2H7ZB

Crystal structure of irditoxin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
QAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Irditoxin subunit A
publication title Irditoxin, a novel covalently linked heterodimeric three-finger toxin with high taxon-specific neurotoxicity.
pubmed doi rcsb
total genus 14
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h7zB00
2MUPA 1NYUA 5EBXA 1HOYA 1TXBA 2QJ9C 3U74U 2MJYA 2VLWA 1FRAA 2MFAA 5IMTD 2QC1A 4EY8B 1HC9A 1KL8A 4BDTB 1IDHA 1TGXA 5IMYC 1ONJA 4QTIU 1CDTA 4XJJA 1CDRA 3HH7A 4AEAA 1IKCA 1KXIA 1NXBA 2X8BB 2CTXA 1RGJA 2QJAC 3LAQU 1QKDA 3U73U 2H5FA 1KBAA 1ERAA 2H64C 3VTSA 1CTXA 1FFJA 1HC9B 1IDGA 2ABXA 2H62D 1JE9A 3NH7A 1KTZB 1ERGA 2CDXA 1CB9A 1B41B 3EVSC 1NORA 1CXOA 1UG4A 1G6MA 1IK8A 2JVEA 4IYEA 1BXPA 1CODA 1RL5A 1CDSA 1V6PA 3PLCA 1S4YA 2LCRA 2PJYC 1PLOA 3KFDE 2HLQA 1LXHA 1KC4A 2CCXA 2H64B 1TFSA 1HAAA 3BT2U 4LFTA 2UWRA 1QKEA 1CVOA 2UX2A 1F94A 6EBXA 1M9ZA 2GOOB 1HAJA 1L4WA 1JBDA 4BIKB 2BHIA 1LSIA 2ERAA 4HQPF 2LA1A 3ERAA 2CRSA 2OFSA 1NTXA 1KBSA 1TXAA 1CDQA 5DZ5A 3BT1U 2PJYB 2QJBC 1FSCA 1H0JA 2H7ZA 1QM7A 2N99A 2MHYA 1CRFA 4ZQYA 3NEQA 5DO6A 2JQPA 1DRSA 4FAOC 2CRTA 1F8UB 2I9BE 2NBTA 1NYSA 1COEA 1CXNA 1CCQA 1ZADA 1YWHA 4RUDA 1KS6A 1KU6B 2H7ZB 1FF4A 3EBXA 1I02A 1NTNA 2L5SA 1IDIA 2MJ4A 1CHVS 1LXGA 1VB0A 1LX5B 4FAOE 1LJZA 1IJCA 2BTXA 2HLRA 2J8BA 2MJ0A 4OM5A 1MAHF 1JGKA 1CREA 4DO8A 1IQ9A 1XT3A 1FSSB 1NEAA 3FEVA 1ES7B 1KFHA 2H62C 2K3GA 4OM4A 2H8UA 3QB4B 1BTEA 1FASA 1REWC 1ABTA 1KBTA 4UY2C 3NDSA 2GOOC 5DU1A 1W6BA 2L03A 1IDLA 2MUOA 3KFDI 4P7UA 2FD6U 1MR6A
chains in the Genus database with same CATH superfamily
