3BT1U

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
275
structure length
273
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 64
structure length 273
sequence length 275
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt1U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt1U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt1U02
4OM5A 1CB9A 3NEQA 1RGJA 1REWC 1M9ZA 4EY8B 1CVOA 1CDQA 2CRSA 4XJJA 1BTEA 5DO6A 1LX5B 1IKCA 2H62D 1FFJA 4UY2C 1B41B 2LCRA 3BT2U 1CXOA 1I02A 1TXBA 4FAOE 1CCQA 3BT1U 2VLWA 4P7UA 1NXBA 2CDXA 1CHVS 1KTZB 1TXAA 1FF4A 2QJAC 3LAQU 1BXPA 1COEA 1DRSA 2H62C 1KS6A 2K3GA 1L4WA 1LXGA 1JE9A 4LFTA 1HC9A 3KFDE 2LA1A 4OM4A 1XT3A 2H64B 1ONJA 2L03A 1PLOA 2ERAA 1KU6B 2OFSA 4IYEA 3U74U 1HOYA 2GOOB 2MUPA 1LSIA 4QTIU 1IK8A 1ERAA 2ABXA 2HLRA 1G6MA 1NTXA 2JVEA 5DU1A 1IDHA 1NTNA 1MR6A 5DZ5A 5IMTD 3HH7A 2I9BE 3QB4B 1IJCA 1YWHA 1KBSA 4HQPF 2L5SA 2BHIA 4ZQYA 1CREA 3VTSA 1IDLA 1CODA 2QC1A 5IMYC 2CCXA 1IDIA 1KXIA 2MJYA 1KBAA 4FAOC 1JBDA 2FD6U 1KC4A 3NDSA 3PLCA 1NYUA 2HLQA 1NORA 3EVSC 1VB0A 2PJYB 2JQPA 1QKDA 1HAJA 1CDTA 2NBTA 4BDTB 3KFDI 2H5FA 4BIKB 2QJ9C 1RL5A 3U73U 2H64C 1IQ9A 2X8BB 1UG4A 1CDSA 1KL8A 1F8UB 1CXNA 2H7ZA 2CRTA 1HC9B 2MJ0A 3EBXA 1FSSB 1KBTA 1MAHF 3ERAA 5EBXA 1FSCA 2MHYA 4AEAA 6EBXA 1CRFA 1QKEA 1LJZA 1JGKA 1F94A 1IDGA 1LXHA 3NH7A 1ES7B 2UX2A 1CDRA 1ERGA 1H0JA 1S4YA 1TFSA 1FRAA 4DO8A 3FEVA 1FASA 1V6PA 1NEAA 2UWRA 2J8BA 2CTXA 2PJYC 2H8UA 2N99A 1HAAA 2GOOC 1ZADA 1TGXA 2MUOA 1KFHA 4RUDA 1NYSA 1CTXA 1ABTA 2MJ4A 2H7ZB 2MFAA 1QM7A 2BTXA 2QJBC 1W6BA
chains in the Genus database with same CATH superfamily
4OM5A 1CB9A 3NEQA 1RGJA 1REWC 1M9ZA 4EY8B 1CVOA 1CDQA 2CRSA 4XJJA 1BTEA 5DO6A 1LX5B 1IKCA 2H62D 1FFJA 4UY2C 1B41B 2LCRA 3BT2U 1CXOA 1I02A 1TXBA 4FAOE 1CCQA 3BT1U 2VLWA 4KSNA 4P7UA 1NXBA 2CDXA 1CHVS 1KTZB 1TXAA 1FF4A 2QJAC 3LAQU 1BXPA 1COEA 1DRSA 2H62C 1KS6A 2K3GA 1L4WA 1LXGA 1JE9A 4LFTA 1HC9A 3KFDE 