5DU1A

Crystal structure of dendroaspis polylepis mambalgin-1 wild-type in p21 space group.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
57
structure length
57
Chain Sequence
LKCYQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mambalgin-1
publication title Mambalgin-1 Pain-relieving Peptide, Stepwise Solid-phase Synthesis, Crystal Structure, and Functional Domain for Acid-sensing Ion Channel 1a Inhibition.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 57
sequence length 57
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5du1A00
2X8BB 5EBXA 1TGXA 4IYEA 3EBXA 4RUDA 4EY8B 3KFDE 1NTNA 3KFDI 1KXIA 1FSSB 1TXAA 2N99A 2QJAC 1UG4A 1KTZB 2LCRA 1IKCA 1IQ9A 1FRAA 2VLWA 2L5SA 4OM5A 5DZ5A 3NDSA 1CXOA 4UY2C 3U74U 2PJYC 1PLOA 2H5FA 1CB9A 3BT2U 1FASA 2FD6U 2K3GA 2MJ0A 1FSCA 2UWRA 1CREA 1ES7B 1LJZA 1NEAA 1RGJA 1FF4A 2CDXA 4FAOE 1LX5B 1M9ZA 1LXHA 3NH7A 4HQPF 1NTXA 1BTEA 1KBTA 3QB4B 2JQPA 1RL5A 2H62D 1TXBA 2MHYA 1NYSA 1HC9B 1JGKA 1NYUA 1QKDA 1CRFA 1KU6B 1W6BA 2NBTA 4QTIU 1COEA 2L03A 1IDGA 1CHVS 1CCQA 3U73U 2MUOA 4FAOC 5IMYC 1QM7A 1KBSA 1ERGA 2H8UA 1IDHA 4BIKB 1LSIA 1KBAA 1H0JA 1REWC 1KS6A 2ERAA 2UX2A 4LFTA 1KC4A 2CTXA 1HOYA 4ZQYA 1QKEA 4DO8A 1JE9A 1F8UB 1YWHA 2CRSA 1CODA 3HH7A 2MJYA 2HLQA 1BXPA 1V6PA 2GOOC 5DU1A 1ZADA 1KL8A 1HAJA 1ABTA 1VB0A 2GOOB 1IDLA 2I9BE 1L4WA 3EVSC 1CDSA 1MR6A 1S4YA 1XT3A 1JBDA 1IDIA 3ERAA 2H64B 2H7ZA 1CVOA 3BT1U 3FEVA 1NXBA 6EBXA 1CDTA 1CDRA 1F94A 2BTXA 3LAQU 2QJBC 2H62C 2OFSA 5DO6A 1CTXA 1I02A 1DRSA 1KFHA 3PLCA 2MUPA 4XJJA 5IMTD 1HAAA 1NORA 2H7ZB 1ERAA 4P7UA 1CXNA 1G6MA 2LA1A 3VTSA 4OM4A 1IK8A 2CRTA 4AEAA 2ABXA 1TFSA 2QJ9C 1B41B 2MJ4A 4BDTB 1IJCA 1FFJA 2PJYB 2HLRA 2H64C 1MAHF 2CCXA 2MFAA 3NEQA 1LXGA 1ONJA 2QC1A 1CDQA 2J8BA 2BHIA 1HC9A 2JVEA
chains in the Genus database with same CATH superfamily
