4RUDA

Crystal structure of a three finger toxin
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
58
structure length
58
Chain Sequence
LKCYSSRTETMTCPEGEDKCEKYAVGLMHGSFFFIYTCTSKCHEGAYNVCCSTDLCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a three finger toxin from M fulvius
rcsb
molecule tags Toxin
molecule keywords Three-finger toxin 3b
total genus 9
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4rudA00
3NDSA 2QC1A 5EBXA 1CB9A 2LCRA 4IYEA 4BDTB 6EBXA 2VLWA 1KBSA 2HLRA 1W6BA 4RUDA 5IMTD 2PJYB 4BIKB 2UWRA 3LAQU 1NORA 2BHIA 4LFTA 2L5SA 3QB4B 4AEAA 1S4YA 1NXBA 2QJAC 3NH7A 1TGXA 1CDQA 4XJJA 1NEAA 2H7ZB 3VTSA 1IDGA 2H7ZA 2MHYA 1IDHA 1FF4A 1REWC 1DRSA 1RL5A 1PLOA 2MJ0A 2H64B 1IJCA 2K3GA 1CRFA 1CDSA 1KC4A 2N99A 2J8BA 4P7UA 1KU6B 1MAHF 4QTIU 1HC9B 2CDXA 1TXAA 5DU1A 1CHVS 1COEA 1CXOA 2LA1A 1JGKA 2UX2A 1CREA 1NTNA 2CTXA 2MUPA 1FFJA 2BTXA 1V6PA 1TFSA 4OM5A 1IKCA 3FEVA 1KBAA 4EY8B 2L03A 1F94A 3U74U 1KS6A 2CCXA 1KXIA 4HQPF 1HAJA 1KTZB 2JVEA 2GOOC 1QKEA 2NBTA 2MJYA 4FAOE 1UG4A 1KFHA 2PJYC 1L4WA 1KL8A 3KFDE 1ES7B 3ERAA 2OFSA 3HH7A 1IK8A 5IMYC 2ERAA 1JE9A 4FAOC 1B41B 1H0JA 2FD6U 3BT1U 1IQ9A 1LX5B 1KBTA 1NYSA 1ONJA 3PLCA 1CVOA 2X8BB 1ERGA 3U73U 1JBDA 1G6MA 3KFDI 4DO8A 2H64C 3EVSC 1FRAA 2QJBC 1LXHA 1MR6A 1TXBA 3NEQA 5DZ5A 1YWHA 1F8UB 1FASA 1HC9A 2HLQA 1HOYA 1IDLA 1LJZA 1FSCA 1BTEA 2ABXA 2H8UA 2I9BE 1HAAA 2CRSA 1LXGA 1IDIA 1CXNA 2H62D 1CDRA 1ABTA 2MUOA 1M9ZA 1VB0A 2H5FA 1CDTA 1QM7A 2QJ9C 1CCQA 4UY2C 1FSSB 1NTXA 2MFAA 1CODA 1BXPA 1I02A 4OM4A 1XT3A 2MJ4A 3EBXA 1ERAA 2JQPA 1QKDA 2H62C 2GOOB 1NYUA 3BT2U 1RGJA 1CTXA 5DO6A 1LSIA 2CRTA 4ZQYA 1ZADA
chains in the Genus database with same CATH superfamily
3NDSA 2QC1A 5EBXA 1CB9A 2LCRA 4IYEA 4BDTB 6EBXA 2VLWA 1KBSA 2HLRA 1W6BA 4RUDA 5IMTD 2PJYB 4BIKB 2UWRA 3LAQU 1NORA 2BHIA 4LFTA 2L5SA 3QB4B 4AEAA 1S4YA 1NXBA 2QJAC 3NH7A 1TGXA 1CDQA 4XJJA 1NEAA 2H7ZB 3VTSA 1IDGA 2H7ZA 2MHYA 1IDHA 1FF4A 1REWC 1DRSA 1RL5A 1PLOA 2MJ0A 2H64B 1IJCA 2K3GA 1CRFA 1CDSA 1KC4A 2N99A 2J8BA 4P7UA 1KU6B 1MAHF 4QTIU 1HC9B 2CDXA 1TXAA 5DU1A 1CHVS 1COEA 1CXOA 2LA1A 1JGKA 2UX2A 1CREA 1NTNA 2CTXA 2MUPA 1FFJA 2BTXA 1V6PA 1TFSA 4OM5A 1IKCA 3FEVA 1KBAA 4KSNA 4EY8B 2L03A 1F94A 3U74U 1KS6A 2CCXA 1KXIA 4HQPF 