4RUDA

Crystal structure of a three finger toxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
LKCYSSRTETMTCPEGEDKCEKYAVGLMHGSFFFIYTCTSKCHEGAYNVCCSTDLCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three-finger toxin 3b
publication title Crystal structure of a three finger toxin from M fulvius
rcsb
molecule tags Toxin
total genus 9
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4rudA00
1S4YA 1CXNA 3LAQU 1ERGA 2QJAC 4FAOE 1ERAA 3EVSC 2MFAA 4IYEA 1NORA 5IMYC 1COEA 1JGKA 2ABXA 2NBTA 1KBTA 1L4WA 1LXHA 1QM7A 1HC9A 3VTSA 1FSCA 2HLRA 1KL8A 2N99A 1LSIA 1IDLA 1JBDA 4LFTA 1LJZA 1HAJA 1KU6B 1IDHA 2GOOC 4AEAA 2X8BB 1CRFA 1FF4A 3FEVA 1BXPA 2HLQA 1M9ZA 2MJ0A 2JVEA 1KTZB 1CTXA 2H64C 1FASA 1QKDA 3KFDI 3U74U 2H7ZA 5DO6A 1CDQA 1V6PA 2CRSA 2H8UA 2PJYC 4FAOC 4P7UA 1FSSB 4HQPF 5DZ5A 1IDGA 3QB4B 2CRTA 6EBXA 2MJ4A 1CODA 1IQ9A 5DU1A 1F94A 3U73U 3BT2U 1CDRA 1HAAA 2L03A 1HC9B 1NYUA 3KFDE 4UY2C 2LA1A 1CB9A 1ONJA 4ZQYA 1CREA 3HH7A 1ABTA 4QTIU 1CDTA 3EBXA 1PLOA 1TXBA 2QC1A 1NTNA 2L5SA 1TGXA 3BT1U 1VB0A 2H64B 1RL5A 4OM5A 4XJJA 1FFJA 2BTXA 1LXGA 2H5FA 1W6BA 1MAHF 2K3GA 2PJYB 1KXIA 3ERAA 2H7ZB 1MR6A 4DO8A 4OM4A 3PLCA 1CXOA 5IMTD 1ZADA 3NEQA 5EBXA 1YWHA 1IJCA 1F8UB 4EY8B 1H0JA 1IDIA 1XT3A 2QJBC 3NDSA 2BHIA 2GOOB 1CHVS 2I9BE 2UX2A 2UWRA 3NH7A 1NXBA 1FRAA 1CDSA 2CCXA 2MJYA 1BTEA 1KBAA 1CCQA 1NTXA 1UG4A 4RUDA 2LCRA 1NEAA 2MUOA 2CDXA 1TXAA 4BIKB 2VLWA 1I02A 1DRSA 2FD6U 2MHYA 1KC4A 1JE9A 1HOYA 1B41B 1RGJA 2H62D 1KBSA 1KS6A 1IK8A 2QJ9C 1IKCA 2JQPA 1KFHA 1REWC 2H62C 2CTXA 2OFSA 1ES7B 1LX5B 2J8BA 1NYSA 1CVOA 2ERAA 4BDTB 1QKEA 1G6MA 1TFSA 2MUPA
chains in the Genus database with same CATH superfamily
