2BHIA

Crystal structure of taiwan cobra cardiotoxin a3 complexed with sulfogalactoceramide
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOTOXIN 3
publication title Glycosphingolipid-Facilitated Membrane Insertion and Internalization of Cobra Cardiotoxin: The Sulfatide/Cardiotoxin Complex Structure in a Membrane-Like Environment Suggests a Lipid-Dependent Cell-Penetrating Mechanism for Membrane Binding Polypeptides.
pubmed doi rcsb
molecule tags Cardiotoxin
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-01-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2bhiA00
1FRAA 1I02A 1CXNA 1NTNA 1UG4A 1DRSA 1HAAA 4OM5A 2BTXA 4HQPF 1CB9A 2QJ9C 2MFAA 1G6MA 3KFDI 4FAOE 1CODA 2CCXA 1JBDA 4AEAA 3FEVA 2J8BA 1IJCA 1MAHF 2BHIA 2MJYA 1CHVS 4BIKB 4IYEA 4BDTB 1FFJA 3U73U 3EVSC 3PLCA 2MUPA 1KC4A 1RL5A 1FSCA 2H7ZB 1CDQA 1KTZB 1ABTA 4LFTA 5DO6A 1S4YA 2CRTA 1TFSA 2X8BB 1F8UB 1HC9A 4UY2C 2FD6U 2CTXA 1KS6A 2JQPA 1ERAA 1NXBA 1CVOA 2HLRA 1CTXA 1XT3A 3QB4B 1KBAA 1COEA 1BXPA 1FSSB 1HC9B 1PLOA 2N99A 2QC1A 2QJAC 1F94A 2H5FA 2H64C 3EBXA 5EBXA 1KFHA 1HAJA 2MUOA 1LX5B 2H62C 2CDXA 1BTEA 1IQ9A 2QJBC 3KFDE 4ZQYA 1NORA 2ABXA 2H8UA 2JVEA 1IDIA 5IMTD 5DZ5A 1YWHA 1ES7B 1FF4A 1IKCA 1ONJA 1JE9A 2ERAA 2K3GA 2UWRA 5DU1A 2GOOC 1HOYA 1ERGA 1LJZA 1NEAA 3BT1U 6EBXA 4OM4A 2L5SA 1V6PA 1KL8A 1B41B 1KU6B 1QM7A 1CDSA 1CDTA 1W6BA 2HLQA 3NDSA 1ZADA 2GOOB 2H62D 1RGJA 1JGKA 1KXIA 1M9ZA 2LCRA 3VTSA 2PJYC 2MJ4A 1LXHA 1TGXA 1L4WA 2L03A 2LA1A 1QKDA 1IDGA 1LXGA 2H64B 3NEQA 1MR6A 1IDHA 4EY8B 1LSIA 1NYUA 1CRFA 2MJ0A 2CRSA 1KBSA 2NBTA 2VLWA 3U74U 4FAOC 2PJYB 1QKEA 4QTIU 1TXBA 2H7ZA 5IMYC 1CXOA 1H0JA 1NTXA 3HH7A 3ERAA 2MHYA 1IDLA 2UX2A 1NYSA 1REWC 3BT2U 2OFSA 1VB0A 4P7UA 1FASA 4XJJA 3LAQU 4RUDA 4DO8A 1CCQA 2I9BE 1CREA 1CDRA 1TXAA 3NH7A 1KBTA 1IK8A
chains in the Genus database with same CATH superfamily