2LA1A 4OM4A 1XT3A 2H64B 1ONJA 2L03A 1PLOA 2ERAA 1KU6B 2OFSA 4IYEA 3U74U 1HOYA 2GOOB 2MUPA 1LSIA 4QTIU 1IK8A 1ERAA 2ABXA 2HLRA 1G6MA 1NTXA 2JVEA 5DU1A 1IDHA 1NTNA 1MR6A 5DZ5A 5IMTD 3HH7A 2I9BE 3QB4B 1IJCA 1YWHA 1KBSA 4HQPF 2L5SA 2BHIA 4ZQYA 1CREA 3VTSA 1IDLA 1CODA 2QC1A 5IMYC 2CCXA 1IDIA 1KXIA 2MJYA 1KBAA 4FAOC 1JBDA 2FD6U 1KC4A 3NDSA 3PLCA 1NYUA 2HLQA 1NORA 3EVSC 1VB0A 2PJYB 2JQPA 1QKDA 1HAJA 1CDTA 2NBTA 4BDTB 3KFDI 2H5FA 4BIKB 2QJ9C 1RL5A 3U73U 2H64C 1IQ9A 2X8BB 1UG4A 1CDSA 1KL8A 1F8UB 1CXNA 2H7ZA 2CRTA 1HC9B 2MJ0A 3EBXA 1FSSB 1KBTA 1MAHF 3ERAA 5EBXA 1FSCA 2MHYA 4AEAA 6EBXA 1CRFA 1QKEA 1LJZA 1JGKA 1F94A 1IDGA 1LXHA 3NH7A 1ES7B 2UX2A 1CDRA 1ERGA 1H0JA 1S4YA 1TFSA 1FRAA 4DO8A 3FEVA 1FASA 1V6PA 1NEAA 2UWRA 2J8BA 2CTXA 2PJYC 2H8UA 2N99A 1HAAA 2GOOC 1ZADA 1TGXA 2MUOA 1KFHA 4RUDA 1NYSA 1CTXA 1ABTA 2MJ4A 2H7ZB 2MFAA 1QM7A 2BTXA 2QJBC 1W6BA
chains in the Genus database with same CATH topology
4OM5A 1CB9A 3NEQA 1RGJA 1REWC 1M9ZA 4EY8B 1CVOA 1CDQA 2CRSA 4XJJA 1BTEA 5DO6A 1LX5B 1IKCA 2H62D 1FFJA 4UY2C 1B41B 2LCRA 3BT2U 1CXOA 1I02A 1TXBA 4FAOE 1CCQA 3BT1U 2VLWA 4KSNA 4P7UA 1NXBA 2CDXA 1CHVS 1KTZB 1TXAA 1FF4A 2QJAC 3LAQU 1BXPA 1COEA 1DRSA 2H62C 1KS6A 2K3GA 1L4WA 1LXGA 1JE9A 4LFTA 1HC9A 3KFDE 2LA1A 4OM4A 1XT3A 2H64B 1ONJA 2L03A 1PLOA 2ERAA 1KU6B 2OFSA 4IYEA 3U74U 1HOYA 2GOOB 2MUPA 1LSIA 4QTIU 1IK8A 1ERAA 2ABXA 2HLRA 1G6MA 1NTXA 2JVEA 5DU1A 1IDHA 1NTNA 1MR6A 5DZ5A 5IMTD 3HH7A 2I9BE 3QB4B 1IJCA 1YWHA 1KBSA 4HQPF 2L5SA 2BHIA 4ZQYA 1CREA 3VTSA 1IDLA 1CODA 2QC1A 5IMYC 2CCXA 1IDIA 1KXIA 2MJYA 1KBAA 4FAOC 1JBDA 2FD6U 1KC4A 3NDSA 3PLCA 1NYUA 2HLQA 1NORA 3EVSC 1VB0A 2PJYB 2JQPA 1QKDA 1HAJA 1CDTA 2NBTA 4BDTB 3KFDI 2H5FA 4BIKB 2QJ9C 1RL5A 3U73U 2H64C 1IQ9A 2X8BB 1UG4A 1CDSA 1KL8A 1F8UB 1CXNA 2H7ZA 2CRTA 1HC9B 2MJ0A 3EBXA 1FSSB 1KBTA 1MAHF 3ERAA 5EBXA 1FSCA 2MHYA 4AEAA 6EBXA 1CRFA 1QKEA 1LJZA 1JGKA 1F94A 1IDGA 1LXHA 3NH7A 1ES7B 2UX2A 1CDRA 