1S4YA 1CXNA 3LAQU 1ERGA 2QJAC 4FAOE 1ERAA 3EVSC 2MFAA 4IYEA 1NORA 5IMYC 1COEA 1JGKA 2ABXA 2NBTA 1KBTA 1L4WA 1LXHA 1QM7A 1HC9A 3VTSA 1FSCA 2HLRA 1KL8A 2N99A 1LSIA 1IDLA 1JBDA 4LFTA 1LJZA 1HAJA 1KU6B 1IDHA 2GOOC 4AEAA 2X8BB 1CRFA 1FF4A 3FEVA 1BXPA 2HLQA 1M9ZA 2MJ0A 2JVEA 1KTZB 1CTXA 2H64C 1FASA 1QKDA 3KFDI 3U74U 2H7ZA 5DO6A 1CDQA 1V6PA 2CRSA 2H8UA 2PJYC 4FAOC 4P7UA 1FSSB 4HQPF 5DZ5A 1IDGA 3QB4B 2CRTA 6EBXA 2MJ4A 1CODA 1IQ9A 5DU1A 1F94A 3U73U 3BT2U 1CDRA 1HAAA 2L03A 1HC9B 1NYUA 3KFDE 4UY2C 2LA1A 1CB9A 1ONJA 4ZQYA 1CREA 3HH7A 1ABTA 4QTIU 1CDTA 3EBXA 1PLOA 1TXBA 2QC1A 1NTNA 2L5SA 1TGXA 3BT1U 1VB0A 2H64B 1RL5A 4OM5A 4XJJA 1FFJA 2BTXA 1LXGA 2H5FA 1W6BA 1MAHF 2K3GA 2PJYB 1KXIA 3ERAA 2H7ZB 1MR6A 4DO8A 4OM4A 3PLCA 1CXOA 5IMTD 1ZADA 3NEQA 5EBXA 1YWHA 1IJCA 1F8UB 4EY8B 1H0JA 1IDIA 1XT3A 2QJBC 3NDSA 2BHIA 2GOOB 1CHVS 2I9BE 2UX2A 2UWRA 3NH7A 1NXBA 1FRAA 1CDSA 2CCXA 2MJYA 1BTEA 1KBAA 1CCQA 1NTXA 1UG4A 4RUDA 2LCRA 1NEAA 2MUOA 2CDXA 1TXAA 4BIKB 2VLWA 1I02A 1DRSA 2FD6U 2MHYA 1KC4A 1JE9A 1HOYA 1B41B 1RGJA 2H62D 1KBSA 1KS6A 1IK8A 2QJ9C 1IKCA 2JQPA 1KFHA 1REWC 2H62C 2CTXA 2OFSA 1ES7B 1LX5B 2J8BA 1NYSA 1CVOA 4KSNA 2ERAA 4BDTB 1QKEA 1G6MA 1TFSA 2MUPA
chains in the Genus database with same CATH topology
1S4YA 1CXNA 3LAQU 1ERGA 2QJAC 4FAOE 1ERAA 3EVSC 2MFAA 4IYEA 1NORA 5IMYC 1COEA 1JGKA 2ABXA 2NBTA 1KBTA 1L4WA 1LXHA 1QM7A 1HC9A 3VTSA 1FSCA 2HLRA 1KL8A 2N99A 1LSIA 1IDLA 1JBDA 4LFTA 1LJZA 1HAJA 1KU6B 1IDHA 2GOOC 4AEAA 2X8BB 1CRFA 1FF4A 3FEVA 1BXPA 2HLQA 1M9ZA 2MJ0A 2JVEA 1KTZB 1CTXA 2H64C 1FASA 1QKDA 3KFDI 3U74U 2H7ZA 5DO6A 1CDQA 1V6PA 2CRSA 2H8UA 2PJYC 4FAOC 4P7UA 1FSSB 4HQPF 5DZ5A 1IDGA 3QB4B 2CRTA 6EBXA 2MJ4A 1CODA 1IQ9A 5DU1A 1F94A 3U73U 3BT2U 1CDRA 1HAAA 2L03A 1HC9B 1NYUA 3KFDE 4UY2C 2LA1A 1CB9A 1ONJA 4ZQYA 1CREA 3HH7A 1ABTA 4QTIU 1CDTA 3EBXA 1PLOA 1TXBA 2QC1A 1NTNA 2L5SA 1TGXA 3BT1U 1VB0A 2H64B 1RL5A 4OM5A 4XJJA 1FFJA 2BTXA 1LXGA 2H5FA 1W6BA 1MAHF 2K3GA 2PJYB 1KXIA 3ERAA 2H7ZB 1MR6A 4DO8A 4OM4A 3PLCA 1CXOA 5IMTD 1ZADA 3NEQA 5EBXA 1YWHA 1IJCA 1F8UB 4EY8B 1H0JA 1IDIA 1XT3A 2QJBC 3NDSA 2BHIA 2GOOB 1CHVS 2I9BE 2UX2A 2UWRA 3NH7A 1NXBA 1FRAA 1CDSA 2CCXA 2MJYA 1BTEA 1KBAA 1CCQA 1NTXA 1UG4A 4RUDA 2LCRA 1NEAA 