4RUDA

Crystal structure of a three finger toxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
b'LKCYSSRTETMTCPEGEDKCEKYAVGLMHGSFFFIYTCTSKCHEGAYNVCCSTDLCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three-finger toxin 3b
publication title Crystal structure of a three finger toxin from M fulvius
rcsb
molecule tags Toxin
total genus 9
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4rudA00
2MJ0A 1V6PA 2QJBC 1CRFA 1HOYA 3KFDI 2UWRA 4HQPF 2ERAA 4AEAA 2QJ9C 2I9BE 1IJCA 5DZ5A 1DRSA 3U74U 1FRAA 1F94A 1KL8A 2N99A 1IQ9A 1ERGA 3NH7A 2QJAC 1CDRA 1IDHA 1NYSA 2CRSA 2H62D 5IMTD 2MJYA 5EBXA 1G6MA 1ZADA 1LXHA 2VLWA 2ABXA 3HH7A 1LXGA 5DU1A 3QB4B 1H0JA 2MUOA 2UX2A 1LJZA 1NEAA 1HC9A 1HAJA 1KU6B 2BTXA 1LX5B 1NTXA 1IDLA 1COEA 2JVEA 1M9ZA 1JGKA 2L5SA 1HC9B 1F8UB 1CREA 2GOOB 1QKEA 2H8UA 1RL5A 1KBAA 4BDTB 2H64C 1KTZB 3EBXA 3U73U 1CHVS 2CDXA 1CDQA 2K3GA 2MFAA 4UY2C 1KC4A 2PJYC 1S4YA 5DO6A 1MR6A 1CDTA 1L4WA 1PLOA 2J8BA 2LCRA 1CVOA 1UG4A 1NXBA 1YWHA 3EVSC 1IK8A 1RGJA 4FAOE 4IYEA 3BT2U 2QC1A 2HLQA 1KBSA 1FF4A 1I02A 1FSSB 1CXOA 2MHYA 2NBTA 1FSCA 1BXPA 2LA1A 3KFDE 1IKCA 2JQPA 1LSIA 1TGXA 4BIKB 1CDSA 1VB0A 5IMYC 1FASA 1IDGA 1TFSA 2CRTA 2H7ZA 1CB9A 2MJ4A 4FAOC 1KFHA 1BTEA 1NTNA 4XJJA 1W6BA 4DO8A 6EBXA 4OM5A 1ES7B 1NYUA 4QTIU 1FFJA 1ABTA 3LAQU 2H5FA 1ERAA 3FEVA 2L03A 1JBDA 3PLCA 4OM4A 1XT3A 1ONJA 4RUDA 2OFSA 2GOOC 1CCQA 1KBTA 2FD6U 1CTXA 4ZQYA 1QM7A 3NEQA 1QKDA 2BHIA 3BT1U 1IDIA 3NDSA 1CXNA 2H62C 1MAHF 2H64B 1KXIA 2CCXA 1B41B 1TXBA 4EY8B 2CTXA 1JE9A 2X8BB 2HLRA 3ERAA 1HAAA 1REWC 4LFTA 2MUPA 4P7UA 3VTSA 1TXAA 2H7ZB 2PJYB 1KS6A 1CODA 1NORA
chains in the Genus database with same CATH superfamily
