2H62C

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
84
structure length
84
Chain Sequence
PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor
molecule keywords Bone morphogenetic protein 2
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h62C00
2I9BE 2N99A 3QB4B 1FRAA 1CXNA 4ZQYA 4FAOC 4XJJA 1XT3A 1TXAA 1L4WA 5DU1A 2CRTA 1ES7B 2MUPA 1CTXA 1KBSA 1CDQA 1FASA 4QTIU 2H7ZA 3NEQA 2QC1A 2FD6U 3U74U 4FAOE 1FSSB 1LSIA 1KBAA 4IYEA 5IMTD 1FF4A 1YWHA 2H64C 4P7UA 1HOYA 1HAJA 1CRFA 1UG4A 1CREA 1ZADA 1CXOA 1B41B 1LXGA 2GOOB 1V6PA 1KC4A 1NEAA 1IQ9A 1F8UB 2H64B 2CTXA 2X8BB 2CRSA 2BHIA 1CDSA 3HH7A 1CVOA 1ERAA 1QKDA 2LA1A 1CDRA 1F94A 4OM4A 1MAHF 1KTZB 4LFTA 1I02A 2QJBC 1NTXA 1LX5B 2H62D 1QKEA 3NH7A 2GOOC 2JQPA 1CODA 2JVEA 2CCXA 1NORA 1ONJA 2LCRA 2PJYC 2OFSA 5DO6A 4BDTB 1LXHA 3EBXA 6EBXA 1CDTA 1CHVS 5EBXA 1IDHA 1CCQA 1COEA 1NYSA 1JGKA 4DO8A 4HQPF 2UWRA 1MR6A 3NDSA 1HC9B 2BTXA 2MJYA 2J8BA 1IJCA 2PJYB 2L5SA 1HC9A 1IKCA 1ERGA 1W6BA 1H0JA 2UX2A 5DZ5A 2MHYA 1KBTA 1HAAA 2QJAC 2MFAA 2VLWA 1VB0A 1RL5A 2H8UA 3KFDE 1ABTA 2HLQA 2HLRA 1KU6B 1DRSA 1NTNA 1FSCA 1G6MA 3PLCA 1RGJA 4EY8B 1NYUA 3VTSA 2QJ9C 1TGXA 3ERAA 1KFHA 1TFSA 3BT2U 3U73U 3FEVA 4UY2C 1KL8A 1KS6A 1QM7A 3EVSC 4RUDA 1LJZA 4OM5A 1IDGA 1KXIA 2H62C 2L03A 2MUOA 2ABXA 2CDXA 1IK8A 2H7ZB 1BTEA 1M9ZA 1FFJA 2MJ4A 1PLOA 1REWC 1IDLA 1CB9A 3KFDI 3LAQU 2ERAA 2H5FA 1IDIA 2K3GA 1S4YA 5IMYC 1JBDA 4AEAA 1BXPA 4BIKB 1JE9A 3BT1U 2MJ0A 1NXBA 2NBTA 1TXBA
chains in the Genus database with same CATH superfamily
2I9BE 2N99A 3QB4B 1FRAA 1CXNA 4ZQYA 4FAOC 4KSNA 4XJJA 1XT3A 1TXAA 1L4WA 5DU1A 2CRTA 1ES7B 2MUPA 1CTXA 1KBSA 1CDQA 1FASA 4QTIU 2H7ZA 3NEQA 2QC1A 2FD6U 3U74U 4FAOE 1FSSB 1LSIA 1KBAA 4IYEA 5IMTD 1FF4A 1YWHA 2H64C 4P7UA 1HOYA 1HAJA 1CRFA 1UG4A 1CREA 1ZADA 1CXOA 1B41B 1LXGA 2GOOB 1V6PA 1KC4A 1NEAA 1IQ9A 1F8UB 2H64B 2CTXA 2X8BB 2CRSA 2BHIA 1CDSA 3HH7A 1CVOA 1ERAA 1QKDA 2LA1A 