2MUOA 2CDXA 1TXAA 4BIKB 2VLWA 1I02A 1DRSA 2FD6U 2MHYA 1KC4A 1JE9A 1HOYA 1B41B 1RGJA 2H62D 1KBSA 1KS6A 1IK8A 2QJ9C 1IKCA 2JQPA 1KFHA 1REWC 2H62C 2CTXA 2OFSA 1ES7B 1LX5B 2J8BA 1NYSA 1CVOA 4KSNA 2ERAA 4BDTB 1QKEA 1G6MA 1TFSA 2MUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Y A;  1CXN A;  3LAQ U;  1ERG A;  2QJA C;  4FAO E;  1ERA A;  3EVS C;  2MFA A;  4IYE A;  1NOR A;  5IMY C;  1COE A;  1JGK A;  2ABX A;  2NBT A;  1KBT A;  1L4W A;  1LXH A;  1QM7 A;  1HC9 A;  3VTS A;  1FSC A;  2HLR A;  1KL8 A;  2N99 A;  1LSI A;  1IDL A;  1JBD A;  4LFT A;  1LJZ A;  1HAJ A;  1KU6 B;  1IDH A;  2GOO C;  4AEA A;  2X8B B;  1CRF A;  1FF4 A;  3FEV A;  1BXP A;  2HLQ A;  1M9Z A;  2MJ0 A;  2JVE A;  1KTZ B;  1CTX A;  2H64 C;  1FAS A;  1QKD A;  3KFD I;  3U74 U;  2H7Z A;  5DO6 A;  1CDQ A;  1V6P A;  2CRS A;  2H8U A;  2PJY C;  4FAO C;  4P7U A;  1FSS B;  4HQP F;  5DZ5 A;  1IDG A;  3QB4 B;  2CRT A;  6EBX A;  2MJ4 A;  1COD A;  1IQ9 A;  5DU1 A;  1F94 A;  3U73 U;  3BT2 U;  1CDR A;  1HAA A;  2L03 A;  1HC9 B;  1NYU A;  3KFD E;  4UY2 C;  2LA1 A;  1CB9 A;  1ONJ A;  4ZQY A;  1CRE A;  3HH7 A;  1ABT A;  4QTI U;  1CDT A;  3EBX A;  1PLO A;  1TXB A;  2QC1 A;  1NTN A;  2L5S A;  1TGX A;  3BT1 U;  1VB0 A;  2H64 B;  1RL5 A;  4OM5 A;  4XJJ A;  1FFJ A;  2BTX A;  1LXG A;  2H5F A;  1W6B A;  1MAH F;  2K3G A;  2PJY B;  1KXI A;  3ERA A;  2H7Z B;  1MR6 A;  4DO8 A;  4OM4 A;  3PLC A;  1CXO A;  5IMT D;  1ZAD A;  3NEQ A;  5EBX A;  1YWH A;  1IJC A;  1F8U B;  4EY8 B;  1H0J A;  1IDI A;  1XT3 A;  2QJB C;  3NDS A;  2BHI A;  2GOO B;  1CHV S;  2I9B E;  2UX2 A;  2UWR A;  3NH7 A;  1NXB A;  1FRA A;  1CDS A;  2CCX A;  2MJY A;  1BTE A;  1KBA A;  1CCQ A;  1NTX A;  1UG4 A;  4RUD A;  2LCR A;  1NEA A;  2MUO A;  2CDX A;  1TXA A;  4BIK B;  2VLW A;  1I02 A;  1DRS A;  2FD6 U;  2MHY A;  1KC4 A;  1JE9 A;  1HOY A;  1B41 B;  1RGJ A;  2H62 D;  1KBS A;  1KS6 A;  1IK8 A;  2QJ9 C;  1IKC A;  2JQP A;  1KFH A;  1REW C;  2H62 C;  2CTX A;  2OFS A;  1ES7 B;  1LX5 B;  2J8B A;  1NYS A;  1CVO A;  2ERA A;  4BDT B;  1QKE A;  1G6M A;  1TFS A;  2MUP A; 
