1CXOA

Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organisation suggests the existence of a possible phospholipid binding site
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
LKCNQLIPPFWKTCPKGKNLCYKMTMRAAPMVPVKRGCIDVCPKSSLLIKYMCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytotoxin
molecule keywords CARDIOTOXIN GAMMA
publication title Refined three-dimensional solution structure of a snake cardiotoxin: analysis of the side-chain organization suggests the existence of a possible phospholipid binding site.
pubmed doi rcsb
source organism Naja nigricollis
total genus 9
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1cxoA00
1NTXA 3EBXA 1RGJA 1KBSA 4DO8A 1IQ9A 3U73U 1IDIA 3VTSA 2H7ZB 1JGKA 1ES7B 5DO6A 1BTEA 1HOYA 1QKEA 5DZ5A 1IDLA 1L4WA 2MJYA 2BHIA 1KBAA 2QJ9C 1NXBA 2I9BE 2GOOB 1IK8A 5IMYC 1V6PA 1CHVS 2MJ0A 3LAQU 1RL5A 4P7UA 1KFHA 4AEAA 2UWRA 2MUPA 3NDSA 3PLCA 1KL8A 1NYSA 1QM7A 1TXBA 1MAHF 1CTXA 1CXNA 1G6MA 2CRSA 3ERAA 1DRSA 2NBTA 1ONJA 1LX5B 1LSIA 4BIKB 1BXPA 1NYUA 4OM4A 2QC1A 1REWC 2FD6U 1CB9A 2CCXA 2CRTA 2PJYC 1IDGA 2LCRA 1FSCA 1I02A 1JBDA 1UG4A 1KC4A 2H64C 1JE9A 2K3GA 1ERAA 1H0JA 1F94A 1NEAA 1S4YA 1XT3A 1FFJA 3KFDE 2JVEA 3KFDI 2QJBC 2H5FA 1HAJA 1NTNA 2J8BA 1HAAA 2H8UA 3BT1U 2BTXA 2HLQA 1FF4A 4OM5A 1VB0A 2UX2A 1IDHA 2MFAA 6EBXA 1CODA 1NORA 1TFSA 1W6BA 1ERGA 5DU1A 1TXAA 4IYEA 1B41B 1KS6A 4FAOC 1CRFA 1CXOA 1CCQA 1F8UB 2H62C 1KXIA 2MUOA 1IJCA 4EY8B 2HLRA 2PJYB 5IMTD 1KTZB 2L5SA 4XJJA 2H64B 3QB4B 2CTXA 3EVSC 1CVOA 1FASA 2ABXA 1CREA 2LA1A 2N99A 4QTIU 1M9ZA 1IKCA 4RUDA 3U74U 1TGXA 5EBXA 3HH7A 1HC9A 1FRAA 2MHYA 1KU6B 2GOOC 2H62D 2H7ZA 2QJAC 3NH7A 1CDQA 1QKDA 3BT2U 4HQPF 2X8BB 1ZADA 1ABTA 4LFTA 2VLWA 2MJ4A 4FAOE 1KBTA 1PLOA 2CDXA 2ERAA 2OFSA 1LXGA 1COEA 2JQPA 4BDTB 4UY2C 1CDRA 1CDTA 1FSSB 1LJZA 2L03A 3NEQA 4ZQYA 1LXHA 3FEVA 1MR6A 1YWHA 1CDSA 1HC9B
chains in the Genus database with same CATH superfamily