2X8BB 5EBXA 4KSNA 1TGXA 4IYEA 3EBXA 4RUDA 4EY8B 3KFDE 1NTNA 3KFDI 1KXIA 1FSSB 1TXAA 2N99A 2QJAC 1UG4A 1KTZB 2LCRA 1IKCA 1IQ9A 1FRAA 2VLWA 2L5SA 4OM5A 5DZ5A 3NDSA 1CXOA 4UY2C 3U74U 2PJYC 1PLOA 2H5FA 1CB9A 3BT2U 1FASA 2FD6U 2K3GA 2MJ0A 1FSCA 2UWRA 1CREA 1ES7B 1LJZA 1NEAA 1RGJA 1FF4A 2CDXA 4FAOE 1LX5B 1M9ZA 1LXHA 3NH7A 4HQPF 1NTXA 1BTEA 1KBTA 3QB4B 2JQPA 1RL5A 2H62D 1TXBA 2MHYA 1NYSA 1HC9B 1JGKA 1NYUA 1QKDA 1CRFA 1KU6B 1W6BA 2NBTA 4QTIU 1COEA 2L03A 1IDGA 1CHVS 1CCQA 3U73U 2MUOA 4FAOC 5IMYC 1QM7A 1KBSA 1ERGA 2H8UA 1IDHA 4BIKB 1LSIA 1KBAA 1H0JA 1REWC 1KS6A 2ERAA 2UX2A 4LFTA 1KC4A 2CTXA 1HOYA 4ZQYA 1QKEA 4DO8A 1JE9A 1F8UB 1YWHA 2CRSA 1CODA 3HH7A 2MJYA 2HLQA 1BXPA 1V6PA 2GOOC 5DU1A 1ZADA 1KL8A 1HAJA 1ABTA 1VB0A 2GOOB 1IDLA 2I9BE 1L4WA 3EVSC 1CDSA 1MR6A 1S4YA 1XT3A 1JBDA 1IDIA 3ERAA 2H64B 2H7ZA 1CVOA 3BT1U 3FEVA 1NXBA 6EBXA 1CDTA 1CDRA 1F94A 2BTXA 3LAQU 2QJBC 2H62C 2OFSA 5DO6A 1CTXA 1I02A 1DRSA 1KFHA 3PLCA 2MUPA 4XJJA 5IMTD 1HAAA 1NORA 2H7ZB 1ERAA 4P7UA 1CXNA 1G6MA 2LA1A 3VTSA 4OM4A 1IK8A 2CRTA 4AEAA 2ABXA 1TFSA 2QJ9C 1B41B 2MJ4A 4BDTB 1IJCA 1FFJA 2PJYB 2HLRA 2H64C 1MAHF 2CCXA 2MFAA 3NEQA 1LXGA 1ONJA 2QC1A 1CDQA 2J8BA 2BHIA 1HC9A 2JVEA
chains in the Genus database with same CATH topology
2X8BB 5EBXA 4KSNA 1TGXA 4IYEA 3EBXA 4RUDA 4EY8B 3KFDE 1NTNA 3KFDI 1KXIA 1FSSB 1TXAA 2N99A 2QJAC 1UG4A 1KTZB 2LCRA 1IKCA 1IQ9A 1FRAA 2VLWA 2L5SA 4OM5A 5DZ5A 3NDSA 1CXOA 4UY2C 3U74U 2PJYC 1PLOA 2H5FA 1CB9A 3BT2U 1FASA 2FD6U 2K3GA 2MJ0A 1FSCA 2UWRA 1CREA 1ES7B 1LJZA 1NEAA 1RGJA 1FF4A 2CDXA 4FAOE 1LX5B 1M9ZA 1LXHA 3NH7A 4HQPF 1NTXA 1BTEA 1KBTA 3QB4B 2JQPA 1RL5A 2H62D 1TXBA 2MHYA 1NYSA 1HC9B 1JGKA 1NYUA 1QKDA 1CRFA 1KU6B 1W6BA 2NBTA 4QTIU 1COEA 2L03A 1IDGA 1CHVS 1CCQA 3U73U 2MUOA 4FAOC 5IMYC 1QM7A 1KBSA 1ERGA 2H8UA 1IDHA 4BIKB 1LSIA 1KBAA 1H0JA 1REWC 1KS6A 2ERAA 2UX2A 4LFTA 1KC4A 2CTXA 1HOYA 4ZQYA 1QKEA 4DO8A 1JE9A 1F8UB 1YWHA 2CRSA 1CODA 3HH7A 2MJYA 2HLQA 1BXPA 1V6PA 2GOOC 5DU1A 1ZADA 1KL8A 1HAJA 1ABTA 1VB0A 2GOOB 1IDLA 2I9BE 1L4WA 3EVSC 1CDSA 1MR6A 1S4YA 1XT3A 1JBDA 1IDIA 3ERAA 2H64B 2H7ZA 1CVOA 3BT1U 3FEVA 1NXBA 6EBXA 