#chains in the Genus database with same CATH topology
 1S4Y A;  1CXN A;  3LAQ U;  1ERG A;  2QJA C;  4FAO E;  1ERA A;  3EVS C;  2MFA A;  4IYE A;  1NOR A;  5IMY C;  1COE A;  1JGK A;  2ABX A;  2NBT A;  1KBT A;  1L4W A;  1LXH A;  1QM7 A;  1HC9 A;  3VTS A;  1FSC A;  2HLR A;  1KL8 A;  2N99 A;  1LSI A;  1IDL A;  1JBD A;  4LFT A;  1LJZ A;  1HAJ A;  1KU6 B;  1IDH A;  2GOO C;  4AEA A;  2X8B B;  1CRF A;  1FF4 A;  3FEV A;  1BXP A;  2HLQ A;  1M9Z A;  2MJ0 A;  2JVE A;  1KTZ B;  1CTX A;  2H64 C;  1FAS A;  1QKD A;  3KFD I;  3U74 U;  2H7Z A;  5DO6 A;  1CDQ A;  1V6P A;  2CRS A;  2H8U A;  2PJY C;  4FAO C;  4P7U A;  1FSS B;  4HQP F;  5DZ5 A;  1IDG A;  3QB4 B;  2CRT A;  6EBX A;  2MJ4 A;  1COD A;  1IQ9 A;  5DU1 A;  1F94 A;  3U73 U;  3BT2 U;  1CDR A;  1HAA A;  2L03 A;  1HC9 B;  1NYU A;  3KFD E;  4UY2 C;  2LA1 A;  1CB9 A;  1ONJ A;  4ZQY A;  1CRE A;  3HH7 A;  1ABT A;  4QTI U;  1CDT A;  3EBX A;  1PLO A;  1TXB A;  2QC1 A;  1NTN A;  2L5S A;  1TGX A;  3BT1 U;  1VB0 A;  2H64 B;  1RL5 A;  4OM5 A;  4XJJ A;  1FFJ A;  2BTX A;  1LXG A;  2H5F A;  1W6B A;  1MAH F;  2K3G A;  2PJY B;  1KXI A;  3ERA A;  2H7Z B;  1MR6 A;  4DO8 A;  4OM4 A;  3PLC A;  1CXO A;  5IMT D;  1ZAD A;  3NEQ A;  5EBX A;  1YWH A;  1IJC A;  1F8U B;  4EY8 B;  1H0J A;  1IDI A;  1XT3 A;  2QJB C;  3NDS A;  2BHI A;  2GOO B;  1CHV S;  2I9B E;  2UX2 A;  2UWR A;  3NH7 A;  1NXB A;  1FRA A;  1CDS A;  2CCX A;  2MJY A;  1BTE A;  1KBA A;  1CCQ A;  1NTX A;  1UG4 A;  4RUD A;  2LCR A;  1NEA A;  2MUO A;  2CDX A;  1TXA A;  4BIK B;  2VLW A;  1I02 A;  1DRS A;  2FD6 U;  2MHY A;  1KC4 A;  1JE9 A;  1HOY A;  1B41 B;  1RGJ A;  2H62 D;  1KBS A;  1KS6 A;  1IK8 A;  2QJ9 C;  1IKC A;  2JQP A;  1KFH A;  1REW C;  2H62 C;  2CTX A;  2OFS A;  1ES7 B;  1LX5 B;  2J8B A;  1NYS A;  1CVO A;  4KSN A;  2ERA A;  4BDT B;  1QKE A;  1G6M A;  1TFS A;  2MUP A; 