1NTXA 3EBXA 1RGJA 1KBSA 4DO8A 1IQ9A 3U73U 1IDIA 3VTSA 2H7ZB 1JGKA 1ES7B 5DO6A 1BTEA 1HOYA 1QKEA 5DZ5A 1IDLA 1L4WA 2MJYA 2BHIA 1KBAA 2QJ9C 4KSNA 1NXBA 2I9BE 2GOOB 1IK8A 5IMYC 1V6PA 1CHVS 2MJ0A 3LAQU 1RL5A 4P7UA 1KFHA 4AEAA 2UWRA 2MUPA 3NDSA 3PLCA 1KL8A 1NYSA 1QM7A 1TXBA 1MAHF 1CTXA 1CXNA 1G6MA 2CRSA 3ERAA 1DRSA 2NBTA 1ONJA 1LX5B 1LSIA 4BIKB 1BXPA 1NYUA 4OM4A 2QC1A 1REWC 2FD6U 1CB9A 2CCXA 2CRTA 2PJYC 1IDGA 2LCRA 1FSCA 1I02A 1JBDA 1UG4A 1KC4A 2H64C 1JE9A 2K3GA 1ERAA 1H0JA 1F94A 1NEAA 1S4YA 1XT3A 1FFJA 3KFDE 2JVEA 3KFDI 2QJBC 2H5FA 1HAJA 1NTNA 2J8BA 1HAAA 2H8UA 3BT1U 2BTXA 2HLQA 1FF4A 4OM5A 1VB0A 2UX2A 1IDHA 2MFAA 6EBXA 1CODA 1NORA 1TFSA 1W6BA 1ERGA 5DU1A 1TXAA 4IYEA 1B41B 1KS6A 4FAOC 1CRFA 1CXOA 1CCQA 1F8UB 2H62C 1KXIA 2MUOA 1IJCA 4EY8B 2HLRA 2PJYB 5IMTD 1KTZB 2L5SA 4XJJA 2H64B 3QB4B 2CTXA 3EVSC 1CVOA 1FASA 2ABXA 1CREA 2LA1A 2N99A 4QTIU 1M9ZA 1IKCA 4RUDA 3U74U 1TGXA 5EBXA 3HH7A 1HC9A 1FRAA 2MHYA 1KU6B 2GOOC 2H62D 2H7ZA 2QJAC 3NH7A 1CDQA 1QKDA 3BT2U 4HQPF 2X8BB 1ZADA 1ABTA 4LFTA 2VLWA 2MJ4A 4FAOE 1KBTA 1PLOA 2CDXA 2ERAA 2OFSA 1LXGA 1COEA 2JQPA 4BDTB 4UY2C 1CDRA 1CDTA 1FSSB 1LJZA 2L03A 3NEQA 4ZQYA 1LXHA 3FEVA 1MR6A 1YWHA 1CDSA 1HC9B
chains in the Genus database with same CATH topology
1NTXA 3EBXA 1RGJA 1KBSA 4DO8A 1IQ9A 3U73U 1IDIA 3VTSA 2H7ZB 1JGKA 1ES7B 5DO6A 1BTEA 1HOYA 1QKEA 5DZ5A 1IDLA 1L4WA 2MJYA 2BHIA 1KBAA 2QJ9C 4KSNA 1NXBA 2I9BE 2GOOB 1IK8A 5IMYC 1V6PA 1CHVS 2MJ0A 3LAQU 1RL5A 4P7UA 1KFHA 4AEAA 2UWRA 2MUPA 3NDSA 3PLCA 1KL8A 1NYSA 1QM7A 1TXBA 1MAHF 1CTXA 1CXNA 1G6MA 2CRSA 3ERAA 1DRSA 2NBTA 1ONJA 1LX5B 1LSIA 4BIKB 1BXPA 1NYUA 4OM4A 2QC1A 1REWC 2FD6U 1CB9A 2CCXA 2CRTA 2PJYC 1IDGA 2LCRA 1FSCA 1I02A 1JBDA 1UG4A 1KC4A 2H64C 1JE9A 2K3GA 1ERAA 1H0JA 1F94A 1NEAA 1S4YA 1XT3A 1FFJA 3KFDE 2JVEA 3KFDI 2QJBC 2H5FA 1HAJA 1NTNA 2J8BA 1HAAA 2H8UA 3BT1U 2BTXA 2HLQA 1FF4A 4OM5A 1VB0A 2UX2A 1IDHA 2MFAA 6EBXA 1CODA 1NORA 1TFSA 1W6BA 1ERGA 5DU1A 1TXAA 4IYEA 1B41B 1KS6A 4FAOC 1CRFA 1CXOA 1CCQA 1F8UB 2H62C 1KXIA 2MUOA 1IJCA 4EY8B 2HLRA 2PJYB 5IMTD 1KTZB 