1CDTA 1CDRA 1F94A 2BTXA 3LAQU 2QJBC 2H62C 2OFSA 5DO6A 1CTXA 1I02A 1DRSA 1KFHA 3PLCA 2MUPA 4XJJA 5IMTD 1HAAA 1NORA 2H7ZB 1ERAA 4P7UA 1CXNA 1G6MA 2LA1A 3VTSA 4OM4A 1IK8A 2CRTA 4AEAA 2ABXA 1TFSA 2QJ9C 1B41B 2MJ4A 4BDTB 1IJCA 1FFJA 2PJYB 2HLRA 2H64C 1MAHF 2CCXA 2MFAA 3NEQA 1LXGA 1ONJA 2QC1A 1CDQA 2J8BA 2BHIA 1HC9A 2JVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X8B B;  5EBX A;  1TGX A;  4IYE A;  3EBX A;  4RUD A;  4EY8 B;  3KFD E;  1NTN A;  3KFD I;  1KXI A;  1FSS B;  1TXA A;  2N99 A;  2QJA C;  1UG4 A;  1KTZ B;  2LCR A;  1IKC A;  1IQ9 A;  1FRA A;  2VLW A;  2L5S A;  4OM5 A;  5DZ5 A;  3NDS A;  1CXO A;  4UY2 C;  3U74 U;  2PJY C;  1PLO A;  2H5F A;  1CB9 A;  3BT2 U;  1FAS A;  2FD6 U;  2K3G A;  2MJ0 A;  1FSC A;  2UWR A;  1CRE A;  1ES7 B;  1LJZ A;  1NEA A;  1RGJ A;  1FF4 A;  2CDX A;  4FAO E;  1LX5 B;  1M9Z A;  1LXH A;  3NH7 A;  4HQP F;  1NTX A;  1BTE A;  1KBT A;  3QB4 B;  2JQP A;  1RL5 A;  2H62 D;  1TXB A;  2MHY A;  1NYS A;  1HC9 B;  1JGK A;  1NYU A;  1QKD A;  1CRF A;  1KU6 B;  1W6B A;  2NBT A;  4QTI U;  1COE A;  2L03 A;  1IDG A;  1CHV S;  1CCQ A;  3U73 U;  2MUO A;  4FAO C;  5IMY C;  1QM7 A;  1KBS A;  1ERG A;  2H8U A;  1IDH A;  4BIK B;  1LSI A;  1KBA A;  1H0J A;  1REW C;  1KS6 A;  2ERA A;  2UX2 A;  4LFT A;  1KC4 A;  2CTX A;  1HOY A;  4ZQY A;  1QKE A;  4DO8 A;  1JE9 A;  1F8U B;  1YWH A;  2CRS A;  1COD A;  3HH7 A;  2MJY A;  2HLQ A;  1BXP A;  1V6P A;  2GOO C;  5DU1 A;  1ZAD A;  1KL8 A;  1HAJ A;  1ABT A;  1VB0 A;  2GOO B;  1IDL A;  2I9B E;  1L4W A;  3EVS C;  1CDS A;  1MR6 A;  1S4Y A;  1XT3 A;  1JBD A;  1IDI A;  3ERA A;  2H64 B;  2H7Z A;  1CVO A;  3BT1 U;  3FEV A;  1NXB A;  6EBX A;  1CDT A;  1CDR A;  1F94 A;  2BTX A;  3LAQ U;  2QJB C;  2H62 C;  2OFS A;  5DO6 A;  1CTX A;  1I02 A;  1DRS A;  1KFH A;  3PLC A;  2MUP A;  4XJJ A;  5IMT D;  1HAA A;  1NOR A;  2H7Z B;  1ERA A;  4P7U A;  1CXN A;  1G6M A;  2LA1 A;  3VTS A;  4OM4 A;  1IK8 A;  2CRT A;  4AEA A;  2ABX A;  1TFS A;  2QJ9 C;  1B41 B;  2MJ4 A;  4BDT B;  1IJC A;  1FFJ A;  2PJY B;  2HLR A;  2H64 C;  1MAH F;  2CCX A;  2MFA A;  3NEQ A;  1LXG A;  1ONJ A;  2QC1 A;  1CDQ A;  2J8B A;  2BHI A;  1HC9 A;  2JVE A; 
