A;  2GOO B;  2CCX A;  1BTE A;  2OFS A;  4UY2 C;  1NXB A;  4XJJ A;  2H8U A;  4BDT B;  4IYE A;  2MUP A;  4RUD A;  1S4Y A;  1IKC A;  2QJ9 C;  2PJY B;  2H64 C;  1NTX A;  1LXG A;  1CHV S;  1CCQ A;  1G6M A;  1QM7 A;  2H7Z A;  1ZAD A;  1IQ9 A;  1CB9 A;  2J8B A;  1YWH A;  1JBD A;  1HC9 A;  1KXI A;  3EBX A;  1KL8 A;  2ERA A;  2CTX A;  3NDS A;  1ERG A;  1IDL A;  1CDS A;  4OM5 A;  1HOY A;  4ZQY A;  5IMY C;  2N99 A;  1KTZ B;  2VLW A;  2GOO C;  1TFS A;  1W6B A;  4FAO E;  1KBA A;  1KU6 B;  1MAH F;  1MR6 A;  1FSS B;  4KSN A;  2I9B E;  3ERA A;  1B41 B;  1NYU A;  1UG4 A;  2LA1 A;  4FAO C;  2BTX A;  3EVS C;  1XT3 A;  1CDT A;  1KBT A;  1NEA A;  1JGK A;  3KFD I;  1FF4 A;  2QJB C;  4LFT A;  1NTN A;  2QJA C;  3U74 U;  1KC4 A;  1ABT A;  2MJ0 A;  2JVE A;  1HAA A;  3BT2 U;  4BIK B;  1NOR A;  1LJZ A;  3NEQ A;  1F8U B;  1DRS A;  1L4W A;  5IMT D;  2L03 A;  3FEV A;  3QB4 B;  1F94 A;  2BHI A;  1QKE A;  1CTX A;  1M9Z A;  1CXN A;  6EBX A;  1FFJ A;  2H5F A;  4OM4 A;  1IDH A;  1LXH A;  1V6P A;  5DO6 A;  4P7U A;  2K3G A;  2H64 B;  1JE9 A;  2H62 C;  2HLQ A;  1KBS A;  1VB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...