2H62C

Crystal structure of a ternary ligand-receptor complex of bmp-2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
84
structure length
84
Chain Sequence
PFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title A silent H-bond can be mutationally activated for high-affinity interaction of BMP-2 and activin type IIB receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 12
structure length 84
sequence length 84
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2h62C00
1CODA 1TXAA 1NYUA 2CDXA 1KU6B 2HLQA 1MAHF 2QJAC 1S4YA 2JVEA 1FSCA 1ABTA 4AEAA 1FSSB 1CDRA 2JQPA 2MUOA 2MJ0A 1NORA 1FFJA 1TGXA 2QJBC 1CXOA 1CTXA 2OFSA 2NBTA 2CRSA 1KBTA 4IYEA 2N99A 1MR6A 1F8UB 6EBXA 5EBXA 1ONJA 2CRTA 1YWHA 1IJCA 3EVSC 2BTXA 1HOYA 4DO8A 1IKCA 2H5FA 1NEAA 2QC1A 1G6MA 1HAAA 4LFTA 3LAQU 2H7ZA 1XT3A 1FASA 4RUDA 1LXGA 2MHYA 2PJYB 5IMTD 1IK8A 1V6PA 1IDGA 1LX5B 3U74U 1IDIA 1TXBA 2L03A 2FD6U 1ERAA 1KS6A 1PLOA 2X8BB 3KFDI 1BTEA 1ES7B 1QM7A 1KBSA 5IMYC 1CDSA 1NXBA 1REWC 1NYSA 2H62D 2H62C 4QTIU 2VLWA 2GOOC 4EY8B 1CREA 3PLCA 3NDSA 3NEQA 3EBXA 1H0JA 2MFAA 3BT1U 3ERAA 5DO6A 3BT2U 4OM5A 2MJYA 2MUPA 1BXPA 1CVOA 1NTXA 4OM4A 1QKDA 1M9ZA 2UX2A 1RL5A 1ERGA 5DZ5A 3VTSA 1CB9A 2L5SA 1LSIA 4BIKB 1KL8A 1HAJA 1F94A 2H64C 2LCRA 2GOOB 1RGJA 2BHIA 1CXNA 1HC9A 2UWRA 1DRSA 1ZADA 2I9BE 1CDTA 3KFDE 1KXIA 1KC4A 2MJ4A 2H7ZB 1I02A 4XJJA 4HQPF 1UG4A 1L4WA 1CDQA 1IDLA 1TFSA 1IDHA 1CHVS 1FRAA 2J8BA 3U73U 1QKEA 1HC9B 1W6BA 1IQ9A 1FF4A 1CCQA 2H64B 2H8UA 1NTNA 2HLRA 4FAOC 1KFHA 1VB0A 1JGKA 2ERAA 3HH7A 3NH7A 1CRFA 2PJYC 1JBDA 1KTZB 1COEA 1JE9A 1LXHA 1LJZA 2CCXA 4P7UA 2QJ9C 4ZQYA 1KBAA 1B41B 3FEVA 3QB4B 5DU1A 4BDTB 4FAOE 2ABXA 2LA1A 2CTXA 4UY2C 2K3GA
chains in the Genus database with same CATH superfamily