2MUPA 1NYUA 5EBXA 1HOYA 1TXBA 2QJ9C 3U74U 2MJYA 2VLWA 1FRAA 2MFAA 5IMTD 2QC1A 4EY8B 1HC9A 1KL8A 4BDTB 1IDHA 1TGXA 5IMYC 1ONJA 4QTIU 1CDTA 4XJJA 1CDRA 3HH7A 4AEAA 1IKCA 1KXIA 1NXBA 2X8BB 2CTXA 1RGJA 2QJAC 3LAQU 1QKDA 3U73U 2H5FA 1KBAA 1ERAA 2H64C 3VTSA 1CTXA 1FFJA 1HC9B 1IDGA 2ABXA 2H62D 1JE9A 3NH7A 1KTZB 1ERGA 2CDXA 1CB9A 1B41B 3EVSC 1NORA 1CXOA 1UG4A 1G6MA 1IK8A 2JVEA 4IYEA 1BXPA 1CODA 1RL5A 1CDSA 1V6PA 3PLCA 1S4YA 2LCRA 2PJYC 1PLOA 3KFDE 2HLQA 1LXHA 1KC4A 2CCXA 2H64B 1TFSA 1HAAA 3BT2U 4LFTA 2UWRA 1QKEA 1CVOA 2UX2A 1F94A 6EBXA 1M9ZA 2GOOB 1HAJA 1L4WA 1JBDA 4BIKB 2BHIA 1LSIA 2ERAA 4HQPF 2LA1A 3ERAA 2CRSA 2OFSA 1NTXA 1KBSA 1TXAA 1CDQA 5DZ5A 3BT1U 4KSNA 2PJYB 2QJBC 1FSCA 1H0JA 2H7ZA 1QM7A 2N99A 2MHYA 1CRFA 4ZQYA 3NEQA 5DO6A 2JQPA 1DRSA 4FAOC 2CRTA 1F8UB 2I9BE 2NBTA 1NYSA 1COEA 1CXNA 1CCQA 1ZADA 1YWHA 4RUDA 1KS6A 1KU6B 2H7ZB 1FF4A 3EBXA 1I02A 1NTNA 2L5SA 1IDIA 2MJ4A 1CHVS 1LXGA 1VB0A 1LX5B 4FAOE 1LJZA 1IJCA 2BTXA 2HLRA 2J8BA 2MJ0A 4OM5A 1MAHF 1JGKA 1CREA 4DO8A 1IQ9A 1XT3A 1FSSB 1NEAA 3FEVA 1ES7B 1KFHA 2H62C 2K3GA 4OM4A 2H8UA 3QB4B 1BTEA 1FASA 1REWC 1ABTA 1KBTA 4UY2C 3NDSA 2GOOC 5DU1A 1W6BA 2L03A 1IDLA 2MUOA 3KFDI 4P7UA 2FD6U 1MR6A
chains in the Genus database with same CATH topology
2MUPA 1NYUA 5EBXA 1HOYA 1TXBA 2QJ9C 3U74U 2MJYA 2VLWA 1FRAA 2MFAA 5IMTD 2QC1A 4EY8B 1HC9A 1KL8A 4BDTB 1IDHA 1TGXA 5IMYC 1ONJA 4QTIU 1CDTA 4XJJA 1CDRA 3HH7A 4AEAA 1IKCA 1KXIA 1NXBA 2X8BB 2CTXA 1RGJA 2QJAC 3LAQU 1QKDA 3U73U 2H5FA 1KBAA 1ERAA 2H64C 3VTSA 1CTXA 1FFJA 1HC9B 1IDGA 2ABXA 2H62D 1JE9A 3NH7A 1KTZB 1ERGA 2CDXA 1CB9A 1B41B 3EVSC 1NORA 1CXOA 1UG4A 1G6MA 1IK8A 2JVEA 4IYEA 1BXPA 1CODA 1RL5A 1CDSA 1V6PA 3PLCA 1S4YA 2LCRA 2PJYC 1PLOA 3KFDE 2HLQA 1LXHA 1KC4A 2CCXA 2H64B 1TFSA 1HAAA 3BT2U 4LFTA 2UWRA 1QKEA 1CVOA 2UX2A 1F94A 6EBXA 1M9ZA 2GOOB 1HAJA 1L4WA 1JBDA 4BIKB 2BHIA 1LSIA 2ERAA 4HQPF 2LA1A 3ERAA 2CRSA 2OFSA 1NTXA 1KBSA 1TXAA 1CDQA 5DZ5A 3BT1U 4KSNA 2PJYB 2QJBC 1FSCA 1H0JA 2H7ZA 1QM7A 2N99A 2MHYA 1CRFA 4ZQYA 3NEQA 5DO6A 2JQPA 1DRSA 4FAOC 2CRTA 1F8UB 2I9BE 2NBTA 1NYSA 1COEA 1CXNA 1CCQA 1ZADA 1YWHA 4RUDA 1KS6A 1KU6B 2H7ZB 1FF4A 3EBXA 1I02A 1NTNA 2L5SA 1IDIA 2MJ4A 1CHVS 1LXGA 1VB0A 1LX5B 4FAOE 1LJZA 1IJCA 2BTXA 2HLRA 