4RUDA

Crystal structure of a three finger toxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
LKCYSSRTETMTCPEGEDKCEKYAVGLMHGSFFFIYTCTSKCHEGAYNVCCSTDLCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Three-finger toxin 3b
publication title Crystal structure of a three finger toxin from M fulvius
rcsb
total genus 9
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4rudA00
2MUOA 4UY2C 1W6BA 4LFTA 2JQPA 1QKEA 1IK8A 2MJYA 1LX5B 1NTNA 2H8UA 1V6PA 1IDGA 4IYEA 1TGXA 2LA1A 1IDIA 1M9ZA 4QTIU 1LXGA 1LJZA 1CDTA 2QJBC 2J8BA 1LSIA 4DO8A 1XT3A 1FSCA 2CTXA 2CDXA 1JGKA 1LXHA 2UWRA 5DO6A 1JBDA 1HAAA 2H5FA 1BXPA 4OM4A 1UG4A 3NH7A 4BDTB 3KFDE 5EBXA 1ABTA 2QJ9C 2VLWA 3NEQA 1NTXA 4P7UA 2MHYA 4OM5A 6EBXA 1TXBA 2OFSA 1KBAA 1CDRA 1L4WA 2BTXA 2MUPA 1VB0A 3BT1U 5IMYC 4BIKB 1KS6A 1KBSA 2I9BE 1QM7A 1REWC 1CXNA 3LAQU 1HC9B 1JE9A 2PJYB 1HAJA 1IDHA 1QKDA 2NBTA 1HC9A 2H62C 1NYUA 1CTXA 1BTEA 4ZQYA 2H64B 1NYSA 1S4YA 2X8BB 3EBXA 1KU6B 4HQPF 1CDQA 1COEA 1ERAA 2N99A 1FSSB 1KFHA 2GOOC 2PJYC 1RGJA 3BT2U 3KFDI 5DU1A 3ERAA 1CDSA 2L5SA 2H62D 1CRFA 1G6MA 1H0JA 2CCXA 1PLOA 1MAHF 2H64C 1DRSA 1ERGA 2QJAC 3HH7A 1TXAA 1ES7B 5DZ5A 5IMTD 2MJ0A 2GOOB 1KTZB 2K3GA 1RL5A 1IDLA 4AEAA 1CREA 1I02A 1NEAA 3PLCA 3QB4B 1FFJA 2H7ZB 2HLQA 2UX2A 1HOYA 3U73U 1KL8A 1CCQA 1NXBA 1IQ9A 1F94A 2H7ZA 3EVSC 1KC4A 1IKCA 2CRTA 2JVEA 2MFAA 4EY8B 1TFSA 1F8UB 1NORA 1CHVS 1B41B 2L03A 1FASA 1CVOA 1KXIA 1CXOA 1CB9A 2HLRA 4XJJA 2MJ4A 2FD6U 1ONJA 1YWHA 1FRAA 1KBTA 4FAOC 2ABXA 1ZADA 3VTSA 1FF4A 3FEVA 3NDSA 1CODA 4RUDA 2LCRA 4FAOE 1IJCA 2QC1A 2ERAA 1MR6A 3U74U 2BHIA 2CRSA
chains in the Genus database with same CATH superfamily