1ERGA 1H0JA 1S4YA 1TFSA 1FRAA 4DO8A 3FEVA 1FASA 1V6PA 1NEAA 2UWRA 2J8BA 2CTXA 2PJYC 2H8UA 2N99A 1HAAA 2GOOC 1ZADA 1TGXA 2MUOA 1KFHA 4RUDA 1NYSA 1CTXA 1ABTA 2MJ4A 2H7ZB 2MFAA 1QM7A 2BTXA 2QJBC 1W6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  1CB9 A;  3NEQ A;  1RGJ A;  1REW C;  1M9Z A;  4EY8 B;  1CVO A;  1CDQ A;  2CRS A;  4XJJ A;  1BTE A;  5DO6 A;  1LX5 B;  1IKC A;  2H62 D;  1FFJ A;  4UY2 C;  1B41 B;  2LCR A;  3BT2 U;  1CXO A;  1I02 A;  1TXB A;  4FAO E;  1CCQ A;  3BT1 U;  2VLW A;  4P7U A;  1NXB A;  2CDX A;  1CHV S;  1KTZ B;  1TXA A;  1FF4 A;  2QJA C;  3LAQ U;  1BXP A;  1COE A;  1DRS A;  2H62 C;  1KS6 A;  2K3G A;  1L4W A;  1LXG A;  1JE9 A;  4LFT A;  1HC9 A;  3KFD E;  2LA1 A;  4OM4 A;  1XT3 A;  2H64 B;  1ONJ A;  2L03 A;  1PLO A;  2ERA A;  1KU6 B;  2OFS A;  4IYE A;  3U74 U;  1HOY A;  2GOO B;  2MUP A;  1LSI A;  4QTI U;  1IK8 A;  1ERA A;  2ABX A;  2HLR A;  1G6M A;  1NTX A;  2JVE A;  5DU1 A;  1IDH A;  1NTN A;  1MR6 A;  5DZ5 A;  5IMT D;  3HH7 A;  2I9B E;  3QB4 B;  1IJC A;  1YWH A;  1KBS A;  4HQP F;  2L5S A;  2BHI A;  4ZQY A;  1CRE A;  3VTS A;  1IDL A;  1COD A;  2QC1 A;  5IMY C;  2CCX A;  1IDI A;  1KXI A;  2MJY A;  1KBA A;  4FAO C;  1JBD A;  2FD6 U;  1KC4 A;  3NDS A;  3PLC A;  1NYU A;  2HLQ A;  1NOR A;  3EVS C;  1VB0 A;  2PJY B;  2JQP A;  1QKD A;  1HAJ A;  1CDT A;  2NBT A;  4BDT B;  3KFD I;  2H5F A;  4BIK B;  2QJ9 C;  1RL5 A;  3U73 U;  2H64 C;  1IQ9 A;  2X8B B;  1UG4 A;  1CDS A;  1KL8 A;  1F8U B;  1CXN A;  2H7Z A;  2CRT A;  1HC9 B;  2MJ0 A;  3EBX A;  1FSS B;  1KBT A;  1MAH F;  3ERA A;  5EBX A;  1FSC A;  2MHY A;  4AEA A;  6EBX A;  1CRF A;  1QKE A;  1LJZ A;  1JGK A;  1F94 A;  1IDG A;  1LXH A;  3NH7 A;  1ES7 B;  2UX2 A;  1CDR A;  1ERG A;  1H0J A;  1S4Y A;  1TFS A;  1FRA A;  4DO8 A;  3FEV A;  1FAS A;  1V6P A;  1NEA A;  2UWR A;  2J8B A;  2CTX A;  2PJY C;  2H8U A;  2N99 A;  1HAA A;  2GOO C;  1ZAD A;  1TGX A;  2MUO A;  1KFH A;  4RUD A;  1NYS A;  1CTX A;  1ABT A;  2MJ4 A;  2H7Z B;  2MFA A;  1QM7 A;  2BTX A;  2QJB C;  1W6B A; 
#chains in the Genus database with same CATH topology
 4OM5 A;  1CB9 A;  3NEQ A;  1RGJ A;  1REW C;  1M9Z A;  4EY8 B;  1CVO A;  1CDQ A;  2CRS A;  4XJJ A;  1BTE A;  5DO6 A;  1LX5 B;  1IKC A;  2H62 D;  1FFJ A;  4UY2 C;  1B41 B;  2LCR A;  3BT2 U;  1CXO A;  1I02 A;  1TXB A;  4FAO E;  1CCQ A;  3BT1 U;  2VLW A;  4KSN A;  4P7U A;  1NXB A;  2CDX A;  1CHV S;  1KTZ B;  1TXA A;  1FF4 A;  2QJA C;  3LAQ U;  1BXP A;  1COE A;  1DRS A;  2H62 C;  1KS6 A;  2K3G A;  1L4W A;  1LXG A;  1JE9 A;  4LFT A;  1HC9 A;  3KFD E;  2LA1 A;  4OM4 A;  1XT3 A;  2H64 B;  1ONJ A;  2L03 A;  1PLO A;  2ERA A;  1KU6 B;  2OFS A;  4IYE A;  3U74 U;  1HOY A;  2GOO B;  2MUP A;  1LSI A;  4QTI U;  1IK8 A;  1ERA A;  2ABX A;  2HLR A;  1G6M A;  1NTX A;  2JVE A;  5DU1 A;  1IDH A;  1NTN A;  1MR6 A;  5DZ5 A;  5IMT D;  3HH7 A;  2I9B E;  3QB4 B;  1IJC A;  1YWH A;  1KBS A;  4HQP F;  2L5S A;  2BHI A;  4ZQY A;  1CRE A;  3VTS A;  1IDL A;  1COD A;  2QC1 A;  5IMY C;  2CCX A;  1IDI A;  1KXI A;  2MJY A;  1KBA A;  4FAO C;  1JBD A;  2FD6 U;  1KC4 A;  3NDS A;  3PLC A;  1NYU A;  2HLQ A;  1NOR A;  3EVS C;  1VB0 A;  2PJY B;  2JQP A;  1QKD A;  1HAJ A;  1CDT A;  2NBT A;  4BDT B;  3KFD I;  2H5F A;  4BIK B;  2QJ9 C;  1RL5 A;  3U73 U;  2H64 C;  1IQ9 A;  2X8B B;  1UG4 A;  1CDS A;  1KL8 A;  1F8U B;  1CXN A;  2H7Z A;  2CRT A;  1HC9 B;  2MJ0 A;  3EBX A;  1FSS B;  1KBT A;  1MAH F;  3ERA A;  5EBX A;  1FSC A;  2MHY A;  4AEA A;  6EBX A;  1CRF A;  1QKE A;  1LJZ A;  1JGK A;  1F94 A;  1IDG A;  1LXH A;  3NH7 A;  1ES7 B;  2UX2 A;  1CDR A;  1ERG A;  1H0J A;  1S4Y A;  1TFS A;  1FRA A;  4DO8 A;  3FEV A;  1FAS A;  1V6P A;  1NEA A;  2UWR A;  2J8B A;  2CTX A;  2PJY C;  2H8U A;  2N99 A;  1HAA A;  2GOO C;  1ZAD A;  1TGX A;  2MUO A;  1KFH A;  4RUD A;  1NYS A;  1CTX A;  1ABT A;  2MJ4 A;  2H7Z B;  2MFA A;  1QM7 A;  2BTX A;  2QJB C;  1W6B A; 