#chains in the Genus database with same CATH topology
 2X8B B;  5EBX A;  4KSN A;  1TGX A;  4IYE A;  3EBX A;  4RUD A;  4EY8 B;  3KFD E;  1NTN A;  3KFD I;  1KXI A;  1FSS B;  1TXA A;  2N99 A;  2QJA C;  1UG4 A;  1KTZ B;  2LCR A;  1IKC A;  1IQ9 A;  1FRA A;  2VLW A;  2L5S A;  4OM5 A;  5DZ5 A;  3NDS A;  1CXO A;  4UY2 C;  3U74 U;  2PJY C;  1PLO A;  2H5F A;  1CB9 A;  3BT2 U;  1FAS A;  2FD6 U;  2K3G A;  2MJ0 A;  1FSC A;  2UWR A;  1CRE A;  1ES7 B;  1LJZ A;  1NEA A;  1RGJ A;  1FF4 A;  2CDX A;  4FAO E;  1LX5 B;  1M9Z A;  1LXH A;  3NH7 A;  4HQP F;  1NTX A;  1BTE A;  1KBT A;  3QB4 B;  2JQP A;  1RL5 A;  2H62 D;  1TXB A;  2MHY A;  1NYS A;  1HC9 B;  1JGK A;  1NYU A;  1QKD A;  1CRF A;  1KU6 B;  1W6B A;  2NBT A;  4QTI U;  1COE A;  2L03 A;  1IDG A;  1CHV S;  1CCQ A;  3U73 U;  2MUO A;  4FAO C;  5IMY C;  1QM7 A;  1KBS A;  1ERG A;  2H8U A;  1IDH A;  4BIK B;  1LSI A;  1KBA A;  1H0J A;  1REW C;  1KS6 A;  2ERA A;  2UX2 A;  4LFT A;  1KC4 A;  2CTX A;  1HOY A;  4ZQY A;  1QKE A;  4DO8 A;  1JE9 A;  1F8U B;  1YWH A;  2CRS A;  1COD A;  3HH7 A;  2MJY A;  2HLQ A;  1BXP A;  1V6P A;  2GOO C;  5DU1 A;  1ZAD A;  1KL8 A;  1HAJ A;  1ABT A;  1VB0 A;  2GOO B;  1IDL A;  2I9B E;  1L4W A;  3EVS C;  1CDS A;  1MR6 A;  1S4Y A;  1XT3 A;  1JBD A;  1IDI A;  3ERA A;  2H64 B;  2H7Z A;  1CVO A;  3BT1 U;  3FEV A;  1NXB A;  6EBX A;  1CDT A;  1CDR A;  1F94 A;  2BTX A;  3LAQ U;  2QJB C;  2H62 C;  2OFS A;  5DO6 A;  1CTX A;  1I02 A;  1DRS A;  1KFH A;  3PLC A;  2MUP A;  4XJJ A;  5IMT D;  1HAA A;  1NOR A;  2H7Z B;  1ERA A;  4P7U A;  1CXN A;  1G6M A;  2LA1 A;  3VTS A;  4OM4 A;  1IK8 A;  2CRT A;  4AEA A;  2ABX A;  1TFS A;  2QJ9 C;  1B41 B;  2MJ4 A;  4BDT B;  1IJC A;  1FFJ A;  2PJY B;  2HLR A;  2H64 C;  1MAH F;  2CCX A;  2MFA A;  3NEQ A;  1LXG A;  1ONJ A;  2QC1 A;  1CDQ A;  2J8B A;  2BHI A;  1HC9 A;  2JVE A; 