1CODA 1TXAA 1NYUA 2CDXA 1KU6B 2HLQA 1MAHF 2QJAC 1S4YA 2JVEA 1FSCA 1ABTA 4AEAA 1FSSB 1CDRA 2JQPA 2MUOA 2MJ0A 1NORA 1FFJA 1TGXA 2QJBC 1CXOA 1CTXA 2OFSA 2NBTA 2CRSA 1KBTA 4IYEA 2N99A 1MR6A 1F8UB 6EBXA 5EBXA 1ONJA 2CRTA 1YWHA 1IJCA 3EVSC 2BTXA 1HOYA 4DO8A 1IKCA 2H5FA 1NEAA 2QC1A 1G6MA 1HAAA 4LFTA 3LAQU 2H7ZA 1XT3A 1FASA 4RUDA 1LXGA 2MHYA 2PJYB 5IMTD 1IK8A 1V6PA 1IDGA 1LX5B 3U74U 1IDIA 1TXBA 2L03A 2FD6U 1ERAA 1KS6A 1PLOA 2X8BB 3KFDI 1BTEA 1ES7B 1QM7A 1KBSA 5IMYC 1CDSA 1NXBA 1REWC 1NYSA 2H62D 2H62C 4QTIU 2VLWA 2GOOC 4EY8B 1CREA 3PLCA 3NDSA 3NEQA 3EBXA 1H0JA 2MFAA 3BT1U 3ERAA 5DO6A 3BT2U 4OM5A 2MJYA 2MUPA 1BXPA 1CVOA 1NTXA 4OM4A 1QKDA 1M9ZA 2UX2A 1RL5A 1ERGA 5DZ5A 3VTSA 1CB9A 2L5SA 1LSIA 4BIKB 1KL8A 1HAJA 1F94A 2H64C 2LCRA 2GOOB 1RGJA 2BHIA 1CXNA 1HC9A 2UWRA 1DRSA 1ZADA 2I9BE 1CDTA 3KFDE 1KXIA 1KC4A 2MJ4A 2H7ZB 1I02A 4XJJA 4HQPF 1UG4A 1L4WA 1CDQA 4KSNA 1IDLA 1TFSA 1IDHA 1CHVS 1FRAA 2J8BA 3U73U 1QKEA 1HC9B 1W6BA 1IQ9A 1FF4A 1CCQA 2H64B 2H8UA 1NTNA 2HLRA 4FAOC 1KFHA 1VB0A 1JGKA 2ERAA 3HH7A 3NH7A 1CRFA 2PJYC 1JBDA 1KTZB 1COEA 1JE9A 1LXHA 1LJZA 2CCXA 4P7UA 2QJ9C 4ZQYA 1KBAA 1B41B 3FEVA 3QB4B 5DU1A 4BDTB 4FAOE 2ABXA 2LA1A 2CTXA 4UY2C 2K3GA
chains in the Genus database with same CATH topology
1CODA 1TXAA 1NYUA 2CDXA 1KU6B 2HLQA 1MAHF 2QJAC 1S4YA 2JVEA 1FSCA 1ABTA 4AEAA 1FSSB 1CDRA 2JQPA 2MUOA 2MJ0A 1NORA 1FFJA 1TGXA 2QJBC 1CXOA 1CTXA 2OFSA 2NBTA 2CRSA 1KBTA 4IYEA 2N99A 1MR6A 1F8UB 6EBXA 5EBXA 1ONJA 2CRTA 1YWHA 1IJCA 3EVSC 2BTXA 1HOYA 4DO8A 1IKCA 2H5FA 1NEAA 2QC1A 1G6MA 1HAAA 4LFTA 3LAQU 2H7ZA 1XT3A 1FASA 4RUDA 1LXGA 2MHYA 2PJYB 5IMTD 1IK8A 1V6PA 1IDGA 1LX5B 3U74U 1IDIA 1TXBA 2L03A 2FD6U 1ERAA 1KS6A 1PLOA 2X8BB 3KFDI 1BTEA 1ES7B 1QM7A 1KBSA 5IMYC 1CDSA 1NXBA 1REWC 1NYSA 2H62D 2H62C 4QTIU 2VLWA 2GOOC 4EY8B 1CREA 3PLCA 3NDSA 3NEQA 3EBXA 1H0JA 2MFAA 3BT1U 3ERAA 5DO6A 3BT2U 4OM5A 2MJYA 2MUPA 1BXPA 1CVOA 1NTXA 4OM4A 1QKDA 1M9ZA 2UX2A 1RL5A 1ERGA 5DZ5A 3VTSA 1CB9A 2L5SA 1LSIA 4BIKB 1KL8A 1HAJA 1F94A 2H64C 2LCRA 2GOOB 1RGJA 2BHIA 1CXNA 1HC9A 2UWRA 1DRSA 1ZADA 2I9BE 1CDTA 3KFDE 1KXIA 1KC4A 2MJ4A 2H7ZB 1I02A 4XJJA 4HQPF 1UG4A 1L4WA 1CDQA 4KSNA 1IDLA 1TFSA 