#chains in the Genus database with same CATH homology
 4OM5 A;  1CB9 A;  3NEQ A;  1RGJ A;  1REW C;  1M9Z A;  4EY8 B;  1CVO A;  1CDQ A;  2CRS A;  4XJJ A;  1BTE A;  5DO6 A;  1LX5 B;  1IKC A;  2H62 D;  1FFJ A;  4UY2 C;  1B41 B;  2LCR A;  3BT2 U;  1CXO A;  1I02 A;  1TXB A;  4FAO E;  1CCQ A;  3BT1 U;  2VLW A;  4KSN A;  4P7U A;  1NXB A;  2CDX A;  1CHV S;  1KTZ B;  1TXA A;  1FF4 A;  2QJA C;  3LAQ U;  1BXP A;  1COE A;  1DRS A;  2H62 C;  1KS6 A;  2K3G A;  1L4W A;  1LXG A;  1JE9 A;  4LFT A;  1HC9 A;  3KFD E;  2LA1 A;  4OM4 A;  1XT3 A;  2H64 B;  1ONJ A;  2L03 A;  1PLO A;  2ERA A;  1KU6 B;  2OFS A;  4IYE A;  3U74 U;  1HOY A;  2GOO B;  2MUP A;  1LSI A;  4QTI U;  1IK8 A;  1ERA A;  2ABX A;  2HLR A;  1G6M A;  1NTX A;  2JVE A;  5DU1 A;  1IDH A;  1NTN A;  1MR6 A;  5DZ5 A;  5IMT D;  3HH7 A;  2I9B E;  3QB4 B;  1IJC A;  1YWH A;  1KBS A;  4HQP F;  2L5S A;  2BHI A;  4ZQY A;  1CRE A;  3VTS A;  1IDL A;  1COD A;  2QC1 A;  5IMY C;  2CCX A;  1IDI A;  1KXI A;  2MJY A;  1KBA A;  4FAO C;  1JBD A;  2FD6 U;  1KC4 A;  3NDS A;  3PLC A;  1NYU A;  2HLQ A;  1NOR A;  3EVS C;  1VB0 A;  2PJY B;  2JQP A;  1QKD A;  1HAJ A;  1CDT A;  2NBT A;  4BDT B;  3KFD I;  2H5F A;  4BIK B;  2QJ9 C;  1RL5 A;  3U73 U;  2H64 C;  1IQ9 A;  2X8B B;  1UG4 A;  1CDS A;  1KL8 A;  1F8U B;  1CXN A;  2H7Z A;  2CRT A;  1HC9 B;  2MJ0 A;  3EBX A;  1FSS B;  1KBT A;  1MAH F;  3ERA A;  5EBX A;  1FSC A;  2MHY A;  4AEA A;  6EBX A;  1CRF A;  1QKE A;  1LJZ A;  1JGK A;  1F94 A;  1IDG A;  1LXH A;  3NH7 A;  1ES7 B;  2UX2 A;  1CDR A;  1ERG A;  1H0J A;  1S4Y A;  1TFS A;  1FRA A;  4DO8 A;  3FEV A;  1FAS A;  1V6P A;  1NEA A;  2UWR A;  2J8B A;  2CTX A;  2PJY C;  2H8U A;  2N99 A;  1HAA A;  2GOO C;  1ZAD A;  1TGX A;  2MUO A;  1KFH A;  4RUD A;  1NYS A;  1CTX A;  1ABT A;  2MJ4 A;  2H7Z B;  2MFA A;  1QM7 A;  2BTX A;  2QJB C;  1W6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...