2MUOA 4UY2C 1W6BA 4LFTA 2JQPA 1QKEA 1IK8A 2MJYA 1LX5B 1NTNA 2H8UA 1V6PA 1IDGA 4IYEA 1TGXA 2LA1A 1IDIA 1M9ZA 4QTIU 1LXGA 1LJZA 1CDTA 2QJBC 2J8BA 1LSIA 4DO8A 1XT3A 1FSCA 2CTXA 2CDXA 1JGKA 1LXHA 2UWRA 5DO6A 1JBDA 1HAAA 2H5FA 1BXPA 4OM4A 1UG4A 3NH7A 4BDTB 3KFDE 5EBXA 1ABTA 2QJ9C 2VLWA 3NEQA 1NTXA 4P7UA 2MHYA 4OM5A 6EBXA 1TXBA 2OFSA 1KBAA 1CDRA 1L4WA 2BTXA 2MUPA 1VB0A 3BT1U 5IMYC 4BIKB 1KS6A 1KBSA 2I9BE 1QM7A 1REWC 1CXNA 3LAQU 1HC9B 1JE9A 2PJYB 1HAJA 1IDHA 1QKDA 2NBTA 1HC9A 2H62C 1NYUA 1CTXA 1BTEA 4ZQYA 2H64B 1NYSA 1S4YA 2X8BB 3EBXA 1KU6B 4HQPF 1CDQA 1COEA 1ERAA 2N99A 1FSSB 1KFHA 2GOOC 2PJYC 1RGJA 3BT2U 3KFDI 5DU1A 3ERAA 1CDSA 2L5SA 2H62D 1CRFA 1G6MA 1H0JA 2CCXA 1PLOA 1MAHF 2H64C 1DRSA 1ERGA 2QJAC 3HH7A 1TXAA 1ES7B 5DZ5A 4KSNA 5IMTD 2MJ0A 2GOOB 1KTZB 2K3GA 1RL5A 1IDLA 4AEAA 1CREA 1I02A 1NEAA 3PLCA 3QB4B 1FFJA 2H7ZB 2HLQA 2UX2A 1HOYA 3U73U 1KL8A 1CCQA 1NXBA 1IQ9A 1F94A 2H7ZA 3EVSC 1KC4A 1IKCA 2CRTA 2JVEA 2MFAA 4EY8B 1TFSA 1F8UB 1NORA 1CHVS 1B41B 2L03A 1FASA 1CVOA 1KXIA 1CXOA 1CB9A 2HLRA 4XJJA 2MJ4A 2FD6U 1ONJA 1YWHA 1FRAA 1KBTA 4FAOC 2ABXA 1ZADA 3VTSA 1FF4A 3FEVA 3NDSA 1CODA 4RUDA 2LCRA 4FAOE 1IJCA 2QC1A 2ERAA 1MR6A 3U74U 2BHIA 2CRSA
chains in the Genus database with same CATH topology
2MUOA 4UY2C 1W6BA 4LFTA 2JQPA 1QKEA 1IK8A 2MJYA 1LX5B 1NTNA 2H8UA 1V6PA 1IDGA 4IYEA 1TGXA 2LA1A 1IDIA 1M9ZA 4QTIU 1LXGA 1LJZA 1CDTA 2QJBC 2J8BA 1LSIA 4DO8A 1XT3A 1FSCA 2CTXA 2CDXA 1JGKA 1LXHA 2UWRA 5DO6A 1JBDA 1HAAA 2H5FA 1BXPA 4OM4A 1UG4A 3NH7A 4BDTB 3KFDE 5EBXA 1ABTA 2QJ9C 2VLWA 3NEQA 1NTXA 4P7UA 2MHYA 4OM5A 6EBXA 1TXBA 2OFSA 1KBAA 1CDRA 1L4WA 2BTXA 2MUPA 1VB0A 3BT1U 5IMYC 4BIKB 1KS6A 1KBSA 2I9BE 1QM7A 1REWC 1CXNA 3LAQU 1HC9B 1JE9A 2PJYB 1HAJA 1IDHA 1QKDA 2NBTA 1HC9A 2H62C 1NYUA 1CTXA 1BTEA 4ZQYA 2H64B 1NYSA 1S4YA 2X8BB 3EBXA 1KU6B 4HQPF 1CDQA 1COEA 1ERAA 2N99A 1FSSB 1KFHA 2GOOC 2PJYC 1RGJA 3BT2U 3KFDI 5DU1A 3ERAA 1CDSA 2L5SA 2H62D 1CRFA 1G6MA 1H0JA 2CCXA 1PLOA 1MAHF 2H64C 1DRSA 1ERGA 2QJAC 3HH7A 1TXAA 1ES7B 5DZ5A 4KSNA 5IMTD 2MJ0A 2GOOB 1KTZB 2K3GA 1RL5A 1IDLA 4AEAA 1CREA 1I02A 1NEAA 3PLCA 3QB4B 1FFJA 2H7ZB 2HLQA 2UX2A 1HOYA 3U73U 1KL8A 1CCQA 1NXBA 1IQ9A 1F94A 2H7ZA 3EVSC 1KC4A 1IKCA 2CRTA 2JVEA 2MFAA 4EY8B 1TFSA 