2J8BA 2MJ0A 4OM5A 1MAHF 1JGKA 1CREA 4DO8A 1IQ9A 1XT3A 1FSSB 1NEAA 3FEVA 1ES7B 1KFHA 2H62C 2K3GA 4OM4A 2H8UA 3QB4B 1BTEA 1FASA 1REWC 1ABTA 1KBTA 4UY2C 3NDSA 2GOOC 5DU1A 1W6BA 2L03A 1IDLA 2MUOA 3KFDI 4P7UA 2FD6U 1MR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUP A;  1NYU A;  5EBX A;  1HOY A;  1TXB A;  2QJ9 C;  3U74 U;  2MJY A;  2VLW A;  1FRA A;  2MFA A;  5IMT D;  2QC1 A;  4EY8 B;  1HC9 A;  1KL8 A;  4BDT B;  1IDH A;  1TGX A;  5IMY C;  1ONJ A;  4QTI U;  1CDT A;  4XJJ A;  1CDR A;  3HH7 A;  4AEA A;  1IKC A;  1KXI A;  1NXB A;  2X8B B;  2CTX A;  1RGJ A;  2QJA C;  3LAQ U;  1QKD A;  3U73 U;  2H5F A;  1KBA A;  1ERA A;  2H64 C;  3VTS A;  1CTX A;  1FFJ A;  1HC9 B;  1IDG A;  2ABX A;  2H62 D;  1JE9 A;  3NH7 A;  1KTZ B;  1ERG A;  2CDX A;  1CB9 A;  1B41 B;  3EVS C;  1NOR A;  1CXO A;  1UG4 A;  1G6M A;  1IK8 A;  2JVE A;  4IYE A;  1BXP A;  1COD A;  1RL5 A;  1CDS A;  1V6P A;  3PLC A;  1S4Y A;  2LCR A;  2PJY C;  1PLO A;  3KFD E;  2HLQ A;  1LXH A;  1KC4 A;  2CCX A;  2H64 B;  1TFS A;  1HAA A;  3BT2 U;  4LFT A;  2UWR A;  1QKE A;  1CVO A;  2UX2 A;  1F94 A;  6EBX A;  1M9Z A;  2GOO B;  1HAJ A;  1L4W A;  1JBD A;  4BIK B;  2BHI A;  1LSI A;  2ERA A;  4HQP F;  2LA1 A;  3ERA A;  2CRS A;  2OFS A;  1NTX A;  1KBS A;  1TXA A;  1CDQ A;  5DZ5 A;  3BT1 U;  2PJY B;  2QJB C;  1FSC A;  1H0J A;  2H7Z A;  1QM7 A;  2N99 A;  2MHY A;  1CRF A;  4ZQY A;  3NEQ A;  5DO6 A;  2JQP A;  1DRS A;  4FAO C;  2CRT A;  1F8U B;  2I9B E;  2NBT A;  1NYS A;  1COE A;  1CXN A;  1CCQ A;  1ZAD A;  1YWH A;  4RUD A;  1KS6 A;  1KU6 B;  2H7Z B;  1FF4 A;  3EBX A;  1I02 A;  1NTN A;  2L5S A;  1IDI A;  2MJ4 A;  1CHV S;  1LXG A;  1VB0 A;  1LX5 B;  4FAO E;  1LJZ A;  1IJC A;  2BTX A;  2HLR A;  2J8B A;  2MJ0 A;  4OM5 A;  1MAH F;  1JGK A;  1CRE A;  4DO8 A;  1IQ9 A;  1XT3 A;  1FSS B;  1NEA A;  3FEV A;  1ES7 B;  1KFH A;  2H62 C;  2K3G A;  4OM4 A;  2H8U A;  3QB4 B;  1BTE A;  1FAS A;  1REW C;  1ABT A;  1KBT A;  4UY2 C;  3NDS A;  2GOO C;  5DU1 A;  1W6B A;  2L03 A;  1IDL A;  2MUO A;  3KFD I;  4P7U A;  2FD6 U;  1MR6 A; 