#chains in the Genus database with same CATH homology
 2X8B B;  5EBX A;  4KSN A;  1TGX A;  4IYE A;  3EBX A;  4RUD A;  4EY8 B;  3KFD E;  1NTN A;  3KFD I;  1KXI A;  1FSS B;  1TXA A;  2N99 A;  2QJA C;  1UG4 A;  1KTZ B;  2LCR A;  1IKC A;  1IQ9 A;  1FRA A;  2VLW A;  2L5S A;  4OM5 A;  5DZ5 A;  3NDS A;  1CXO A;  4UY2 C;  3U74 U;  2PJY C;  1PLO A;  2H5F A;  1CB9 A;  3BT2 U;  1FAS A;  2FD6 U;  2K3G A;  2MJ0 A;  1FSC A;  2UWR A;  1CRE A;  1ES7 B;  1LJZ A;  1NEA A;  1RGJ A;  1FF4 A;  2CDX A;  4FAO E;  1LX5 B;  1M9Z A;  1LXH A;  3NH7 A;  4HQP F;  1NTX A;  1BTE A;  1KBT A;  3QB4 B;  2JQP A;  1RL5 A;  2H62 D;  1TXB A;  2MHY A;  1NYS A;  1HC9 B;  1JGK A;  1NYU A;  1QKD A;  1CRF A;  1KU6 B;  1W6B A;  2NBT A;  4QTI U;  1COE A;  2L03 A;  1IDG A;  1CHV S;  1CCQ A;  3U73 U;  2MUO A;  4FAO C;  5IMY C;  1QM7 A;  1KBS A;  1ERG A;  2H8U A;  1IDH A;  4BIK B;  1LSI A;  1KBA A;  1H0J A;  1REW C;  1KS6 A;  2ERA A;  2UX2 A;  4LFT A;  1KC4 A;  2CTX A;  1HOY A;  4ZQY A;  1QKE A;  4DO8 A;  1JE9 A;  1F8U B;  1YWH A;  2CRS A;  1COD A;  3HH7 A;  2MJY A;  2HLQ A;  1BXP A;  1V6P A;  2GOO C;  5DU1 A;  1ZAD A;  1KL8 A;  1HAJ A;  1ABT A;  1VB0 A;  2GOO B;  1IDL A;  2I9B E;  1L4W A;  3EVS C;  1CDS A;  1MR6 A;  1S4Y A;  1XT3 A;  1JBD A;  1IDI A;  3ERA A;  2H64 B;  2H7Z A;  1CVO A;  3BT1 U;  3FEV A;  1NXB A;  6EBX A;  1CDT A;  1CDR A;  1F94 A;  2BTX A;  3LAQ U;  2QJB C;  2H62 C;  2OFS A;  5DO6 A;  1CTX A;  1I02 A;  1DRS A;  1KFH A;  3PLC A;  2MUP A;  4XJJ A;  5IMT D;  1HAA A;  1NOR A;  2H7Z B;  1ERA A;  4P7U A;  1CXN A;  1G6M A;  2LA1 A;  3VTS A;  4OM4 A;  1IK8 A;  2CRT A;  4AEA A;  2ABX A;  1TFS A;  2QJ9 C;  1B41 B;  2MJ4 A;  4BDT B;  1IJC A;  1FFJ A;  2PJY B;  2HLR A;  2H64 C;  1MAH F;  2CCX A;  2MFA A;  3NEQ A;  1LXG A;  1ONJ A;  2QC1 A;  1CDQ A;  2J8B A;  2BHI A;  1HC9 A;  2JVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...