1FRAA 1I02A 1CXNA 1NTNA 1UG4A 1DRSA 1HAAA 4OM5A 2BTXA 4HQPF 1CB9A 2QJ9C 2MFAA 1G6MA 3KFDI 4FAOE 1CODA 2CCXA 1JBDA 4AEAA 3FEVA 2J8BA 1IJCA 1MAHF 2BHIA 2MJYA 1CHVS 4KSNA 4BIKB 4IYEA 4BDTB 1FFJA 3U73U 3EVSC 3PLCA 2MUPA 1KC4A 1RL5A 1FSCA 2H7ZB 1CDQA 1KTZB 1ABTA 4LFTA 5DO6A 1S4YA 2CRTA 1TFSA 2X8BB 1F8UB 1HC9A 4UY2C 2FD6U 2CTXA 1KS6A 2JQPA 1ERAA 1NXBA 1CVOA 2HLRA 1CTXA 1XT3A 3QB4B 1KBAA 1COEA 1BXPA 1FSSB 1HC9B 1PLOA 2N99A 2QC1A 2QJAC 1F94A 2H5FA 2H64C 3EBXA 5EBXA 1KFHA 1HAJA 2MUOA 1LX5B 2H62C 2CDXA 1BTEA 1IQ9A 2QJBC 3KFDE 4ZQYA 1NORA 2ABXA 2H8UA 2JVEA 1IDIA 5IMTD 5DZ5A 1YWHA 1ES7B 1FF4A 1IKCA 1ONJA 1JE9A 2ERAA 2K3GA 2UWRA 5DU1A 2GOOC 1HOYA 1ERGA 1LJZA 1NEAA 3BT1U 6EBXA 4OM4A 2L5SA 1V6PA 1KL8A 1B41B 1KU6B 1QM7A 1CDSA 1CDTA 1W6BA 2HLQA 3NDSA 1ZADA 2GOOB 2H62D 1RGJA 1JGKA 1KXIA 1M9ZA 2LCRA 3VTSA 2PJYC 2MJ4A 1LXHA 1TGXA 1L4WA 2L03A 2LA1A 1QKDA 1IDGA 1LXGA 2H64B 3NEQA 1MR6A 1IDHA 4EY8B 1LSIA 1NYUA 1CRFA 2MJ0A 2CRSA 1KBSA 2NBTA 2VLWA 3U74U 4FAOC 2PJYB 1QKEA 4QTIU 1TXBA 2H7ZA 5IMYC 1CXOA 1H0JA 1NTXA 3HH7A 3ERAA 2MHYA 1IDLA 2UX2A 1NYSA 1REWC 3BT2U 2OFSA 1VB0A 4P7UA 1FASA 4XJJA 3LAQU 4RUDA 4DO8A 1CCQA 2I9BE 1CREA 1CDRA 1TXAA 3NH7A 1KBTA 1IK8A
chains in the Genus database with same CATH topology
1FRAA 1I02A 1CXNA 1NTNA 1UG4A 1DRSA 1HAAA 4OM5A 2BTXA 4HQPF 1CB9A 2QJ9C 2MFAA 1G6MA 3KFDI 4FAOE 1CODA 2CCXA 1JBDA 4AEAA 3FEVA 2J8BA 1IJCA 1MAHF 2BHIA 2MJYA 1CHVS 4KSNA 4BIKB 4IYEA 4BDTB 1FFJA 3U73U 3EVSC 3PLCA 2MUPA 1KC4A 1RL5A 1FSCA 2H7ZB 1CDQA 1KTZB 1ABTA 4LFTA 5DO6A 1S4YA 2CRTA 1TFSA 2X8BB 1F8UB 1HC9A 4UY2C 2FD6U 2CTXA 1KS6A 2JQPA 1ERAA 1NXBA 1CVOA 2HLRA 1CTXA 1XT3A 3QB4B 1KBAA 1COEA 1BXPA 1FSSB 1HC9B 1PLOA 2N99A 2QC1A 2QJAC 1F94A 2H5FA 2H64C 3EBXA 5EBXA 1KFHA 1HAJA 2MUOA 1LX5B 2H62C 2CDXA 1BTEA 1IQ9A 2QJBC 3KFDE 4ZQYA 1NORA 2ABXA 2H8UA 2JVEA 1IDIA 5IMTD 5DZ5A 1YWHA 1ES7B 1FF4A 1IKCA 1ONJA 1JE9A 2ERAA 2K3GA 2UWRA 5DU1A 2GOOC 1HOYA 1ERGA 1LJZA 1NEAA 3BT1U 6EBXA 4OM4A 2L5SA 1V6PA 1KL8A 1B41B 1KU6B 1QM7A 1CDSA 1CDTA 1W6BA 2HLQA 3NDSA 1ZADA 2GOOB 2H62D 1RGJA 1JGKA 1KXIA 1M9ZA 2LCRA 3VTSA 2PJYC 2MJ4A 