2MJ0A 1V6PA 2QJBC 1CRFA 1HOYA 3KFDI 2UWRA 4HQPF 2ERAA 4AEAA 2QJ9C 2I9BE 1IJCA 5DZ5A 1DRSA 3U74U 1FRAA 1F94A 1KL8A 2N99A 1IQ9A 1ERGA 3NH7A 2QJAC 1CDRA 1IDHA 1NYSA 2CRSA 2H62D 5IMTD 2MJYA 5EBXA 1G6MA 1ZADA 1LXHA 2VLWA 2ABXA 3HH7A 1LXGA 5DU1A 3QB4B 1H0JA 2MUOA 2UX2A 1LJZA 1NEAA 1HC9A 1HAJA 1KU6B 2BTXA 1LX5B 1NTXA 1IDLA 1COEA 2JVEA 1M9ZA 1JGKA 2L5SA 1HC9B 1F8UB 1CREA 2GOOB 1QKEA 2H8UA 1RL5A 1KBAA 4BDTB 2H64C 1KTZB 3EBXA 3U73U 1CHVS 2CDXA 1CDQA 2K3GA 2MFAA 4UY2C 1KC4A 2PJYC 1S4YA 5DO6A 1MR6A 1CDTA 1L4WA 1PLOA 2J8BA 2LCRA 1CVOA 1UG4A 1NXBA 1YWHA 3EVSC 1IK8A 1RGJA 4FAOE 4IYEA 3BT2U 2QC1A 2HLQA 1KBSA 1FF4A 1I02A 1FSSB 1CXOA 2MHYA 2NBTA 1FSCA 1BXPA 2LA1A 3KFDE 1IKCA 2JQPA 1LSIA 1TGXA 4BIKB 1CDSA 1VB0A 5IMYC 1FASA 1IDGA 1TFSA 2CRTA 2H7ZA 1CB9A 2MJ4A 4FAOC 1KFHA 1BTEA 1NTNA 4XJJA 1W6BA 4DO8A 6EBXA 4OM5A 1ES7B 1NYUA 4QTIU 1FFJA 1ABTA 3LAQU 2H5FA 1ERAA 3FEVA 2L03A 1JBDA 3PLCA 4OM4A 1XT3A 1ONJA 4RUDA 2OFSA 2GOOC 1CCQA 1KBTA 2FD6U 1CTXA 4ZQYA 1QM7A 3NEQA 1QKDA 2BHIA 3BT1U 1IDIA 3NDSA 1CXNA 2H62C 1MAHF 2H64B 1KXIA 2CCXA 1B41B 1TXBA 4EY8B 2CTXA 1JE9A 2X8BB 2HLRA 3ERAA 1HAAA 1REWC 4LFTA 2MUPA 4P7UA 3VTSA 1TXAA 2H7ZB 2PJYB 1KS6A 4KSNA 1CODA 1NORA
chains in the Genus database with same CATH topology
2MJ0A 1V6PA 2QJBC 1CRFA 1HOYA 3KFDI 2UWRA 4HQPF 2ERAA 4AEAA 2QJ9C 2I9BE 1IJCA 5DZ5A 1DRSA 3U74U 1FRAA 1F94A 1KL8A 2N99A 1IQ9A 1ERGA 3NH7A 2QJAC 1CDRA 1IDHA 1NYSA 2CRSA 2H62D 5IMTD 2MJYA 5EBXA 1G6MA 1ZADA 1LXHA 2VLWA 2ABXA 3HH7A 1LXGA 5DU1A 3QB4B 1H0JA 2MUOA 2UX2A 1LJZA 1NEAA 1HC9A 1HAJA 1KU6B 2BTXA 1LX5B 1NTXA 1IDLA 1COEA 2JVEA 1M9ZA 1JGKA 2L5SA 1HC9B 1F8UB 1CREA 2GOOB 1QKEA 2H8UA 1RL5A 1KBAA 4BDTB 2H64C 1KTZB 3EBXA 3U73U 1CHVS 2CDXA 1CDQA 2K3GA 2MFAA 4UY2C 1KC4A 2PJYC 1S4YA 5DO6A 1MR6A 1CDTA 1L4WA 1PLOA 2J8BA 2LCRA 1CVOA 1UG4A 1NXBA 1YWHA 3EVSC 1IK8A 1RGJA 4FAOE 4IYEA 3BT2U 2QC1A 2HLQA 1KBSA 1FF4A 1I02A 1FSSB 1CXOA 2MHYA 2NBTA 1FSCA 1BXPA 2LA1A 3KFDE 1IKCA 2JQPA 1LSIA 1TGXA 4BIKB 1CDSA 1VB0A 5IMYC 1FASA 1IDGA 1TFSA 2CRTA 2H7ZA 1CB9A 2MJ4A 4FAOC 1KFHA 1BTEA 1NTNA 4XJJA 1W6BA 4DO8A 6EBXA 4OM5A 1ES7B 1NYUA 4QTIU 1FFJA 1ABTA 3LAQU 2H5FA 1ERAA 3FEVA 2L03A 1JBDA 3PLCA 4OM4A 1XT3A 1ONJA 4RUDA 2OFSA 2GOOC 1CCQA 