1HAJA 1KTZB 2JVEA 2GOOC 1QKEA 2NBTA 2MJYA 4FAOE 1UG4A 1KFHA 2PJYC 1L4WA 1KL8A 3KFDE 1ES7B 3ERAA 2OFSA 3HH7A 1IK8A 5IMYC 2ERAA 1JE9A 4FAOC 1B41B 1H0JA 2FD6U 3BT1U 1IQ9A 1LX5B 1KBTA 1NYSA 1ONJA 3PLCA 1CVOA 2X8BB 1ERGA 3U73U 1JBDA 1G6MA 3KFDI 4DO8A 2H64C 3EVSC 1FRAA 2QJBC 1LXHA 1MR6A 1TXBA 3NEQA 5DZ5A 1YWHA 1F8UB 1FASA 1HC9A 2HLQA 1HOYA 1IDLA 1LJZA 1FSCA 1BTEA 2ABXA 2H8UA 2I9BE 1HAAA 2CRSA 1LXGA 1IDIA 1CXNA 2H62D 1CDRA 1ABTA 2MUOA 1M9ZA 1VB0A 2H5FA 1CDTA 1QM7A 2QJ9C 1CCQA 4UY2C 1FSSB 1NTXA 2MFAA 1CODA 1BXPA 1I02A 4OM4A 1XT3A 2MJ4A 3EBXA 1ERAA 2JQPA 1QKDA 2H62C 2GOOB 1NYUA 3BT2U 1RGJA 1CTXA 5DO6A 1LSIA 2CRTA 4ZQYA 1ZADA
chains in the Genus database with same CATH topology
3NDSA 2QC1A 5EBXA 1CB9A 2LCRA 4IYEA 4BDTB 6EBXA 2VLWA 1KBSA 2HLRA 1W6BA 4RUDA 5IMTD 2PJYB 4BIKB 2UWRA 3LAQU 1NORA 2BHIA 4LFTA 2L5SA 3QB4B 4AEAA 1S4YA 1NXBA 2QJAC 3NH7A 1TGXA 1CDQA 4XJJA 1NEAA 2H7ZB 3VTSA 1IDGA 2H7ZA 2MHYA 1IDHA 1FF4A 1REWC 1DRSA 1RL5A 1PLOA 2MJ0A 2H64B 1IJCA 2K3GA 1CRFA 1CDSA 1KC4A 2N99A 2J8BA 4P7UA 1KU6B 1MAHF 4QTIU 1HC9B 2CDXA 1TXAA 5DU1A 1CHVS 1COEA 1CXOA 2LA1A 1JGKA 2UX2A 1CREA 1NTNA 2CTXA 2MUPA 1FFJA 2BTXA 1V6PA 1TFSA 4OM5A 1IKCA 3FEVA 1KBAA 4KSNA 4EY8B 2L03A 1F94A 3U74U 1KS6A 2CCXA 1KXIA 4HQPF 1HAJA 1KTZB 2JVEA 2GOOC 1QKEA 2NBTA 2MJYA 4FAOE 1UG4A 1KFHA 2PJYC 1L4WA 1KL8A 3KFDE 1ES7B 3ERAA 2OFSA 3HH7A 1IK8A 5IMYC 2ERAA 1JE9A 4FAOC 1B41B 1H0JA 2FD6U 3BT1U 1IQ9A 1LX5B 1KBTA 1NYSA 1ONJA 3PLCA 1CVOA 2X8BB 1ERGA 3U73U 1JBDA 1G6MA 3KFDI 4DO8A 2H64C 3EVSC 1FRAA 2QJBC 1LXHA 1MR6A 1TXBA 3NEQA 5DZ5A 1YWHA 1F8UB 1FASA 1HC9A 2HLQA 1HOYA 1IDLA 1LJZA 1FSCA 1BTEA 2ABXA 2H8UA 2I9BE 1HAAA 2CRSA 1LXGA 1IDIA 1CXNA 2H62D 1CDRA 1ABTA 2MUOA 1M9ZA 1VB0A 2H5FA 1CDTA 1QM7A 2QJ9C 1CCQA 4UY2C 1FSSB 1NTXA 2MFAA 1CODA 1BXPA 1I02A 4OM4A 1XT3A 2MJ4A 3EBXA 1ERAA 2JQPA 1QKDA 2H62C 2GOOB 1NYUA 3BT2U 1RGJA 1CTXA 5DO6A 1LSIA 2CRTA 4ZQYA 1ZADA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NDS A;  2QC1 A;  5EBX A;  1CB9 A;  2LCR A;  4IYE A;  4BDT B;  6EBX A;  2VLW A;  1KBS A;  2HLR A;  1W6B A;  4RUD A;  5IMT D;  2PJY B;  4BIK B;  2UWR A;  3LAQ U;  1NOR A;  2BHI A;  4LFT A;  2L5S A;  3QB4 B;  4AEA A;  1S4Y A;  1NXB A;  2QJA C;  3NH7 A;  1TGX A;  1CDQ A;  4XJJ A;  1NEA A;  2H7Z B;  3VTS A;  1IDG A;  2H7Z A;  2MHY A;  1IDH A;  1FF4 A;  1REW C;  1DRS A;  1RL5 A;  1PLO A;  2MJ0 A;  2H64 B;  1IJC A;  2K3G A;  1CRF A;  1CDS A;  1KC4 A;  2N99 A;  2J8B A;  4P7U A;  1KU6 B;  1MAH F;  4QTI U;  1HC9 B;  2CDX A;  1TXA A;  5DU1 A;  1CHV S;  1COE A;  1CXO A;  2LA1 A;  1JGK A;  2UX2 A;  1CRE A;  1NTN A;  2CTX A;  2MUP A;  1FFJ A;  2BTX A;  1V6P A;  1TFS A;  4OM5 A;  1IKC A;  3FEV A;  1KBA A;  4EY8 B;  2L03 A;  1F94 A;  3U74 U;  1KS6 A;  2CCX A;  1KXI A;  4HQP F;  1HAJ A;  1KTZ B;  2JVE A;  2GOO C;  1QKE A;  2NBT A;  2MJY A;  4FAO E;  1UG4 A;  1KFH A;  2PJY C;  1L4W A;  1KL8 A;  3KFD E;  1ES7 B;  3ERA A;  2OFS A;  3HH7 A;  1IK8 A;  5IMY C;  2ERA A;  1JE9 A;  4FAO C;  1B41 B;  1H0J A;  2FD6 U;  3BT1 U;  1IQ9 A;  1LX5 B;  1KBT A;  1NYS A;  1ONJ A;  3PLC A;  1CVO A;  2X8B B;  1ERG A;  3U73 U;  1JBD A;  1G6M A;  3KFD I;  4DO8 A;  2H64 C;  3EVS C;  1FRA A;  2QJB C;  1LXH A;  1MR6 A;  1TXB A;  3NEQ A;  5DZ5 A;  1YWH A;  1F8U B;  1FAS A;  1HC9 A;  2HLQ A;  1HOY A;  1IDL A;  1LJZ A;  1FSC A;  1BTE A;  2ABX A;  2H8U A;  2I9B E;  1HAA A;  2CRS A;  1LXG A;  1IDI A;  1CXN A;  2H62 D;  1CDR A;  1ABT A;  2MUO A;  1M9Z A;  1VB0 A;  2H5F A;  1CDT A;  1QM7 A;  2QJ9 C;  1CCQ A;  4UY2 C;  1FSS B;  1NTX A;  2MFA A;  1COD A;  1BXP A;  1I02 A;  4OM4 A;  1XT3 A;  2MJ4 A;  3EBX A;  1ERA A;  2JQP A;  1QKD A;  2H62 C;  2GOO B;  1NYU A;  3BT2 U;  1RGJ A;  1CTX A;  5DO6 A;  1LSI A;  2CRT A;  4ZQY A;  1ZAD A; 
#chains in the Genus database with same CATH topology
 3NDS A;  2QC1 A;  5EBX A;  1CB9 A;  2LCR A;  4IYE A;  4BDT B;  6EBX A;  2VLW A;  1KBS A;  2HLR A;  1W6B A;  4RUD A;  5IMT D;  2PJY B;  4BIK B;  2UWR A;  3LAQ U;  1NOR A;  2BHI A;  4LFT A;  2L5S A;  3QB4 B;  4AEA A;  1S4Y A;  1NXB A;  2QJA C;  3NH7 A;  1TGX A;  1CDQ A;  4XJJ A;  1NEA A;  2H7Z B;  3VTS A;  1IDG A;  2H7Z A;  2MHY A;  1IDH A;  1FF4 A;  1REW C;  1DRS A;  1RL5 A;  1PLO A;  2MJ0 A;  2H64 B;  1IJC A;  2K3G A;  1CRF A;  1CDS A;  1KC4 A;  2N99 A;  2J8B A;  4P7U A;  1KU6 B;  1MAH F;  4QTI U;  1HC9 B;  2CDX A;  1TXA A;  5DU1 A;  1CHV S;  1COE A;  1CXO A;  2LA1 A;  1JGK A;  2UX2 A;  1CRE A;  1NTN A;  2CTX A;  2MUP A;  1FFJ A;  2BTX