1F8UB 1NORA 1CHVS 1B41B 2L03A 1FASA 1CVOA 1KXIA 1CXOA 1CB9A 2HLRA 4XJJA 2MJ4A 2FD6U 1ONJA 1YWHA 1FRAA 1KBTA 4FAOC 2ABXA 1ZADA 3VTSA 1FF4A 3FEVA 3NDSA 1CODA 4RUDA 2LCRA 4FAOE 1IJCA 2QC1A 2ERAA 1MR6A 3U74U 2BHIA 2CRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUO A;  4UY2 C;  1W6B A;  4LFT A;  2JQP A;  1QKE A;  1IK8 A;  2MJY A;  1LX5 B;  1NTN A;  2H8U A;  1V6P A;  1IDG A;  4IYE A;  1TGX A;  2LA1 A;  1IDI A;  1M9Z A;  4QTI U;  1LXG A;  1LJZ A;  1CDT A;  2QJB C;  2J8B A;  1LSI A;  4DO8 A;  1XT3 A;  1FSC A;  2CTX A;  2CDX A;  1JGK A;  1LXH A;  2UWR A;  5DO6 A;  1JBD A;  1HAA A;  2H5F A;  1BXP A;  4OM4 A;  1UG4 A;  3NH7 A;  4BDT B;  3KFD E;  5EBX A;  1ABT A;  2QJ9 C;  2VLW A;  3NEQ A;  1NTX A;  4P7U A;  2MHY A;  4OM5 A;  6EBX A;  1TXB A;  2OFS A;  1KBA A;  1CDR A;  1L4W A;  2BTX A;  2MUP A;  1VB0 A;  3BT1 U;  5IMY C;  4BIK B;  1KS6 A;  1KBS A;  2I9B E;  1QM7 A;  1REW C;  1CXN A;  3LAQ U;  1HC9 B;  1JE9 A;  2PJY B;  1HAJ A;  1IDH A;  1QKD A;  2NBT A;  1HC9 A;  2H62 C;  1NYU A;  1CTX A;  1BTE A;  4ZQY A;  2H64 B;  1NYS A;  1S4Y A;  2X8B B;  3EBX A;  1KU6 B;  4HQP F;  1CDQ A;  1COE A;  1ERA A;  2N99 A;  1FSS B;  1KFH A;  2GOO C;  2PJY C;  1RGJ A;  3BT2 U;  3KFD I;  5DU1 A;  3ERA A;  1CDS A;  2L5S A;  2H62 D;  1CRF A;  1G6M A;  1H0J A;  2CCX A;  1PLO A;  1MAH F;  2H64 C;  1DRS A;  1ERG A;  2QJA C;  3HH7 A;  1TXA A;  1ES7 B;  5DZ5 A;  5IMT D;  2MJ0 A;  2GOO B;  1KTZ B;  2K3G A;  1RL5 A;  1IDL A;  4AEA A;  1CRE A;  1I02 A;  1NEA A;  3PLC A;  3QB4 B;  1FFJ A;  2H7Z B;  2HLQ A;  2UX2 A;  1HOY A;  3U73 U;  1KL8 A;  1CCQ A;  1NXB A;  1IQ9 A;  1F94 A;  2H7Z A;  3EVS C;  1KC4 A;  1IKC A;  2CRT A;  2JVE A;  2MFA A;  4EY8 B;  1TFS A;  1F8U B;  1NOR A;  1CHV S;  1B41 B;  2L03 A;  1FAS A;  1CVO A;  1KXI A;  1CXO A;  1CB9 A;  2HLR A;  4XJJ A;  2MJ4 A;  2FD6 U;  1ONJ A;  1YWH A;  1FRA A;  1KBT A;  4FAO C;  2ABX A;  1ZAD A;  3VTS A;  1FF4 A;  3FEV A;  3NDS A;  1COD A;  4RUD A;  2LCR A;  4FAO E;  1IJC A;  2QC1 A;  2ERA A;  1MR6 A;  3U74 U;  2BHI A;  2CRS A; 