#chains in the Genus database with same CATH topology
 2MUP A;  1NYU A;  5EBX A;  1HOY A;  1TXB A;  2QJ9 C;  3U74 U;  2MJY A;  2VLW A;  1FRA A;  2MFA A;  5IMT D;  2QC1 A;  4EY8 B;  1HC9 A;  1KL8 A;  4BDT B;  1IDH A;  1TGX A;  5IMY C;  1ONJ A;  4QTI U;  1CDT A;  4XJJ A;  1CDR A;  3HH7 A;  4AEA A;  1IKC A;  1KXI A;  1NXB A;  2X8B B;  2CTX A;  1RGJ A;  2QJA C;  3LAQ U;  1QKD A;  3U73 U;  2H5F A;  1KBA A;  1ERA A;  2H64 C;  3VTS A;  1CTX A;  1FFJ A;  1HC9 B;  1IDG A;  2ABX A;  2H62 D;  1JE9 A;  3NH7 A;  1KTZ B;  1ERG A;  2CDX A;  1CB9 A;  1B41 B;  3EVS C;  1NOR A;  1CXO A;  1UG4 A;  1G6M A;  1IK8 A;  2JVE A;  4IYE A;  1BXP A;  1COD A;  1RL5 A;  1CDS A;  1V6P A;  3PLC A;  1S4Y A;  2LCR A;  2PJY C;  1PLO A;  3KFD E;  2HLQ A;  1LXH A;  1KC4 A;  2CCX A;  2H64 B;  1TFS A;  1HAA A;  3BT2 U;  4LFT A;  2UWR A;  1QKE A;  1CVO A;  2UX2 A;  1F94 A;  6EBX A;  1M9Z A;  2GOO B;  1HAJ A;  1L4W A;  1JBD A;  4BIK B;  2BHI A;  1LSI A;  2ERA A;  4HQP F;  2LA1 A;  3ERA A;  2CRS A;  2OFS A;  1NTX A;  1KBS A;  1TXA A;  1CDQ A;  5DZ5 A;  3BT1 U;  4KSN A;  2PJY B;  2QJB C;  1FSC A;  1H0J A;  2H7Z A;  1QM7 A;  2N99 A;  2MHY A;  1CRF A;  4ZQY A;  3NEQ A;  5DO6 A;  2JQP A;  1DRS A;  4FAO C;  2CRT A;  1F8U B;  2I9B E;  2NBT A;  1NYS A;  1COE A;  1CXN A;  1CCQ A;  1ZAD A;  1YWH A;  4RUD A;  1KS6 A;  1KU6 B;  2H7Z B;  1FF4 A;  3EBX A;  1I02 A;  1NTN A;  2L5S A;  1IDI A;  2MJ4 A;  1CHV S;  1LXG A;  1VB0 A;  1LX5 B;  4FAO E;  1LJZ A;  1IJC A;  2BTX A;  2HLR A;  2J8B A;  2MJ0 A;  4OM5 A;  1MAH F;  1JGK A;  1CRE A;  4DO8 A;  1IQ9 A;  1XT3 A;  1FSS B;  1NEA A;  3FEV A;  1ES7 B;  1KFH A;  2H62 C;  2K3G A;  4OM4 A;  2H8U A;  3QB4 B;  1BTE A;  1FAS A;  1REW C;  1ABT A;  1KBT A;  4UY2 C;  3NDS A;  2GOO C;  5DU1 A;  1W6B A;  2L03 A;  1IDL A;  2MUO A;  3KFD I;  4P7U A;  2FD6 U;  1MR6 A; 