1CDRA 1F94A 4OM4A 1MAHF 1KTZB 4LFTA 1I02A 2QJBC 1NTXA 1LX5B 2H62D 1QKEA 3NH7A 2GOOC 2JQPA 1CODA 2JVEA 2CCXA 1NORA 1ONJA 2LCRA 2PJYC 2OFSA 5DO6A 4BDTB 1LXHA 3EBXA 6EBXA 1CDTA 1CHVS 5EBXA 1IDHA 1CCQA 1COEA 1NYSA 1JGKA 4DO8A 4HQPF 2UWRA 1MR6A 3NDSA 1HC9B 2BTXA 2MJYA 2J8BA 1IJCA 2PJYB 2L5SA 1HC9A 1IKCA 1ERGA 1W6BA 1H0JA 2UX2A 5DZ5A 2MHYA 1KBTA 1HAAA 2QJAC 2MFAA 2VLWA 1VB0A 1RL5A 2H8UA 3KFDE 1ABTA 2HLQA 2HLRA 1KU6B 1DRSA 1NTNA 1FSCA 1G6MA 3PLCA 1RGJA 4EY8B 1NYUA 3VTSA 2QJ9C 1TGXA 3ERAA 1KFHA 1TFSA 3BT2U 3U73U 3FEVA 4UY2C 1KL8A 1KS6A 1QM7A 3EVSC 4RUDA 1LJZA 4OM5A 1IDGA 1KXIA 2H62C 2L03A 2MUOA 2ABXA 2CDXA 1IK8A 2H7ZB 1BTEA 1M9ZA 1FFJA 2MJ4A 1PLOA 1REWC 1IDLA 1CB9A 3KFDI 3LAQU 2ERAA 2H5FA 1IDIA 2K3GA 1S4YA 5IMYC 1JBDA 4AEAA 1BXPA 4BIKB 1JE9A 3BT1U 2MJ0A 1NXBA 2NBTA 1TXBA
chains in the Genus database with same CATH topology
2I9BE 2N99A 3QB4B 1FRAA 1CXNA 4ZQYA 4FAOC 4KSNA 4XJJA 1XT3A 1TXAA 1L4WA 5DU1A 2CRTA 1ES7B 2MUPA 1CTXA 1KBSA 1CDQA 1FASA 4QTIU 2H7ZA 3NEQA 2QC1A 2FD6U 3U74U 4FAOE 1FSSB 1LSIA 1KBAA 4IYEA 5IMTD 1FF4A 1YWHA 2H64C 4P7UA 1HOYA 1HAJA 1CRFA 1UG4A 1CREA 1ZADA 1CXOA 1B41B 1LXGA 2GOOB 1V6PA 1KC4A 1NEAA 1IQ9A 1F8UB 2H64B 2CTXA 2X8BB 2CRSA 2BHIA 1CDSA 3HH7A 1CVOA 1ERAA 1QKDA 2LA1A 1CDRA 1F94A 4OM4A 1MAHF 1KTZB 4LFTA 1I02A 2QJBC 1NTXA 1LX5B 2H62D 1QKEA 3NH7A 2GOOC 2JQPA 1CODA 2JVEA 2CCXA 1NORA 1ONJA 2LCRA 2PJYC 2OFSA 5DO6A 4BDTB 1LXHA 3EBXA 6EBXA 1CDTA 1CHVS 5EBXA 1IDHA 1CCQA 1COEA 1NYSA 1JGKA 4DO8A 4HQPF 2UWRA 1MR6A 3NDSA 1HC9B 2BTXA 2MJYA 2J8BA 1IJCA 2PJYB 2L5SA 1HC9A 1IKCA 1ERGA 1W6BA 1H0JA 2UX2A 5DZ5A 2MHYA 1KBTA 1HAAA 2QJAC 2MFAA 2VLWA 1VB0A 1RL5A 2H8UA 3KFDE 1ABTA 2HLQA 2HLRA 1KU6B 1DRSA 1NTNA 1FSCA 1G6MA 3PLCA 1RGJA 4EY8B 1NYUA 3VTSA 2QJ9C 1TGXA 3ERAA 1KFHA 1TFSA 3BT2U 3U73U 3FEVA 4UY2C 1KL8A 1KS6A 1QM7A 3EVSC 4RUDA 1LJZA 4OM5A 1IDGA 1KXIA 2H62C 2L03A 2MUOA 2ABXA 2CDXA 1IK8A 2H7ZB 1BTEA 1M9ZA 1FFJA 