#chains in the Genus database with same CATH topology
 2MUO A;  4UY2 C;  1W6B A;  4LFT A;  2JQP A;  1QKE A;  1IK8 A;  2MJY A;  1LX5 B;  1NTN A;  2H8U A;  1V6P A;  1IDG A;  4IYE A;  1TGX A;  2LA1 A;  1IDI A;  1M9Z A;  4QTI U;  1LXG A;  1LJZ A;  1CDT A;  2QJB C;  2J8B A;  1LSI A;  4DO8 A;  1XT3 A;  1FSC A;  2CTX A;  2CDX A;  1JGK A;  1LXH A;  2UWR A;  5DO6 A;  1JBD A;  1HAA A;  2H5F A;  1BXP A;  4OM4 A;  1UG4 A;  3NH7 A;  4BDT B;  3KFD E;  5EBX A;  1ABT A;  2QJ9 C;  2VLW A;  3NEQ A;  1NTX A;  4P7U A;  2MHY A;  4OM5 A;  6EBX A;  1TXB A;  2OFS A;  1KBA A;  1CDR A;  1L4W A;  2BTX A;  2MUP A;  1VB0 A;  3BT1 U;  5IMY C;  4BIK B;  1KS6 A;  1KBS A;  2I9B E;  1QM7 A;  1REW C;  1CXN A;  3LAQ U;  1HC9 B;  1JE9 A;  2PJY B;  1HAJ A;  1IDH A;  1QKD A;  2NBT A;  1HC9 A;  2H62 C;  1NYU A;  1CTX A;  1BTE A;  4ZQY A;  2H64 B;  1NYS A;  1S4Y A;  2X8B B;  3EBX A;  1KU6 B;  4HQP F;  1CDQ A;  1COE A;  1ERA A;  2N99 A;  1FSS B;  1KFH A;  2GOO C;  2PJY C;  1RGJ A;  3BT2 U;  3KFD I;  5DU1 A;  3ERA A;  1CDS A;  2L5S A;  2H62 D;  1CRF A;  1G6M A;  1H0J A;  2CCX A;  1PLO A;  1MAH F;  2H64 C;  1DRS A;  1ERG A;  2QJA C;  3HH7 A;  1TXA A;  1ES7 B;  5DZ5 A;  4KSN A;  5IMT D;  2MJ0 A;  2GOO B;  1KTZ B;  2K3G A;  1RL5 A;  1IDL A;  4AEA A;  1CRE A;  1I02 A;  1NEA A;  3PLC A;  3QB4 B;  1FFJ A;  2H7Z B;  2HLQ A;  2UX2 A;  1HOY A;  3U73 U;  1KL8 A;  1CCQ A;  1NXB A;  1IQ9 A;  1F94 A;  2H7Z A;  3EVS C;  1KC4 A;  1IKC A;  2CRT A;  2JVE A;  2MFA A;  4EY8 B;  1TFS A;  1F8U B;  1NOR A;  1CHV S;  1B41 B;  2L03 A;  1FAS A;  1CVO A;  1KXI A;  1CXO A;  1CB9 A;  2HLR A;  4XJJ A;  2MJ4 A;  2FD6 U;  1ONJ A;  1YWH A;  1FRA A;  1KBT A;  4FAO C;  2ABX A;  1ZAD A;  3VTS A;  1FF4 A;  3FEV A;  3NDS A;  1COD A;  4RUD A;  2LCR A;  4FAO E;  1IJC A;  2QC1 A;  2ERA A;  1MR6 A;  3U74 U;  2BHI A;  2CRS A; 