1LXHA 1TGXA 1L4WA 2L03A 2LA1A 1QKDA 1IDGA 1LXGA 2H64B 3NEQA 1MR6A 1IDHA 4EY8B 1LSIA 1NYUA 1CRFA 2MJ0A 2CRSA 1KBSA 2NBTA 2VLWA 3U74U 4FAOC 2PJYB 1QKEA 4QTIU 1TXBA 2H7ZA 5IMYC 1CXOA 1H0JA 1NTXA 3HH7A 3ERAA 2MHYA 1IDLA 2UX2A 1NYSA 1REWC 3BT2U 2OFSA 1VB0A 4P7UA 1FASA 4XJJA 3LAQU 4RUDA 4DO8A 1CCQA 2I9BE 1CREA 1CDRA 1TXAA 3NH7A 1KBTA 1IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRA A;  1I02 A;  1CXN A;  1NTN A;  1UG4 A;  1DRS A;  1HAA A;  4OM5 A;  2BTX A;  4HQP F;  1CB9 A;  2QJ9 C;  2MFA A;  1G6M A;  3KFD I;  4FAO E;  1COD A;  2CCX A;  1JBD A;  4AEA A;  3FEV A;  2J8B A;  1IJC A;  1MAH F;  2BHI A;  2MJY A;  1CHV S;  4BIK B;  4IYE A;  4BDT B;  1FFJ A;  3U73 U;  3EVS C;  3PLC A;  2MUP A;  1KC4 A;  1RL5 A;  1FSC A;  2H7Z B;  1CDQ A;  1KTZ B;  1ABT A;  4LFT A;  5DO6 A;  1S4Y A;  2CRT A;  1TFS A;  2X8B B;  1F8U B;  1HC9 A;  4UY2 C;  2FD6 U;  2CTX A;  1KS6 A;  2JQP A;  1ERA A;  1NXB A;  1CVO A;  2HLR A;  1CTX A;  1XT3 A;  3QB4 B;  1KBA A;  1COE A;  1BXP A;  1FSS B;  1HC9 B;  1PLO A;  2N99 A;  2QC1 A;  2QJA C;  1F94 A;  2H5F A;  2H64 C;  3EBX A;  5EBX A;  1KFH A;  1HAJ A;  2MUO A;  1LX5 B;  2H62 C;  2CDX A;  1BTE A;  1IQ9 A;  2QJB C;  3KFD E;  4ZQY A;  1NOR A;  2ABX A;  2H8U A;  2JVE A;  1IDI A;  5IMT D;  5DZ5 A;  1YWH A;  1ES7 B;  1FF4 A;  1IKC A;  1ONJ A;  1JE9 A;  2ERA A;  2K3G A;  2UWR A;  5DU1 A;  2GOO C;  1HOY A;  1ERG A;  1LJZ A;  1NEA A;  3BT1 U;  6EBX A;  4OM4 A;  2L5S A;  1V6P A;  1KL8 A;  1B41 B;  1KU6 B;  1QM7 A;  1CDS A;  1CDT A;  1W6B A;  2HLQ A;  3NDS A;  1ZAD A;  2GOO B;  2H62 D;  1RGJ A;  1JGK A;  1KXI A;  1M9Z A;  2LCR A;  3VTS A;  2PJY C;  2MJ4 A;  1LXH A;  1TGX A;  1L4W A;  2L03 A;  2LA1 A;  1QKD A;  1IDG A;  1LXG A;  2H64 B;  3NEQ A;  1MR6 A;  1IDH A;  4EY8 B;  1LSI A;  1NYU A;  1CRF A;  2MJ0 A;  2CRS A;  1KBS A;  2NBT A;  2VLW A;  3U74 U;  4FAO C;  2PJY B;  1QKE A;  4QTI U;  1TXB A;  2H7Z A;  5IMY C;  1CXO A;  1H0J A;  1NTX A;  3HH7 A;  3ERA A;  2MHY A;  1IDL A;  2UX2 A;  1NYS A;  1REW C;  3BT2 U;  2OFS A;  1VB0 A;  4P7U A;  1FAS A;  4XJJ A;  3LAQ U;  4RUD A;  4DO8 A;  1CCQ A;  2I9B E;  1CRE A;  1CDR A;  1TXA A;  3NH7 A;  1KBT A;  1IK8 A; 