#chains in the Genus database with same CATH homology
 1S4Y A;  1CXN A;  3LAQ U;  1ERG A;  2QJA C;  4FAO E;  1ERA A;  3EVS C;  2MFA A;  4IYE A;  1NOR A;  5IMY C;  1COE A;  1JGK A;  2ABX A;  2NBT A;  1KBT A;  1L4W A;  1LXH A;  1QM7 A;  1HC9 A;  3VTS A;  1FSC A;  2HLR A;  1KL8 A;  2N99 A;  1LSI A;  1IDL A;  1JBD A;  4LFT A;  1LJZ A;  1HAJ A;  1KU6 B;  1IDH A;  2GOO C;  4AEA A;  2X8B B;  1CRF A;  1FF4 A;  3FEV A;  1BXP A;  2HLQ A;  1M9Z A;  2MJ0 A;  2JVE A;  1KTZ B;  1CTX A;  2H64 C;  1FAS A;  1QKD A;  3KFD I;  3U74 U;  2H7Z A;  5DO6 A;  1CDQ A;  1V6P A;  2CRS A;  2H8U A;  2PJY C;  4FAO C;  4P7U A;  1FSS B;  4HQP F;  5DZ5 A;  1IDG A;  3QB4 B;  2CRT A;  6EBX A;  2MJ4 A;  1COD A;  1IQ9 A;  5DU1 A;  1F94 A;  3U73 U;  3BT2 U;  1CDR A;  1HAA A;  2L03 A;  1HC9 B;  1NYU A;  3KFD E;  4UY2 C;  2LA1 A;  1CB9 A;  1ONJ A;  4ZQY A;  1CRE A;  3HH7 A;  1ABT A;  4QTI U;  1CDT A;  3EBX A;  1PLO A;  1TXB A;  2QC1 A;  1NTN A;  2L5S A;  1TGX A;  3BT1 U;  1VB0 A;  2H64 B;  1RL5 A;  4OM5 A;  4XJJ A;  1FFJ A;  2BTX A;  1LXG A;  2H5F A;  1W6B A;  1MAH F;  2K3G A;  2PJY B;  1KXI A;  3ERA A;  2H7Z B;  1MR6 A;  4DO8 A;  4OM4 A;  3PLC A;  1CXO A;  5IMT D;  1ZAD A;  3NEQ A;  5EBX A;  1YWH A;  1IJC A;  1F8U B;  4EY8 B;  1H0J A;  1IDI A;  1XT3 A;  2QJB C;  3NDS A;  2BHI A;  2GOO B;  1CHV S;  2I9B E;  2UX2 A;  2UWR A;  3NH7 A;  1NXB A;  1FRA A;  1CDS A;  2CCX A;  2MJY A;  1BTE A;  1KBA A;  1CCQ A;  1NTX A;  1UG4 A;  4RUD A;  2LCR A;  1NEA A;  2MUO A;  2CDX A;  1TXA A;  4BIK B;  2VLW A;  1I02 A;  1DRS A;  2FD6 U;  2MHY A;  1KC4 A;  1JE9 A;  1HOY A;  1B41 B;  1RGJ A;  2H62 D;  1KBS A;  1KS6 A;  1IK8 A;  2QJ9 C;  1IKC A;  2JQP A;  1KFH A;  1REW C;  2H62 C;  2CTX A;  2OFS A;  1ES7 B;  1LX5 B;  2J8B A;  1NYS A;  1CVO A;  4KSN A;  2ERA A;  4BDT B;  1QKE A;  1G6M A;  1TFS A;  2MUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...