#chains in the Genus database with same CATH homology
 2MUO A;  4UY2 C;  1W6B A;  4LFT A;  2JQP A;  1QKE A;  1IK8 A;  2MJY A;  1LX5 B;  1NTN A;  2H8U A;  1V6P A;  1IDG A;  4IYE A;  1TGX A;  2LA1 A;  1IDI A;  1M9Z A;  4QTI U;  1LXG A;  1LJZ A;  1CDT A;  2QJB C;  2J8B A;  1LSI A;  4DO8 A;  1XT3 A;  1FSC A;  2CTX A;  2CDX A;  1JGK A;  1LXH A;  2UWR A;  5DO6 A;  1JBD A;  1HAA A;  2H5F A;  1BXP A;  4OM4 A;  1UG4 A;  3NH7 A;  4BDT B;  3KFD E;  5EBX A;  1ABT A;  2QJ9 C;  2VLW A;  3NEQ A;  1NTX A;  4P7U A;  2MHY A;  4OM5 A;  6EBX A;  1TXB A;  2OFS A;  1KBA A;  1CDR A;  1L4W A;  2BTX A;  2MUP A;  1VB0 A;  3BT1 U;  5IMY C;  4BIK B;  1KS6 A;  1KBS A;  2I9B E;  1QM7 A;  1REW C;  1CXN A;  3LAQ U;  1HC9 B;  1JE9 A;  2PJY B;  1HAJ A;  1IDH A;  1QKD A;  2NBT A;  1HC9 A;  2H62 C;  1NYU A;  1CTX A;  1BTE A;  4ZQY A;  2H64 B;  1NYS A;  1S4Y A;  2X8B B;  3EBX A;  1KU6 B;  4HQP F;  1CDQ A;  1COE A;  1ERA A;  2N99 A;  1FSS B;  1KFH A;  2GOO C;  2PJY C;  1RGJ A;  3BT2 U;  3KFD I;  5DU1 A;  3ERA A;  1CDS A;  2L5S A;  2H62 D;  1CRF A;  1G6M A;  1H0J A;  2CCX A;  1PLO A;  1MAH F;  2H64 C;  1DRS A;  1ERG A;  2QJA C;  3HH7 A;  1TXA A;  1ES7 B;  5DZ5 A;  4KSN A;  5IMT D;  2MJ0 A;  2GOO B;  1KTZ B;  2K3G A;  1RL5 A;  1IDL A;  4AEA A;  1CRE A;  1I02 A;  1NEA A;  3PLC A;  3QB4 B;  1FFJ A;  2H7Z B;  2HLQ A;  2UX2 A;  1HOY A;  3U73 U;  1KL8 A;  1CCQ A;  1NXB A;  1IQ9 A;  1F94 A;  2H7Z A;  3EVS C;  1KC4 A;  1IKC A;  2CRT A;  2JVE A;  2MFA A;  4EY8 B;  1TFS A;  1F8U B;  1NOR A;  1CHV S;  1B41 B;  2L03 A;  1FAS A;  1CVO A;  1KXI A;  1CXO A;  1CB9 A;  2HLR A;  4XJJ A;  2MJ4 A;  2FD6 U;  1ONJ A;  1YWH A;  1FRA A;  1KBT A;  4FAO C;  2ABX A;  1ZAD A;  3VTS A;  1FF4 A;  3FEV A;  3NDS A;  1COD A;  4RUD A;  2LCR A;  4FAO E;  1IJC A;  2QC1 A;  2ERA A;  1MR6 A;  3U74 U;  2BHI A;  2CRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...