#chains in the Genus database with same CATH topology
 1FRA A;  1I02 A;  1CXN A;  1NTN A;  1UG4 A;  1DRS A;  1HAA A;  4OM5 A;  2BTX A;  4HQP F;  1CB9 A;  2QJ9 C;  2MFA A;  1G6M A;  3KFD I;  4FAO E;  1COD A;  2CCX A;  1JBD A;  4AEA A;  3FEV A;  2J8B A;  1IJC A;  1MAH F;  2BHI A;  2MJY A;  1CHV S;  4KSN A;  4BIK B;  4IYE A;  4BDT B;  1FFJ A;  3U73 U;  3EVS C;  3PLC A;  2MUP A;  1KC4 A;  1RL5 A;  1FSC A;  2H7Z B;  1CDQ A;  1KTZ B;  1ABT A;  4LFT A;  5DO6 A;  1S4Y A;  2CRT A;  1TFS A;  2X8B B;  1F8U B;  1HC9 A;  4UY2 C;  2FD6 U;  2CTX A;  1KS6 A;  2JQP A;  1ERA A;  1NXB A;  1CVO A;  2HLR A;  1CTX A;  1XT3 A;  3QB4 B;  1KBA A;  1COE A;  1BXP A;  1FSS B;  1HC9 B;  1PLO A;  2N99 A;  2QC1 A;  2QJA C;  1F94 A;  2H5F A;  2H64 C;  3EBX A;  5EBX A;  1KFH A;  1HAJ A;  2MUO A;  1LX5 B;  2H62 C;  2CDX A;  1BTE A;  1IQ9 A;  2QJB C;  3KFD E;  4ZQY A;  1NOR A;  2ABX A;  2H8U A;  2JVE A;  1IDI A;  5IMT D;  5DZ5 A;  1YWH A;  1ES7 B;  1FF4 A;  1IKC A;  1ONJ A;  1JE9 A;  2ERA A;  2K3G A;  2UWR A;  5DU1 A;  2GOO C;  1HOY A;  1ERG A;  1LJZ A;  1NEA A;  3BT1 U;  6EBX A;  4OM4 A;  2L5S A;  1V6P A;  1KL8 A;  1B41 B;  1KU6 B;  1QM7 A;  1CDS A;  1CDT A;  1W6B A;  2HLQ A;  3NDS A;  1ZAD A;  2GOO B;  2H62 D;  1RGJ A;  1JGK A;  1KXI A;  1M9Z A;  2LCR A;  3VTS A;  2PJY C;  2MJ4 A;  1LXH A;  1TGX A;  1L4W A;  2L03 A;  2LA1 A;  1QKD A;  1IDG A;  1LXG A;  2H64 B;  3NEQ A;  1MR6 A;  1IDH A;  4EY8 B;  1LSI A;  1NYU A;  1CRF A;  2MJ0 A;  2CRS A;  1KBS A;  2NBT A;  2VLW A;  3U74 U;  4FAO C;  2PJY B;  1QKE A;  4QTI U;  1TXB A;  2H7Z A;  5IMY C;  1CXO A;  1H0J A;  1NTX A;  3HH7 A;  3ERA A;  2MHY A;  1IDL A;  2UX2 A;  1NYS A;  1REW C;  3BT2 U;  2OFS A;  1VB0 A;  4P7U A;  1FAS A;  4XJJ A;  3LAQ U;  4RUD A;  4DO8 A;  1CCQ A;  2I9B E;  1CRE A;  1CDR A;  1TXA A;  3NH7 A;  1KBT A;  1IK8 A; 