2L5SA 4XJJA 2H64B 3QB4B 2CTXA 3EVSC 1CVOA 1FASA 2ABXA 1CREA 2LA1A 2N99A 4QTIU 1M9ZA 1IKCA 4RUDA 3U74U 1TGXA 5EBXA 3HH7A 1HC9A 1FRAA 2MHYA 1KU6B 2GOOC 2H62D 2H7ZA 2QJAC 3NH7A 1CDQA 1QKDA 3BT2U 4HQPF 2X8BB 1ZADA 1ABTA 4LFTA 2VLWA 2MJ4A 4FAOE 1KBTA 1PLOA 2CDXA 2ERAA 2OFSA 1LXGA 1COEA 2JQPA 4BDTB 4UY2C 1CDRA 1CDTA 1FSSB 1LJZA 2L03A 3NEQA 4ZQYA 1LXHA 3FEVA 1MR6A 1YWHA 1CDSA 1HC9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTX A;  3EBX A;  1RGJ A;  1KBS A;  4DO8 A;  1IQ9 A;  3U73 U;  1IDI A;  3VTS A;  2H7Z B;  1JGK A;  1ES7 B;  5DO6 A;  1BTE A;  1HOY A;  1QKE A;  5DZ5 A;  1IDL A;  1L4W A;  2MJY A;  2BHI A;  1KBA A;  2QJ9 C;  1NXB A;  2I9B E;  2GOO B;  1IK8 A;  5IMY C;  1V6P A;  1CHV S;  2MJ0 A;  3LAQ U;  1RL5 A;  4P7U A;  1KFH A;  4AEA A;  2UWR A;  2MUP A;  3NDS A;  3PLC A;  1KL8 A;  1NYS A;  1QM7 A;  1TXB A;  1MAH F;  1CTX A;  1CXN A;  1G6M A;  2CRS A;  3ERA A;  1DRS A;  2NBT A;  1ONJ A;  1LX5 B;  1LSI A;  4BIK B;  1BXP A;  1NYU A;  4OM4 A;  2QC1 A;  1REW C;  2FD6 U;  1CB9 A;  2CCX A;  2CRT A;  2PJY C;  1IDG A;  2LCR A;  1FSC A;  1I02 A;  1JBD A;  1UG4 A;  1KC4 A;  2H64 C;  1JE9 A;  2K3G A;  1ERA A;  1H0J A;  1F94 A;  1NEA A;  1S4Y A;  1XT3 A;  1FFJ A;  3KFD E;  2JVE A;  3KFD I;  2QJB C;  2H5F A;  1HAJ A;  1NTN A;  2J8B A;  1HAA A;  2H8U A;  3BT1 U;  2BTX A;  2HLQ A;  1FF4 A;  4OM5 A;  1VB0 A;  2UX2 A;  1IDH A;  2MFA A;  6EBX A;  1COD A;  1NOR A;  1TFS A;  1W6B A;  1ERG A;  5DU1 A;  1TXA A;  4IYE A;  1B41 B;  1KS6 A;  4FAO C;  1CRF A;  1CXO A;  1CCQ A;  1F8U B;  2H62 C;  1KXI A;  2MUO A;  1IJC A;  4EY8 B;  2HLR A;  2PJY B;  5IMT D;  1KTZ B;  2L5S A;  4XJJ A;  2H64 B;  3QB4 B;  2CTX A;  3EVS C;  1CVO A;  1FAS A;  2ABX A;  1CRE A;  2LA1 A;  2N99 A;  4QTI U;  1M9Z A;  1IKC A;  4RUD A;  3U74 U;  1TGX A;  5EBX A;  3HH7 A;  1HC9 A;  1FRA A;  2MHY A;  1KU6 B;  2GOO C;  2H62 D;  2H7Z A;  2QJA C;  3NH7 A;  1CDQ A;  1QKD A;  3BT2 U;  4HQP F;  2X8B B;  1ZAD A;  1ABT A;  4LFT A;  2VLW A;  2MJ4 A;  4FAO E;  1KBT A;  1PLO A;  2CDX A;  2ERA A;  2OFS A;  1LXG A;  1COE A;  2JQP A;  4BDT B;  4UY2 C;  1CDR A;  1CDT A;  1FSS B;  1LJZ A;  2L03 A;  3NEQ A;  4ZQY A;  1LXH A;  3FEV A;  1MR6 A;  1YWH A;  1CDS A;  1HC9 B; 