2MJ4A 1PLOA 1REWC 1IDLA 1CB9A 3KFDI 3LAQU 2ERAA 2H5FA 1IDIA 2K3GA 1S4YA 5IMYC 1JBDA 4AEAA 1BXPA 4BIKB 1JE9A 3BT1U 2MJ0A 1NXBA 2NBTA 1TXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I9B E;  2N99 A;  3QB4 B;  1FRA A;  1CXN A;  4ZQY A;  4FAO C;  4XJJ A;  1XT3 A;  1TXA A;  1L4W A;  5DU1 A;  2CRT A;  1ES7 B;  2MUP A;  1CTX A;  1KBS A;  1CDQ A;  1FAS A;  4QTI U;  2H7Z A;  3NEQ A;  2QC1 A;  2FD6 U;  3U74 U;  4FAO E;  1FSS B;  1LSI A;  1KBA A;  4IYE A;  5IMT D;  1FF4 A;  1YWH A;  2H64 C;  4P7U A;  1HOY A;  1HAJ A;  1CRF A;  1UG4 A;  1CRE A;  1ZAD A;  1CXO A;  1B41 B;  1LXG A;  2GOO B;  1V6P A;  1KC4 A;  1NEA A;  1IQ9 A;  1F8U B;  2H64 B;  2CTX A;  2X8B B;  2CRS A;  2BHI A;  1CDS A;  3HH7 A;  1CVO A;  1ERA A;  1QKD A;  2LA1 A;  1CDR A;  1F94 A;  4OM4 A;  1MAH F;  1KTZ B;  4LFT A;  1I02 A;  2QJB C;  1NTX A;  1LX5 B;  2H62 D;  1QKE A;  3NH7 A;  2GOO C;  2JQP A;  1COD A;  2JVE A;  2CCX A;  1NOR A;  1ONJ A;  2LCR A;  2PJY C;  2OFS A;  5DO6 A;  4BDT B;  1LXH A;  3EBX A;  6EBX A;  1CDT A;  1CHV S;  5EBX A;  1IDH A;  1CCQ A;  1COE A;  1NYS A;  1JGK A;  4DO8 A;  4HQP F;  2UWR A;  1MR6 A;  3NDS A;  1HC9 B;  2BTX A;  2MJY A;  2J8B A;  1IJC A;  2PJY B;  2L5S A;  1HC9 A;  1IKC A;  1ERG A;  1W6B A;  1H0J A;  2UX2 A;  5DZ5 A;  2MHY A;  1KBT A;  1HAA A;  2QJA C;  2MFA A;  2VLW A;  1VB0 A;  1RL5 A;  2H8U A;  3KFD E;  1ABT A;  2HLQ A;  2HLR A;  1KU6 B;  1DRS A;  1NTN A;  1FSC A;  1G6M A;  3PLC A;  1RGJ A;  4EY8 B;  1NYU A;  3VTS A;  2QJ9 C;  1TGX A;  3ERA A;  1KFH A;  1TFS A;  3BT2 U;  3U73 U;  3FEV A;  4UY2 C;  1KL8 A;  1KS6 A;  1QM7 A;  3EVS C;  4RUD A;  1LJZ A;  4OM5 A;  1IDG A;  1KXI A;  2H62 C;  2L03 A;  2MUO A;  2ABX A;  2CDX A;  1IK8 A;  2H7Z B;  1BTE A;  1M9Z A;  1FFJ A;  2MJ4 A;  1PLO A;  1REW C;  1IDL A;  1CB9 A;  3KFD I;  3LAQ U;  2ERA A;  2H5F A;  1IDI A;  2K3G A;  1S4Y A;  5IMY C;  1JBD A;  4AEA A;  1BXP A;  4BIK B;  1JE9 A;  3BT1 U;  2MJ0 A;  1NXB A;  2NBT A;  1TXB A; 