#chains in the Genus database with same CATH homology
 1FRA A;  1I02 A;  1CXN A;  1NTN A;  1UG4 A;  1DRS A;  1HAA A;  4OM5 A;  2BTX A;  4HQP F;  1CB9 A;  2QJ9 C;  2MFA A;  1G6M A;  3KFD I;  4FAO E;  1COD A;  2CCX A;  1JBD A;  4AEA A;  3FEV A;  2J8B A;  1IJC A;  1MAH F;  2BHI A;  2MJY A;  1CHV S;  4KSN A;  4BIK B;  4IYE A;  4BDT B;  1FFJ A;  3U73 U;  3EVS C;  3PLC A;  2MUP A;  1KC4 A;  1RL5 A;  1FSC A;  2H7Z B;  1CDQ A;  1KTZ B;  1ABT A;  4LFT A;  5DO6 A;  1S4Y A;  2CRT A;  1TFS A;  2X8B B;  1F8U B;  1HC9 A;  4UY2 C;  2FD6 U;  2CTX A;  1KS6 A;  2JQP A;  1ERA A;  1NXB A;  1CVO A;  2HLR A;  1CTX A;  1XT3 A;  3QB4 B;  1KBA A;  1COE A;  1BXP A;  1FSS B;  1HC9 B;  1PLO A;  2N99 A;  2QC1 A;  2QJA C;  1F94 A;  2H5F A;  2H64 C;  3EBX A;  5EBX A;  1KFH A;  1HAJ A;  2MUO A;  1LX5 B;  2H62 C;  2CDX A;  1BTE A;  1IQ9 A;  2QJB C;  3KFD E;  4ZQY A;  1NOR A;  2ABX A;  2H8U A;  2JVE A;  1IDI A;  5IMT D;  5DZ5 A;  1YWH A;  1ES7 B;  1FF4 A;  1IKC A;  1ONJ A;  1JE9 A;  2ERA A;  2K3G A;  2UWR A;  5DU1 A;  2GOO C;  1HOY A;  1ERG A;  1LJZ A;  1NEA A;  3BT1 U;  6EBX A;  4OM4 A;  2L5S A;  1V6P A;  1KL8 A;  1B41 B;  1KU6 B;  1QM7 A;  1CDS A;  1CDT A;  1W6B A;  2HLQ A;  3NDS A;  1ZAD A;  2GOO B;  2H62 D;  1RGJ A;  1JGK A;  1KXI A;  1M9Z A;  2LCR A;  3VTS A;  2PJY C;  2MJ4 A;  1LXH A;  1TGX A;  1L4W A;  2L03 A;  2LA1 A;  1QKD A;  1IDG A;  1LXG A;  2H64 B;  3NEQ A;  1MR6 A;  1IDH A;  4EY8 B;  1LSI A;  1NYU A;  1CRF A;  2MJ0 A;  2CRS A;  1KBS A;  2NBT A;  2VLW A;  3U74 U;  4FAO C;  2PJY B;  1QKE A;  4QTI U;  1TXB A;  2H7Z A;  5IMY C;  1CXO A;  1H0J A;  1NTX A;  3HH7 A;  3ERA A;  2MHY A;  1IDL A;  2UX2 A;  1NYS A;  1REW C;  3BT2 U;  2OFS A;  1VB0 A;  4P7U A;  1FAS A;  4XJJ A;  3LAQ U;  4RUD A;  4DO8 A;  1CCQ A;  2I9B E;  1CRE A;  1CDR A;  1TXA A;  3NH7 A;  1KBT A;  1IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...