1KBTA 2FD6U 1CTXA 4ZQYA 1QM7A 3NEQA 1QKDA 2BHIA 3BT1U 1IDIA 3NDSA 1CXNA 2H62C 1MAHF 2H64B 1KXIA 2CCXA 1B41B 1TXBA 4EY8B 2CTXA 1JE9A 2X8BB 2HLRA 3ERAA 1HAAA 1REWC 4LFTA 2MUPA 4P7UA 3VTSA 1TXAA 2H7ZB 2PJYB 1KS6A 4KSNA 1CODA 1NORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ0 A;  1V6P A;  2QJB C;  1CRF A;  1HOY A;  3KFD I;  2UWR A;  4HQP F;  2ERA A;  4AEA A;  2QJ9 C;  2I9B E;  1IJC A;  5DZ5 A;  1DRS A;  3U74 U;  1FRA A;  1F94 A;  1KL8 A;  2N99 A;  1IQ9 A;  1ERG A;  3NH7 A;  2QJA C;  1CDR A;  1IDH A;  1NYS A;  2CRS A;  2H62 D;  5IMT D;  2MJY A;  5EBX A;  1G6M A;  1ZAD A;  1LXH A;  2VLW A;  2ABX A;  3HH7 A;  1LXG A;  5DU1 A;  3QB4 B;  1H0J A;  2MUO A;  2UX2 A;  1LJZ A;  1NEA A;  1HC9 A;  1HAJ A;  1KU6 B;  2BTX A;  1LX5 B;  1NTX A;  1IDL A;  1COE A;  2JVE A;  1M9Z A;  1JGK A;  2L5S A;  1HC9 B;  1F8U B;  1CRE A;  2GOO B;  1QKE A;  2H8U A;  1RL5 A;  1KBA A;  4BDT B;  2H64 C;  1KTZ B;  3EBX A;  3U73 U;  1CHV S;  2CDX A;  1CDQ A;  2K3G A;  2MFA A;  4UY2 C;  1KC4 A;  2PJY C;  1S4Y A;  5DO6 A;  1MR6 A;  1CDT A;  1L4W A;  1PLO A;  2J8B A;  2LCR A;  1CVO A;  1UG4 A;  1NXB A;  1YWH A;  3EVS C;  1IK8 A;  1RGJ A;  4FAO E;  4IYE A;  3BT2 U;  2QC1 A;  2HLQ A;  1KBS A;  1FF4 A;  1I02 A;  1FSS B;  1CXO A;  2MHY A;  2NBT A;  1FSC A;  1BXP A;  2LA1 A;  3KFD E;  1IKC A;  2JQP A;  1LSI A;  1TGX A;  4BIK B;  1CDS A;  1VB0 A;  5IMY C;  1FAS A;  1IDG A;  1TFS A;  2CRT A;  2H7Z A;  1CB9 A;  2MJ4 A;  4FAO C;  1KFH A;  1BTE A;  1NTN A;  4XJJ A;  1W6B A;  4DO8 A;  6EBX A;  4OM5 A;  1ES7 B;  1NYU A;  4QTI U;  1FFJ A;  1ABT A;  3LAQ U;  2H5F A;  1ERA A;  3FEV A;  2L03 A;  1JBD A;  3PLC A;  4OM4 A;  1XT3 A;  1ONJ A;  4RUD A;  2OFS A;  2GOO C;  1CCQ A;  1KBT A;  2FD6 U;  1CTX A;  4ZQY A;  1QM7 A;  3NEQ A;  1QKD A;  2BHI A;  3BT1 U;  1IDI A;  3NDS A;  1CXN A;  2H62 C;  1MAH F;  2H64 B;  1KXI A;  2CCX A;  1B41 B;  1TXB A;  4EY8 B;  2CTX A;  1JE9 A;  2X8B B;  2HLR A;  3ERA A;  1HAA A;  1REW C;  4LFT A;  2MUP A;  4P7U A;  3VTS A;  1TXA A;  2H7Z B;  2PJY B;  1KS6 A;  1COD A;  1NOR A; 
