2H7ZB

Crystal structure of irditoxin
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
77
Chain Sequence
QAKGPPYTLCFECNRETCSNCFKDNRCPPYHRTCYTLYRPDGNGEMKWAVKGCAKTCPTAQPGESVQCCNTPKCNDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Irditoxin, a novel covalently linked heterodimeric three-finger toxin with high taxon-specific neurotoxicity.
pubmed doi rcsb
molecule tags Toxin
molecule keywords Irditoxin subunit A
total genus 14
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2006-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h7zB00
1PLOA 2H62C 2H7ZA 1CCQA 1BTEA 5DZ5A 2L03A 1CODA 1B41B 1CXNA 2QJBC 3NDSA 3KFDI 4FAOC 1RGJA 2I9BE 1NORA 1KBTA 3HH7A 1F8UB 1ERGA 3BT1U 1M9ZA 1XT3A 1KC4A 1FASA 4IYEA 3U73U 2LCRA 4BIKB 5IMYC 3EBXA 5DO6A 1DRSA 1NTXA 1NTNA 1IDLA 1NYSA 1CDTA 1HC9B 2GOOB 4BDTB 1KU6B 5IMTD 1TGXA 1CDQA 1KBSA 3LAQU 4P7UA 1ERAA 2H7ZB 2QC1A 1FRAA 2JQPA 2QJ9C 1LJZA 1KXIA 2GOOC 4EY8B 5EBXA 1JBDA 2NBTA 2BHIA 1FSSB 2UWRA 1CVOA 1NXBA 2PJYC 6EBXA 1IKCA 4DO8A 2PJYB 1LXHA 1KTZB 1NEAA 1MAHF 2CRSA 4OM5A 1CHVS 1IJCA 2FD6U 2MJ4A 1IK8A 2CCXA 1LXGA 1KFHA 1ZADA 3EVSC 1ABTA 1IQ9A 3NH7A 1TXAA 3ERAA 4RUDA 2ERAA 2MJ0A 3BT2U 4OM4A 1FSCA 1HC9A 1YWHA 1BXPA 1JGKA 2L5SA 4LFTA 1G6MA 5DU1A 1I02A 1ES7B 2X8BB 1QKDA 1QM7A 1ONJA 2HLRA 4HQPF 1CRFA 1CDSA 3NEQA 1KL8A 2JVEA 2UX2A 1S4YA 1HOYA 1TXBA 2H8UA 2OFSA 1RL5A 2ABXA 4QTIU 2VLWA 1FFJA 1L4WA 2HLQA 2MFAA 1FF4A 2K3GA 1IDIA 1REWC 3PLCA 2MUOA 2CDXA 3VTSA 1LSIA 2H62D 2J8BA 1H0JA 1UG4A 3QB4B 1HAJA 1COEA 4XJJA 1CREA 1TFSA 4ZQYA 1NYUA 1CDRA 2BTXA 2MJYA 3U74U 1KS6A 2H64C 1CXOA 4AEAA 2MUPA 2H64B 4UY2C 2LA1A 1MR6A 2CRTA 1F94A 2MHYA 1QKEA 1CTXA 1JE9A 2QJAC 4FAOE 1CB9A 2N99A 1IDHA 1LX5B 1KBAA 3FEVA 1IDGA 2H5FA 1V6PA 1HAAA 2CTXA 1W6BA 3KFDE 1VB0A
chains in the Genus database with same CATH superfamily