#chains in the Genus database with same CATH topology
 2I9B E;  2N99 A;  3QB4 B;  1FRA A;  1CXN A;  4ZQY A;  4FAO C;  4KSN A;  4XJJ A;  1XT3 A;  1TXA A;  1L4W A;  5DU1 A;  2CRT A;  1ES7 B;  2MUP A;  1CTX A;  1KBS A;  1CDQ A;  1FAS A;  4QTI U;  2H7Z A;  3NEQ A;  2QC1 A;  2FD6 U;  3U74 U;  4FAO E;  1FSS B;  1LSI A;  1KBA A;  4IYE A;  5IMT D;  1FF4 A;  1YWH A;  2H64 C;  4P7U A;  1HOY A;  1HAJ A;  1CRF A;  1UG4 A;  1CRE A;  1ZAD A;  1CXO A;  1B41 B;  1LXG A;  2GOO B;  1V6P A;  1KC4 A;  1NEA A;  1IQ9 A;  1F8U B;  2H64 B;  2CTX A;  2X8B B;  2CRS A;  2BHI A;  1CDS A;  3HH7 A;  1CVO A;  1ERA A;  1QKD A;  2LA1 A;  1CDR A;  1F94 A;  4OM4 A;  1MAH F;  1KTZ B;  4LFT A;  1I02 A;  2QJB C;  1NTX A;  1LX5 B;  2H62 D;  1QKE A;  3NH7 A;  2GOO C;  2JQP A;  1COD A;  2JVE A;  2CCX A;  1NOR A;  1ONJ A;  2LCR A;  2PJY C;  2OFS A;  5DO6 A;  4BDT B;  1LXH A;  3EBX A;  6EBX A;  1CDT A;  1CHV S;  5EBX A;  1IDH A;  1CCQ A;  1COE A;  1NYS A;  1JGK A;  4DO8 A;  4HQP F;  2UWR A;  1MR6 A;  3NDS A;  1HC9 B;  2BTX A;  2MJY A;  2J8B A;  1IJC A;  2PJY B;  2L5S A;  1HC9 A;  1IKC A;  1ERG A;  1W6B A;  1H0J A;  2UX2 A;  5DZ5 A;  2MHY A;  1KBT A;  1HAA A;  2QJA C;  2MFA A;  2VLW A;  1VB0 A;  1RL5 A;  2H8U A;  3KFD E;  1ABT A;  2HLQ A;  2HLR A;  1KU6 B;  1DRS A;  1NTN A;  1FSC A;  1G6M A;  3PLC A;  1RGJ A;  4EY8 B;  1NYU A;  3VTS A;  2QJ9 C;  1TGX A;  3ERA A;  1KFH A;  1TFS A;  3BT2 U;  3U73 U;  3FEV A;  4UY2 C;  1KL8 A;  1KS6 A;  1QM7 A;  3EVS C;  4RUD A;  1LJZ A;  4OM5 A;  1IDG A;  1KXI A;  2H62 C;  2L03 A;  2MUO A;  2ABX A;  2CDX A;  1IK8 A;  2H7Z B;  1BTE A;  1M9Z A;  1FFJ A;  2MJ4 A;  1PLO A;  1REW C;  1IDL A;  1CB9 A;  3KFD I;  3LAQ U;  2ERA A;  2H5F A;  1IDI A;  2K3G A;  1S4Y A;  5IMY C;  1JBD A;  4AEA A;  1BXP A;  4BIK B;  1JE9 A;  3BT1 U;  2MJ0 A;  1NXB A;  2NBT A;  1TXB A; 