#chains in the Genus database with same CATH topology
 2MJ0 A;  1V6P A;  2QJB C;  1CRF A;  1HOY A;  3KFD I;  2UWR A;  4HQP F;  2ERA A;  4AEA A;  2QJ9 C;  2I9B E;  1IJC A;  5DZ5 A;  1DRS A;  3U74 U;  1FRA A;  1F94 A;  1KL8 A;  2N99 A;  1IQ9 A;  1ERG A;  3NH7 A;  2QJA C;  1CDR A;  1IDH A;  1NYS A;  2CRS A;  2H62 D;  5IMT D;  2MJY A;  5EBX A;  1G6M A;  1ZAD A;  1LXH A;  2VLW A;  2ABX A;  3HH7 A;  1LXG A;  5DU1 A;  3QB4 B;  1H0J A;  2MUO A;  2UX2 A;  1LJZ A;  1NEA A;  1HC9 A;  1HAJ A;  1KU6 B;  2BTX A;  1LX5 B;  1NTX A;  1IDL A;  1COE A;  2JVE A;  1M9Z A;  1JGK A;  2L5S A;  1HC9 B;  1F8U B;  1CRE A;  2GOO B;  1QKE A;  2H8U A;  1RL5 A;  1KBA A;  4BDT B;  2H64 C;  1KTZ B;  3EBX A;  3U73 U;  1CHV S;  2CDX A;  1CDQ A;  2K3G A;  2MFA A;  4UY2 C;  1KC4 A;  2PJY C;  1S4Y A;  5DO6 A;  1MR6 A;  1CDT A;  1L4W A;  1PLO A;  2J8B A;  2LCR A;  1CVO A;  1UG4 A;  1NXB A;  1YWH A;  3EVS C;  1IK8 A;  1RGJ A;  4FAO E;  4IYE A;  3BT2 U;  2QC1 A;  2HLQ A;  1KBS A;  1FF4 A;  1I02 A;  1FSS B;  1CXO A;  2MHY A;  2NBT A;  1FSC A;  1BXP A;  2LA1 A;  3KFD E;  1IKC A;  2JQP A;  1LSI A;  1TGX A;  4BIK B;  1CDS A;  1VB0 A;  5IMY C;  1FAS A;  1IDG A;  1TFS A;  2CRT A;  2H7Z A;  1CB9 A;  2MJ4 A;  4FAO C;  1KFH A;  1BTE A;  1NTN A;  4XJJ A;  1W6B A;  4DO8 A;  6EBX A;  4OM5 A;  1ES7 B;  1NYU A;  4QTI U;  1FFJ A;  1ABT A;  3LAQ U;  2H5F A;  1ERA A;  3FEV A;  2L03 A;  1JBD A;  3PLC A;  4OM4 A;  1XT3 A;  1ONJ A;  4RUD A;  2OFS A;  2GOO C;  1CCQ A;  1KBT A;  2FD6 U;  1CTX A;  4ZQY A;  1QM7 A;  3NEQ A;  1QKD A;  2BHI A;  3BT1 U;  1IDI A;  3NDS A;  1CXN A;  2H62 C;  1MAH F;  2H64 B;  1KXI A;  2CCX A;  1B41 B;  1TXB A;  4EY8 B;  2CTX A;  1JE9 A;  2X8B B;  2HLR A;  3ERA A;  1HAA A;  1REW C;  4LFT A;  2MUP A;  4P7U A;  3VTS A;  1TXA A;  2H7Z B;  2PJY B;  1KS6 A;  4KSN A;  1COD A;  1NOR A; 