1PLOA 2H62C 2H7ZA 1CCQA 1BTEA 5DZ5A 2L03A 1CODA 1B41B 1CXNA 2QJBC 3NDSA 3KFDI 4FAOC 1RGJA 2I9BE 1NORA 1KBTA 3HH7A 1F8UB 1ERGA 3BT1U 1M9ZA 1XT3A 1KC4A 1FASA 4IYEA 3U73U 2LCRA 4BIKB 5IMYC 3EBXA 5DO6A 1DRSA 1NTXA 1NTNA 1IDLA 1NYSA 1CDTA 1HC9B 2GOOB 4BDTB 1KU6B 5IMTD 1TGXA 1CDQA 1KBSA 3LAQU 4P7UA 1ERAA 2H7ZB 2QC1A 1FRAA 2JQPA 2QJ9C 1LJZA 1KXIA 2GOOC 4EY8B 5EBXA 1JBDA 2NBTA 2BHIA 1FSSB 2UWRA 1CVOA 1NXBA 2PJYC 6EBXA 1IKCA 4DO8A 2PJYB 1LXHA 1KTZB 1NEAA 1MAHF 2CRSA 4OM5A 1CHVS 1IJCA 2FD6U 2MJ4A 1IK8A 2CCXA 1LXGA 1KFHA 1ZADA 3EVSC 1ABTA 1IQ9A 3NH7A 1TXAA 3ERAA 4RUDA 2ERAA 2MJ0A 3BT2U 4OM4A 1FSCA 1HC9A 1YWHA 1BXPA 1JGKA 2L5SA 4LFTA 1G6MA 5DU1A 1I02A 1ES7B 2X8BB 1QKDA 1QM7A 1ONJA 2HLRA 4HQPF 1CRFA 1CDSA 3NEQA 1KL8A 2JVEA 2UX2A 1S4YA 1HOYA 1TXBA 2H8UA 2OFSA 1RL5A 2ABXA 4QTIU 2VLWA 1FFJA 1L4WA 2HLQA 2MFAA 1FF4A 2K3GA 1IDIA 1REWC 3PLCA 2MUOA 2CDXA 3VTSA 1LSIA 2H62D 2J8BA 1H0JA 1UG4A 3QB4B 1HAJA 1COEA 4XJJA 1CREA 1TFSA 4ZQYA 1NYUA 1CDRA 2BTXA 2MJYA 3U74U 1KS6A 2H64C 1CXOA 4AEAA 2MUPA 2H64B 4UY2C 2LA1A 1MR6A 2CRTA 4KSNA 1F94A 2MHYA 1QKEA 1CTXA 1JE9A 2QJAC 4FAOE 1CB9A 2N99A 1IDHA 1LX5B 1KBAA 3FEVA 1IDGA 2H5FA 1V6PA 1HAAA 2CTXA 1W6BA 3KFDE 1VB0A
chains in the Genus database with same CATH topology
1PLOA 2H62C 2H7ZA 1CCQA 1BTEA 5DZ5A 2L03A 1CODA 1B41B 1CXNA 2QJBC 3NDSA 3KFDI 4FAOC 1RGJA 2I9BE 1NORA 1KBTA 3HH7A 1F8UB 1ERGA 3BT1U 1M9ZA 1XT3A 1KC4A 1FASA 4IYEA 3U73U 2LCRA 4BIKB 5IMYC 3EBXA 5DO6A 1DRSA 1NTXA 1NTNA 1IDLA 1NYSA 1CDTA 1HC9B 2GOOB 4BDTB 1KU6B 5IMTD 1TGXA 1CDQA 1KBSA 3LAQU 4P7UA 1ERAA 2H7ZB 2QC1A 1FRAA 2JQPA 2QJ9C 1LJZA 1KXIA 2GOOC 4EY8B 5EBXA 1JBDA 2NBTA 2BHIA 1FSSB 2UWRA 1CVOA 1NXBA 2PJYC 6EBXA 1IKCA 4DO8A 2PJYB 1LXHA 1KTZB 1NEAA 1MAHF 2CRSA 4OM5A 1CHVS 1IJCA 2FD6U 2MJ4A 1IK8A 2CCXA 1LXGA 1KFHA 1ZADA 3EVSC 1ABTA 1IQ9A 3NH7A 1TXAA 3ERAA 4RUDA 2ERAA 2MJ0A 3BT2U 4OM4A 1FSCA 1HC9A 1YWHA 1BXPA 1JGKA 2L5SA 4LFTA 1G6MA 5DU1A 1I02A 1ES7B 2X8BB 1QKDA 1QM7A 1ONJA 2HLRA 4HQPF 1CRFA 1CDSA 3NEQA 1KL8A 2JVEA 2UX2A 1S4YA 1HOYA 1TXBA 2H8UA 2OFSA 1RL5A 2ABXA 4QTIU 2VLWA 1FFJA 1L4WA 2HLQA 2MFAA 1FF4A 2K3GA 1IDIA 1REWC 