#chains in the Genus database with same CATH homology
 2I9B E;  2N99 A;  3QB4 B;  1FRA A;  1CXN A;  4ZQY A;  4FAO C;  4KSN A;  4XJJ A;  1XT3 A;  1TXA A;  1L4W A;  5DU1 A;  2CRT A;  1ES7 B;  2MUP A;  1CTX A;  1KBS A;  1CDQ A;  1FAS A;  4QTI U;  2H7Z A;  3NEQ A;  2QC1 A;  2FD6 U;  3U74 U;  4FAO E;  1FSS B;  1LSI A;  1KBA A;  4IYE A;  5IMT D;  1FF4 A;  1YWH A;  2H64 C;  4P7U A;  1HOY A;  1HAJ A;  1CRF A;  1UG4 A;  1CRE A;  1ZAD A;  1CXO A;  1B41 B;  1LXG A;  2GOO B;  1V6P A;  1KC4 A;  1NEA A;  1IQ9 A;  1F8U B;  2H64 B;  2CTX A;  2X8B B;  2CRS A;  2BHI A;  1CDS A;  3HH7 A;  1CVO A;  1ERA A;  1QKD A;  2LA1 A;  1CDR A;  1F94 A;  4OM4 A;  1MAH F;  1KTZ B;  4LFT A;  1I02 A;  2QJB C;  1NTX A;  1LX5 B;  2H62 D;  1QKE A;  3NH7 A;  2GOO C;  2JQP A;  1COD A;  2JVE A;  2CCX A;  1NOR A;  1ONJ A;  2LCR A;  2PJY C;  2OFS A;  5DO6 A;  4BDT B;  1LXH A;  3EBX A;  6EBX A;  1CDT A;  1CHV S;  5EBX A;  1IDH A;  1CCQ A;  1COE A;  1NYS A;  1JGK A;  4DO8 A;  4HQP F;  2UWR A;  1MR6 A;  3NDS A;  1HC9 B;  2BTX A;  2MJY A;  2J8B A;  1IJC A;  2PJY B;  2L5S A;  1HC9 A;  1IKC A;  1ERG A;  1W6B A;  1H0J A;  2UX2 A;  5DZ5 A;  2MHY A;  1KBT A;  1HAA A;  2QJA C;  2MFA A;  2VLW A;  1VB0 A;  1RL5 A;  2H8U A;  3KFD E;  1ABT A;  2HLQ A;  2HLR A;  1KU6 B;  1DRS A;  1NTN A;  1FSC A;  1G6M A;  3PLC A;  1RGJ A;  4EY8 B;  1NYU A;  3VTS A;  2QJ9 C;  1TGX A;  3ERA A;  1KFH A;  1TFS A;  3BT2 U;  3U73 U;  3FEV A;  4UY2 C;  1KL8 A;  1KS6 A;  1QM7 A;  3EVS C;  4RUD A;  1LJZ A;  4OM5 A;  1IDG A;  1KXI A;  2H62 C;  2L03 A;  2MUO A;  2ABX A;  2CDX A;  1IK8 A;  2H7Z B;  1BTE A;  1M9Z A;  1FFJ A;  2MJ4 A;  1PLO A;  1REW C;  1IDL A;  1CB9 A;  3KFD I;  3LAQ U;  2ERA A;  2H5F A;  1IDI A;  2K3G A;  1S4Y A;  5IMY C;  1JBD A;  4AEA A;  1BXP A;  4BIK B;  1JE9 A;  3BT1 U;  2MJ0 A;  1NXB A;  2NBT A;  1TXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...