1IDHA 1CHVS 1FRAA 2J8BA 3U73U 1QKEA 1HC9B 1W6BA 1IQ9A 1FF4A 1CCQA 2H64B 2H8UA 1NTNA 2HLRA 4FAOC 1KFHA 1VB0A 1JGKA 2ERAA 3HH7A 3NH7A 1CRFA 2PJYC 1JBDA 1KTZB 1COEA 1JE9A 1LXHA 1LJZA 2CCXA 4P7UA 2QJ9C 4ZQYA 1KBAA 1B41B 3FEVA 3QB4B 5DU1A 4BDTB 4FAOE 2ABXA 2LA1A 2CTXA 4UY2C 2K3GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1COD A;  1TXA A;  1NYU A;  2CDX A;  1KU6 B;  2HLQ A;  1MAH F;  2QJA C;  1S4Y A;  2JVE A;  1FSC A;  1ABT A;  4AEA A;  1FSS B;  1CDR A;  2JQP A;  2MUO A;  2MJ0 A;  1NOR A;  1FFJ A;  1TGX A;  2QJB C;  1CXO A;  1CTX A;  2OFS A;  2NBT A;  2CRS A;  1KBT A;  4IYE A;  2N99 A;  1MR6 A;  1F8U B;  6EBX A;  5EBX A;  1ONJ A;  2CRT A;  1YWH A;  1IJC A;  3EVS C;  2BTX A;  1HOY A;  4DO8 A;  1IKC A;  2H5F A;  1NEA A;  2QC1 A;  1G6M A;  1HAA A;  4LFT A;  3LAQ U;  2H7Z A;  1XT3 A;  1FAS A;  4RUD A;  1LXG A;  2MHY A;  2PJY B;  5IMT D;  1IK8 A;  1V6P A;  1IDG A;  1LX5 B;  3U74 U;  1IDI A;  1TXB A;  2L03 A;  2FD6 U;  1ERA A;  1KS6 A;  1PLO A;  2X8B B;  3KFD I;  1BTE A;  1ES7 B;  1QM7 A;  1KBS A;  5IMY C;  1CDS A;  1NXB A;  1REW C;  1NYS A;  2H62 D;  2H62 C;  4QTI U;  2VLW A;  2GOO C;  4EY8 B;  1CRE A;  3PLC A;  3NDS A;  3NEQ A;  3EBX A;  1H0J A;  2MFA A;  3BT1 U;  3ERA A;  5DO6 A;  3BT2 U;  4OM5 A;  2MJY A;  2MUP A;  1BXP A;  1CVO A;  1NTX A;  4OM4 A;  1QKD A;  1M9Z A;  2UX2 A;  1RL5 A;  1ERG A;  5DZ5 A;  3VTS A;  1CB9 A;  2L5S A;  1LSI A;  4BIK B;  1KL8 A;  1HAJ A;  1F94 A;  2H64 C;  2LCR A;  2GOO B;  1RGJ A;  2BHI A;  1CXN A;  1HC9 A;  2UWR A;  1DRS A;  1ZAD A;  2I9B E;  1CDT A;  3KFD E;  1KXI A;  1KC4 A;  2MJ4 A;  2H7Z B;  1I02 A;  4XJJ A;  4HQP F;  1UG4 A;  1L4W A;  1CDQ A;  1IDL A;  1TFS A;  1IDH A;  1CHV S;  1FRA A;  2J8B A;  3U73 U;  1QKE A;  1HC9 B;  1W6B A;  1IQ9 A;  1FF4 A;  1CCQ A;  2H64 B;  2H8U A;  1NTN A;  2HLR A;  4FAO C;  1KFH A;  1VB0 A;  1JGK A;  2ERA A;  3HH7 A;  3NH7 A;  1CRF A;  2PJY C;  1JBD A;  1KTZ B;  1COE A;  1JE9 A;  1LXH A;  1LJZ A;  2CCX A;  4P7U A;  2QJ9 C;  4ZQY A;  1KBA A;  1B41 B;  3FEV A;  3QB4 B;  5DU1 A;  4BDT B;  4FAO E;  2ABX A;  2LA1 A;  2CTX A;  4UY2 C;  2K3G A; 