3PLCA 2MUOA 2CDXA 3VTSA 1LSIA 2H62D 2J8BA 1H0JA 1UG4A 3QB4B 1HAJA 1COEA 4XJJA 1CREA 1TFSA 4ZQYA 1NYUA 1CDRA 2BTXA 2MJYA 3U74U 1KS6A 2H64C 1CXOA 4AEAA 2MUPA 2H64B 4UY2C 2LA1A 1MR6A 2CRTA 4KSNA 1F94A 2MHYA 1QKEA 1CTXA 1JE9A 2QJAC 4FAOE 1CB9A 2N99A 1IDHA 1LX5B 1KBAA 3FEVA 1IDGA 2H5FA 1V6PA 1HAAA 2CTXA 1W6BA 3KFDE 1VB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PLO A;  2H62 C;  2H7Z A;  1CCQ A;  1BTE A;  5DZ5 A;  2L03 A;  1COD A;  1B41 B;  1CXN A;  2QJB C;  3NDS A;  3KFD I;  4FAO C;  1RGJ A;  2I9B E;  1NOR A;  1KBT A;  3HH7 A;  1F8U B;  1ERG A;  3BT1 U;  1M9Z A;  1XT3 A;  1KC4 A;  1FAS A;  4IYE A;  3U73 U;  2LCR A;  4BIK B;  5IMY C;  3EBX A;  5DO6 A;  1DRS A;  1NTX A;  1NTN A;  1IDL A;  1NYS A;  1CDT A;  1HC9 B;  2GOO B;  4BDT B;  1KU6 B;  5IMT D;  1TGX A;  1CDQ A;  1KBS A;  3LAQ U;  4P7U A;  1ERA A;  2H7Z B;  2QC1 A;  1FRA A;  2JQP A;  2QJ9 C;  1LJZ A;  1KXI A;  2GOO C;  4EY8 B;  5EBX A;  1JBD A;  2NBT A;  2BHI A;  1FSS B;  2UWR A;  1CVO A;  1NXB A;  2PJY C;  6EBX A;  1IKC A;  4DO8 A;  2PJY B;  1LXH A;  1KTZ B;  1NEA A;  1MAH F;  2CRS A;  4OM5 A;  1CHV S;  1IJC A;  2FD6 U;  2MJ4 A;  1IK8 A;  2CCX A;  1LXG A;  1KFH A;  1ZAD A;  3EVS C;  1ABT A;  1IQ9 A;  3NH7 A;  1TXA A;  3ERA A;  4RUD A;  2ERA A;  2MJ0 A;  3BT2 U;  4OM4 A;  1FSC A;  1HC9 A;  1YWH A;  1BXP A;  1JGK A;  2L5S A;  4LFT A;  1G6M A;  5DU1 A;  1I02 A;  1ES7 B;  2X8B B;  1QKD A;  1QM7 A;  1ONJ A;  2HLR A;  4HQP F;  1CRF A;  1CDS A;  3NEQ A;  1KL8 A;  2JVE A;  2UX2 A;  1S4Y A;  1HOY A;  1TXB A;  2H8U A;  2OFS A;  1RL5 A;  2ABX A;  4QTI U;  2VLW A;  1FFJ A;  1L4W A;  2HLQ A;  2MFA A;  1FF4 A;  2K3G A;  1IDI A;  1REW C;  3PLC A;  2MUO A;  2CDX A;  3VTS A;  1LSI A;  2H62 D;  2J8B A;  1H0J A;  1UG4 A;  3QB4 B;  1HAJ A;  1COE A;  4XJJ A;  1CRE A;  1TFS A;  4ZQY A;  1NYU A;  1CDR A;  2BTX A;  2MJY A;  3U74 U;  1KS6 A;  2H64 C;  1CXO A;  4AEA A;  2MUP A;  2H64 B;  4UY2 C;  2LA1 A;  1MR6 A;  2CRT A;  1F94 A;  2MHY A;  1QKE A;  1CTX A;  1JE9 A;  2QJA C;  4FAO E;  1CB9 A;  2N99 A;  1IDH A;  1LX5 B;  1KBA A;  3FEV A;  1IDG A;  2H5F A;  1V6P A;  1HAA A;  2CTX A;  1W6B A;  3KFD E;  1VB0 A; 