#chains in the Genus database with same CATH homology
 2MJ0 A;  1V6P A;  2QJB C;  1CRF A;  1HOY A;  3KFD I;  2UWR A;  4HQP F;  2ERA A;  4AEA A;  2QJ9 C;  2I9B E;  1IJC A;  5DZ5 A;  1DRS A;  3U74 U;  1FRA A;  1F94 A;  1KL8 A;  2N99 A;  1IQ9 A;  1ERG A;  3NH7 A;  2QJA C;  1CDR A;  1IDH A;  1NYS A;  2CRS A;  2H62 D;  5IMT D;  2MJY A;  5EBX A;  1G6M A;  1ZAD A;  1LXH A;  2VLW A;  2ABX A;  3HH7 A;  1LXG A;  5DU1 A;  3QB4 B;  1H0J A;  2MUO A;  2UX2 A;  1LJZ A;  1NEA A;  1HC9 A;  1HAJ A;  1KU6 B;  2BTX A;  1LX5 B;  1NTX A;  1IDL A;  1COE A;  2JVE A;  1M9Z A;  1JGK A;  2L5S A;  1HC9 B;  1F8U B;  1CRE A;  2GOO B;  1QKE A;  2H8U A;  1RL5 A;  1KBA A;  4BDT B;  2H64 C;  1KTZ B;  3EBX A;  3U73 U;  1CHV S;  2CDX A;  1CDQ A;  2K3G A;  2MFA A;  4UY2 C;  1KC4 A;  2PJY C;  1S4Y A;  5DO6 A;  1MR6 A;  1CDT A;  1L4W A;  1PLO A;  2J8B A;  2LCR A;  1CVO A;  1UG4 A;  1NXB A;  1YWH A;  3EVS C;  1IK8 A;  1RGJ A;  4FAO E;  4IYE A;  3BT2 U;  2QC1 A;  2HLQ A;  1KBS A;  1FF4 A;  1I02 A;  1FSS B;  1CXO A;  2MHY A;  2NBT A;  1FSC A;  1BXP A;  2LA1 A;  3KFD E;  1IKC A;  2JQP A;  1LSI A;  1TGX A;  4BIK B;  1CDS A;  1VB0 A;  5IMY C;  1FAS A;  1IDG A;  1TFS A;  2CRT A;  2H7Z A;  1CB9 A;  2MJ4 A;  4FAO C;  1KFH A;  1BTE A;  1NTN A;  4XJJ A;  1W6B A;  4DO8 A;  6EBX A;  4OM5 A;  1ES7 B;  1NYU A;  4QTI U;  1FFJ A;  1ABT A;  3LAQ U;  2H5F A;  1ERA A;  3FEV A;  2L03 A;  1JBD A;  3PLC A;  4OM4 A;  1XT3 A;  1ONJ A;  4RUD A;  2OFS A;  2GOO C;  1CCQ A;  1KBT A;  2FD6 U;  1CTX A;  4ZQY A;  1QM7 A;  3NEQ A;  1QKD A;  2BHI A;  3BT1 U;  1IDI A;  3NDS A;  1CXN A;  2H62 C;  1MAH F;  2H64 B;  1KXI A;  2CCX A;  1B41 B;  1TXB A;  4EY8 B;  2CTX A;  1JE9 A;  2X8B B;  2HLR A;  3ERA A;  1HAA A;  1REW C;  4LFT A;  2MUP A;  4P7U A;  3VTS A;  1TXA A;  2H7Z B;  2PJY B;  1KS6 A;  4KSN A;  1COD A;  1NOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...