#chains in the Genus database with same CATH topology
 1NTX A;  3EBX A;  1RGJ A;  1KBS A;  4DO8 A;  1IQ9 A;  3U73 U;  1IDI A;  3VTS A;  2H7Z B;  1JGK A;  1ES7 B;  5DO6 A;  1BTE A;  1HOY A;  1QKE A;  5DZ5 A;  1IDL A;  1L4W A;  2MJY A;  2BHI A;  1KBA A;  2QJ9 C;  4KSN A;  1NXB A;  2I9B E;  2GOO B;  1IK8 A;  5IMY C;  1V6P A;  1CHV S;  2MJ0 A;  3LAQ U;  1RL5 A;  4P7U A;  1KFH A;  4AEA A;  2UWR A;  2MUP A;  3NDS A;  3PLC A;  1KL8 A;  1NYS A;  1QM7 A;  1TXB A;  1MAH F;  1CTX A;  1CXN A;  1G6M A;  2CRS A;  3ERA A;  1DRS A;  2NBT A;  1ONJ A;  1LX5 B;  1LSI A;  4BIK B;  1BXP A;  1NYU A;  4OM4 A;  2QC1 A;  1REW C;  2FD6 U;  1CB9 A;  2CCX A;  2CRT A;  2PJY C;  1IDG A;  2LCR A;  1FSC A;  1I02 A;  1JBD A;  1UG4 A;  1KC4 A;  2H64 C;  1JE9 A;  2K3G A;  1ERA A;  1H0J A;  1F94 A;  1NEA A;  1S4Y A;  1XT3 A;  1FFJ A;  3KFD E;  2JVE A;  3KFD I;  2QJB C;  2H5F A;  1HAJ A;  1NTN A;  2J8B A;  1HAA A;  2H8U A;  3BT1 U;  2BTX A;  2HLQ A;  1FF4 A;  4OM5 A;  1VB0 A;  2UX2 A;  1IDH A;  2MFA A;  6EBX A;  1COD A;  1NOR A;  1TFS A;  1W6B A;  1ERG A;  5DU1 A;  1TXA A;  4IYE A;  1B41 B;  1KS6 A;  4FAO C;  1CRF A;  1CXO A;  1CCQ A;  1F8U B;  2H62 C;  1KXI A;  2MUO A;  1IJC A;  4EY8 B;  2HLR A;  2PJY B;  5IMT D;  1KTZ B;  2L5S A;  4XJJ A;  2H64 B;  3QB4 B;  2CTX A;  3EVS C;  1CVO A;  1FAS A;  2ABX A;  1CRE A;  2LA1 A;  2N99 A;  4QTI U;  1M9Z A;  1IKC A;  4RUD A;  3U74 U;  1TGX A;  5EBX A;  3HH7 A;  1HC9 A;  1FRA A;  2MHY A;  1KU6 B;  2GOO C;  2H62 D;  2H7Z A;  2QJA C;  3NH7 A;  1CDQ A;  1QKD A;  3BT2 U;  4HQP F;  2X8B B;  1ZAD A;  1ABT A;  4LFT A;  2VLW A;  2MJ4 A;  4FAO E;  1KBT A;  1PLO A;  2CDX A;  2ERA A;  2OFS A;  1LXG A;  1COE A;  2JQP A;  4BDT B;  4UY2 C;  1CDR A;  1CDT A;  1FSS B;  1LJZ A;  2L03 A;  3NEQ A;  4ZQY A;  1LXH A;  3FEV A;  1MR6 A;  1YWH A;  1CDS A;  1HC9 B; 