#chains in the Genus database with same CATH topology
 1PLO A;  2H62 C;  2H7Z A;  1CCQ A;  1BTE A;  5DZ5 A;  2L03 A;  1COD A;  1B41 B;  1CXN A;  2QJB C;  3NDS A;  3KFD I;  4FAO C;  1RGJ A;  2I9B E;  1NOR A;  1KBT A;  3HH7 A;  1F8U B;  1ERG A;  3BT1 U;  1M9Z A;  1XT3 A;  1KC4 A;  1FAS A;  4IYE A;  3U73 U;  2LCR A;  4BIK B;  5IMY C;  3EBX A;  5DO6 A;  1DRS A;  1NTX A;  1NTN A;  1IDL A;  1NYS A;  1CDT A;  1HC9 B;  2GOO B;  4BDT B;  1KU6 B;  5IMT D;  1TGX A;  1CDQ A;  1KBS A;  3LAQ U;  4P7U A;  1ERA A;  2H7Z B;  2QC1 A;  1FRA A;  2JQP A;  2QJ9 C;  1LJZ A;  1KXI A;  2GOO C;  4EY8 B;  5EBX A;  1JBD A;  2NBT A;  2BHI A;  1FSS B;  2UWR A;  1CVO A;  1NXB A;  2PJY C;  6EBX A;  1IKC A;  4DO8 A;  2PJY B;  1LXH A;  1KTZ B;  1NEA A;  1MAH F;  2CRS A;  4OM5 A;  1CHV S;  1IJC A;  2FD6 U;  2MJ4 A;  1IK8 A;  2CCX A;  1LXG A;  1KFH A;  1ZAD A;  3EVS C;  1ABT A;  1IQ9 A;  3NH7 A;  1TXA A;  3ERA A;  4RUD A;  2ERA A;  2MJ0 A;  3BT2 U;  4OM4 A;  1FSC A;  1HC9 A;  1YWH A;  1BXP A;  1JGK A;  2L5S A;  4LFT A;  1G6M A;  5DU1 A;  1I02 A;  1ES7 B;  2X8B B;  1QKD A;  1QM7 A;  1ONJ A;  2HLR A;  4HQP F;  1CRF A;  1CDS A;  3NEQ A;  1KL8 A;  2JVE A;  2UX2 A;  1S4Y A;  1HOY A;  1TXB A;  2H8U A;  2OFS A;  1RL5 A;  2ABX A;  4QTI U;  2VLW A;  1FFJ A;  1L4W A;  2HLQ A;  2MFA A;  1FF4 A;  2K3G A;  1IDI A;  1REW C;  3PLC A;  2MUO A;  2CDX A;  3VTS A;  1LSI A;  2H62 D;  2J8B A;  1H0J A;  1UG4 A;  3QB4 B;  1HAJ A;  1COE A;  4XJJ A;  1CRE A;  1TFS A;  4ZQY A;  1NYU A;  1CDR A;  2BTX A;  2MJY A;  3U74 U;  1KS6 A;  2H64 C;  1CXO A;  4AEA A;  2MUP A;  2H64 B;  4UY2 C;  2LA1 A;  1MR6 A;  2CRT A;  4KSN A;  1F94 A;  2MHY A;  1QKE A;  1CTX A;  1JE9 A;  2QJA C;  4FAO E;  1CB9 A;  2N99 A;  1IDH A;  1LX5 B;  1KBA A;  3FEV A;  1IDG A;  2H5F A;  1V6P A;  1HAA A;  2CTX A;  1W6B A;  3KFD E;  1VB0 A; 