#chains in the Genus database with same CATH homology
 2MUP A;  1NYU A;  5EBX A;  1HOY A;  1TXB A;  2QJ9 C;  3U74 U;  2MJY A;  2VLW A;  1FRA A;  2MFA A;  5IMT D;  2QC1 A;  4EY8 B;  1HC9 A;  1KL8 A;  4BDT B;  1IDH A;  1TGX A;  5IMY C;  1ONJ A;  4QTI U;  1CDT A;  4XJJ A;  1CDR A;  3HH7 A;  4AEA A;  1IKC A;  1KXI A;  1NXB A;  2X8B B;  2CTX A;  1RGJ A;  2QJA C;  3LAQ U;  1QKD A;  3U73 U;  2H5F A;  1KBA A;  1ERA A;  2H64 C;  3VTS A;  1CTX A;  1FFJ A;  1HC9 B;  1IDG A;  2ABX A;  2H62 D;  1JE9 A;  3NH7 A;  1KTZ B;  1ERG A;  2CDX A;  1CB9 A;  1B41 B;  3EVS C;  1NOR A;  1CXO A;  1UG4 A;  1G6M A;  1IK8 A;  2JVE A;  4IYE A;  1BXP A;  1COD A;  1RL5 A;  1CDS A;  1V6P A;  3PLC A;  1S4Y A;  2LCR A;  2PJY C;  1PLO A;  3KFD E;  2HLQ A;  1LXH A;  1KC4 A;  2CCX A;  2H64 B;  1TFS A;  1HAA A;  3BT2 U;  4LFT A;  2UWR A;  1QKE A;  1CVO A;  2UX2 A;  1F94 A;  6EBX A;  1M9Z A;  2GOO B;  1HAJ A;  1L4W A;  1JBD A;  4BIK B;  2BHI A;  1LSI A;  2ERA A;  4HQP F;  2LA1 A;  3ERA A;  2CRS A;  2OFS A;  1NTX A;  1KBS A;  1TXA A;  1CDQ A;  5DZ5 A;  3BT1 U;  4KSN A;  2PJY B;  2QJB C;  1FSC A;  1H0J A;  2H7Z A;  1QM7 A;  2N99 A;  2MHY A;  1CRF A;  4ZQY A;  3NEQ A;  5DO6 A;  2JQP A;  1DRS A;  4FAO C;  2CRT A;  1F8U B;  2I9B E;  2NBT A;  1NYS A;  1COE A;  1CXN A;  1CCQ A;  1ZAD A;  1YWH A;  4RUD A;  1KS6 A;  1KU6 B;  2H7Z B;  1FF4 A;  3EBX A;  1I02 A;  1NTN A;  2L5S A;  1IDI A;  2MJ4 A;  1CHV S;  1LXG A;  1VB0 A;  1LX5 B;  4FAO E;  1LJZ A;  1IJC A;  2BTX A;  2HLR A;  2J8B A;  2MJ0 A;  4OM5 A;  1MAH F;  1JGK A;  1CRE A;  4DO8 A;  1IQ9 A;  1XT3 A;  1FSS B;  1NEA A;  3FEV A;  1ES7 B;  1KFH A;  2H62 C;  2K3G A;  4OM4 A;  2H8U A;  3QB4 B;  1BTE A;  1FAS A;  1REW C;  1ABT A;  1KBT A;  4UY2 C;  3NDS A;  2GOO C;  5DU1 A;  1W6B A;  2L03 A;  1IDL A;  2MUO A;  3KFD I;  4P7U A;  2FD6 U;  1MR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...