#chains in the Genus database with same CATH topology
 1COD A;  1TXA A;  1NYU A;  2CDX A;  1KU6 B;  2HLQ A;  1MAH F;  2QJA C;  1S4Y A;  2JVE A;  1FSC A;  1ABT A;  4AEA A;  1FSS B;  1CDR A;  2JQP A;  2MUO A;  2MJ0 A;  1NOR A;  1FFJ A;  1TGX A;  2QJB C;  1CXO A;  1CTX A;  2OFS A;  2NBT A;  2CRS A;  1KBT A;  4IYE A;  2N99 A;  1MR6 A;  1F8U B;  6EBX A;  5EBX A;  1ONJ A;  2CRT A;  1YWH A;  1IJC A;  3EVS C;  2BTX A;  1HOY A;  4DO8 A;  1IKC A;  2H5F A;  1NEA A;  2QC1 A;  1G6M A;  1HAA A;  4LFT A;  3LAQ U;  2H7Z A;  1XT3 A;  1FAS A;  4RUD A;  1LXG A;  2MHY A;  2PJY B;  5IMT D;  1IK8 A;  1V6P A;  1IDG A;  1LX5 B;  3U74 U;  1IDI A;  1TXB A;  2L03 A;  2FD6 U;  1ERA A;  1KS6 A;  1PLO A;  2X8B B;  3KFD I;  1BTE A;  1ES7 B;  1QM7 A;  1KBS A;  5IMY C;  1CDS A;  1NXB A;  1REW C;  1NYS A;  2H62 D;  2H62 C;  4QTI U;  2VLW A;  2GOO C;  4EY8 B;  1CRE A;  3PLC A;  3NDS A;  3NEQ A;  3EBX A;  1H0J A;  2MFA A;  3BT1 U;  3ERA A;  5DO6 A;  3BT2 U;  4OM5 A;  2MJY A;  2MUP A;  1BXP A;  1CVO A;  1NTX A;  4OM4 A;  1QKD A;  1M9Z A;  2UX2 A;  1RL5 A;  1ERG A;  5DZ5 A;  3VTS A;  1CB9 A;  2L5S A;  1LSI A;  4BIK B;  1KL8 A;  1HAJ A;  1F94 A;  2H64 C;  2LCR A;  2GOO B;  1RGJ A;  2BHI A;  1CXN A;  1HC9 A;  2UWR A;  1DRS A;  1ZAD A;  2I9B E;  1CDT A;  3KFD E;  1KXI A;  1KC4 A;  2MJ4 A;  2H7Z B;  1I02 A;  4XJJ A;  4HQP F;  1UG4 A;  1L4W A;  1CDQ A;  4KSN A;  1IDL A;  1TFS A;  1IDH A;  1CHV S;  1FRA A;  2J8B A;  3U73 U;  1QKE A;  1HC9 B;  1W6B A;  1IQ9 A;  1FF4 A;  1CCQ A;  2H64 B;  2H8U A;  1NTN A;  2HLR A;  4FAO C;  1KFH A;  1VB0 A;  1JGK A;  2ERA A;  3HH7 A;  3NH7 A;  1CRF A;  2PJY C;  1JBD A;  1KTZ B;  1COE A;  1JE9 A;  1LXH A;  1LJZ A;  2CCX A;  4P7U A;  2QJ9 C;  4ZQY A;  1KBA A;  1B41 B;  3FEV A;  3QB4 B;  5DU1 A;  4BDT B;  4FAO E;  2ABX A;  2LA1 A;  2CTX A;  4UY2 C;  2K3G A; 