#chains in the Genus database with same CATH homology
 1PLO A;  2H62 C;  2H7Z A;  1CCQ A;  1BTE A;  5DZ5 A;  2L03 A;  1COD A;  1B41 B;  1CXN A;  2QJB C;  3NDS A;  3KFD I;  4FAO C;  1RGJ A;  2I9B E;  1NOR A;  1KBT A;  3HH7 A;  1F8U B;  1ERG A;  3BT1 U;  1M9Z A;  1XT3 A;  1KC4 A;  1FAS A;  4IYE A;  3U73 U;  2LCR A;  4BIK B;  5IMY C;  3EBX A;  5DO6 A;  1DRS A;  1NTX A;  1NTN A;  1IDL A;  1NYS A;  1CDT A;  1HC9 B;  2GOO B;  4BDT B;  1KU6 B;  5IMT D;  1TGX A;  1CDQ A;  1KBS A;  3LAQ U;  4P7U A;  1ERA A;  2H7Z B;  2QC1 A;  1FRA A;  2JQP A;  2QJ9 C;  1LJZ A;  1KXI A;  2GOO C;  4EY8 B;  5EBX A;  1JBD A;  2NBT A;  2BHI A;  1FSS B;  2UWR A;  1CVO A;  1NXB A;  2PJY C;  6EBX A;  1IKC A;  4DO8 A;  2PJY B;  1LXH A;  1KTZ B;  1NEA A;  1MAH F;  2CRS A;  4OM5 A;  1CHV S;  1IJC A;  2FD6 U;  2MJ4 A;  1IK8 A;  2CCX A;  1LXG A;  1KFH A;  1ZAD A;  3EVS C;  1ABT A;  1IQ9 A;  3NH7 A;  1TXA A;  3ERA A;  4RUD A;  2ERA A;  2MJ0 A;  3BT2 U;  4OM4 A;  1FSC A;  1HC9 A;  1YWH A;  1BXP A;  1JGK A;  2L5S A;  4LFT A;  1G6M A;  5DU1 A;  1I02 A;  1ES7 B;  2X8B B;  1QKD A;  1QM7 A;  1ONJ A;  2HLR A;  4HQP F;  1CRF A;  1CDS A;  3NEQ A;  1KL8 A;  2JVE A;  2UX2 A;  1S4Y A;  1HOY A;  1TXB A;  2H8U A;  2OFS A;  1RL5 A;  2ABX A;  4QTI U;  2VLW A;  1FFJ A;  1L4W A;  2HLQ A;  2MFA A;  1FF4 A;  2K3G A;  1IDI A;  1REW C;  3PLC A;  2MUO A;  2CDX A;  3VTS A;  1LSI A;  2H62 D;  2J8B A;  1H0J A;  1UG4 A;  3QB4 B;  1HAJ A;  1COE A;  4XJJ A;  1CRE A;  1TFS A;  4ZQY A;  1NYU A;  1CDR A;  2BTX A;  2MJY A;  3U74 U;  1KS6 A;  2H64 C;  1CXO A;  4AEA A;  2MUP A;  2H64 B;  4UY2 C;  2LA1 A;  1MR6 A;  2CRT A;  4KSN A;  1F94 A;  2MHY A;  1QKE A;  1CTX A;  1JE9 A;  2QJA C;  4FAO E;  1CB9 A;  2N99 A;  1IDH A;  1LX5 B;  1KBA A;  3FEV A;  1IDG A;  2H5F A;  1V6P A;  1HAA A;  2CTX A;  1W6B A;  3KFD E;  1VB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...