#chains in the Genus database with same CATH homology
 1NTX A;  3EBX A;  1RGJ A;  1KBS A;  4DO8 A;  1IQ9 A;  3U73 U;  1IDI A;  3VTS A;  2H7Z B;  1JGK A;  1ES7 B;  5DO6 A;  1BTE A;  1HOY A;  1QKE A;  5DZ5 A;  1IDL A;  1L4W A;  2MJY A;  2BHI A;  1KBA A;  2QJ9 C;  4KSN A;  1NXB A;  2I9B E;  2GOO B;  1IK8 A;  5IMY C;  1V6P A;  1CHV S;  2MJ0 A;  3LAQ U;  1RL5 A;  4P7U A;  1KFH A;  4AEA A;  2UWR A;  2MUP A;  3NDS A;  3PLC A;  1KL8 A;  1NYS A;  1QM7 A;  1TXB A;  1MAH F;  1CTX A;  1CXN A;  1G6M A;  2CRS A;  3ERA A;  1DRS A;  2NBT A;  1ONJ A;  1LX5 B;  1LSI A;  4BIK B;  1BXP A;  1NYU A;  4OM4 A;  2QC1 A;  1REW C;  2FD6 U;  1CB9 A;  2CCX A;  2CRT A;  2PJY C;  1IDG A;  2LCR A;  1FSC A;  1I02 A;  1JBD A;  1UG4 A;  1KC4 A;  2H64 C;  1JE9 A;  2K3G A;  1ERA A;  1H0J A;  1F94 A;  1NEA A;  1S4Y A;  1XT3 A;  1FFJ A;  3KFD E;  2JVE A;  3KFD I;  2QJB C;  2H5F A;  1HAJ A;  1NTN A;  2J8B A;  1HAA A;  2H8U A;  3BT1 U;  2BTX A;  2HLQ A;  1FF4 A;  4OM5 A;  1VB0 A;  2UX2 A;  1IDH A;  2MFA A;  6EBX A;  1COD A;  1NOR A;  1TFS A;  1W6B A;  1ERG A;  5DU1 A;  1TXA A;  4IYE A;  1B41 B;  1KS6 A;  4FAO C;  1CRF A;  1CXO A;  1CCQ A;  1F8U B;  2H62 C;  1KXI A;  2MUO A;  1IJC A;  4EY8 B;  2HLR A;  2PJY B;  5IMT D;  1KTZ B;  2L5S A;  4XJJ A;  2H64 B;  3QB4 B;  2CTX A;  3EVS C;  1CVO A;  1FAS A;  2ABX A;  1CRE A;  2LA1 A;  2N99 A;  4QTI U;  1M9Z A;  1IKC A;  4RUD A;  3U74 U;  1TGX A;  5EBX A;  3HH7 A;  1HC9 A;  1FRA A;  2MHY A;  1KU6 B;  2GOO C;  2H62 D;  2H7Z A;  2QJA C;  3NH7 A;  1CDQ A;  1QKD A;  3BT2 U;  4HQP F;  2X8B B;  1ZAD A;  1ABT A;  4LFT A;  2VLW A;  2MJ4 A;  4FAO E;  1KBT A;  1PLO A;  2CDX A;  2ERA A;  2OFS A;  1LXG A;  1COE A;  2JQP A;  4BDT B;  4UY2 C;  1CDR A;  1CDT A;  1FSS B;  1LJZ A;  2L03 A;  3NEQ A;  4ZQY A;  1LXH A;  3FEV A;  1MR6 A;  1YWH A;  1CDS A;  1HC9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...