#chains in the Genus database with same CATH homology
 1COD A;  1TXA A;  1NYU A;  2CDX A;  1KU6 B;  2HLQ A;  1MAH F;  2QJA C;  1S4Y A;  2JVE A;  1FSC A;  1ABT A;  4AEA A;  1FSS B;  1CDR A;  2JQP A;  2MUO A;  2MJ0 A;  1NOR A;  1FFJ A;  1TGX A;  2QJB C;  1CXO A;  1CTX A;  2OFS A;  2NBT A;  2CRS A;  1KBT A;  4IYE A;  2N99 A;  1MR6 A;  1F8U B;  6EBX A;  5EBX A;  1ONJ A;  2CRT A;  1YWH A;  1IJC A;  3EVS C;  2BTX A;  1HOY A;  4DO8 A;  1IKC A;  2H5F A;  1NEA A;  2QC1 A;  1G6M A;  1HAA A;  4LFT A;  3LAQ U;  2H7Z A;  1XT3 A;  1FAS A;  4RUD A;  1LXG A;  2MHY A;  2PJY B;  5IMT D;  1IK8 A;  1V6P A;  1IDG A;  1LX5 B;  3U74 U;  1IDI A;  1TXB A;  2L03 A;  2FD6 U;  1ERA A;  1KS6 A;  1PLO A;  2X8B B;  3KFD I;  1BTE A;  1ES7 B;  1QM7 A;  1KBS A;  5IMY C;  1CDS A;  1NXB A;  1REW C;  1NYS A;  2H62 D;  2H62 C;  4QTI U;  2VLW A;  2GOO C;  4EY8 B;  1CRE A;  3PLC A;  3NDS A;  3NEQ A;  3EBX A;  1H0J A;  2MFA A;  3BT1 U;  3ERA A;  5DO6 A;  3BT2 U;  4OM5 A;  2MJY A;  2MUP A;  1BXP A;  1CVO A;  1NTX A;  4OM4 A;  1QKD A;  1M9Z A;  2UX2 A;  1RL5 A;  1ERG A;  5DZ5 A;  3VTS A;  1CB9 A;  2L5S A;  1LSI A;  4BIK B;  1KL8 A;  1HAJ A;  1F94 A;  2H64 C;  2LCR A;  2GOO B;  1RGJ A;  2BHI A;  1CXN A;  1HC9 A;  2UWR A;  1DRS A;  1ZAD A;  2I9B E;  1CDT A;  3KFD E;  1KXI A;  1KC4 A;  2MJ4 A;  2H7Z B;  1I02 A;  4XJJ A;  4HQP F;  1UG4 A;  1L4W A;  1CDQ A;  4KSN A;  1IDL A;  1TFS A;  1IDH A;  1CHV S;  1FRA A;  2J8B A;  3U73 U;  1QKE A;  1HC9 B;  1W6B A;  1IQ9 A;  1FF4 A;  1CCQ A;  2H64 B;  2H8U A;  1NTN A;  2HLR A;  4FAO C;  1KFH A;  1VB0 A;  1JGK A;  2ERA A;  3HH7 A;  3NH7 A;  1CRF A;  2PJY C;  1JBD A;  1KTZ B;  1COE A;  1JE9 A;  1LXH A;  1LJZ A;  2CCX A;  4P7U A;  2QJ9 C;  4ZQY A;  1KBA A;  1B41 B;  3FEV A;  3QB4 B;  5DU1 A;  4BDT B;  4FAO E;  2ABX A;  2LA1 A;  2CTX A;  4UY2 C;  2K3G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...