A;  1V6P A;  1TFS A;  4OM5 A;  1IKC A;  3FEV A;  1KBA A;  4KSN A;  4EY8 B;  2L03 A;  1F94 A;  3U74 U;  1KS6 A;  2CCX A;  1KXI A;  4HQP F;  1HAJ A;  1KTZ B;  2JVE A;  2GOO C;  1QKE A;  2NBT A;  2MJY A;  4FAO E;  1UG4 A;  1KFH A;  2PJY C;  1L4W A;  1KL8 A;  3KFD E;  1ES7 B;  3ERA A;  2OFS A;  3HH7 A;  1IK8 A;  5IMY C;  2ERA A;  1JE9 A;  4FAO C;  1B41 B;  1H0J A;  2FD6 U;  3BT1 U;  1IQ9 A;  1LX5 B;  1KBT A;  1NYS A;  1ONJ A;  3PLC A;  1CVO A;  2X8B B;  1ERG A;  3U73 U;  1JBD A;  1G6M A;  3KFD I;  4DO8 A;  2H64 C;  3EVS C;  1FRA A;  2QJB C;  1LXH A;  1MR6 A;  1TXB A;  3NEQ A;  5DZ5 A;  1YWH A;  1F8U B;  1FAS A;  1HC9 A;  2HLQ A;  1HOY A;  1IDL A;  1LJZ A;  1FSC A;  1BTE A;  2ABX A;  2H8U A;  2I9B E;  1HAA A;  2CRS A;  1LXG A;  1IDI A;  1CXN A;  2H62 D;  1CDR A;  1ABT A;  2MUO A;  1M9Z A;  1VB0 A;  2H5F A;  1CDT A;  1QM7 A;  2QJ9 C;  1CCQ A;  4UY2 C;  1FSS B;  1NTX A;  2MFA A;  1COD A;  1BXP A;  1I02 A;  4OM4 A;  1XT3 A;  2MJ4 A;  3EBX A;  1ERA A;  2JQP A;  1QKD A;  2H62 C;  2GOO B;  1NYU A;  3BT2 U;  1RGJ A;  1CTX A;  5DO6 A;  1LSI A;  2CRT A;  4ZQY A;  1ZAD A; 
#chains in the Genus database with same CATH homology
 3NDS A;  2QC1 A;  5EBX A;  1CB9 A;  2LCR A;  4IYE A;  4BDT B;  6EBX A;  2VLW A;  1KBS A;  2HLR A;  1W6B A;  4RUD A;  5IMT D;  2PJY B;  4BIK B;  2UWR A;  3LAQ U;  1NOR A;  2BHI A;  4LFT A;  2L5S A;  3QB4 B;  4AEA A;  1S4Y A;  1NXB A;  2QJA C;  3NH7 A;  1TGX A;  1CDQ A;  4XJJ A;  1NEA A;  2H7Z B;  3VTS A;  1IDG A;  2H7Z A;  2MHY A;  1IDH A;  1FF4 A;  1REW C;  1DRS A;  1RL5 A;  1PLO A;  2MJ0 A;  2H64 B;  1IJC A;  2K3G A;  1CRF A;  1CDS A;  1KC4 A;  2N99 A;  2J8B A;  4P7U A;  1KU6 B;  1MAH F;  4QTI U;  1HC9 B;  2CDX A;  1TXA A;  5DU1 A;  1CHV S;  1COE A;  1CXO A;  2LA1 A;  1JGK A;  2UX2 A;  1CRE A;  1NTN A;  2CTX A;  2MUP A;  1FFJ A;  2BTX A;  1V6P A;  1TFS A;  4OM5 A;  1IKC A;  3FEV A;  1KBA A;  4KSN A;  4EY8 B;  2L03 A;  1F94 A;  3U74 U;  1KS6 A;  2CCX A;  1KXI A;  4HQP F;  1HAJ A;  1KTZ B;  2JVE A;  2GOO C;  1QKE A;  2NBT A;  2MJY A;  4FAO E;  1UG4 A;  1KFH A;  2PJY C;  1L4W A;  1KL8 A;  3KFD E;  1ES7 B;  3ERA A;  2OFS A;  3HH7 A;  1IK8 A;  5IMY C;  2ERA A;  1JE9 A;  4FAO C;  1B41 B;  1H0J A;  2FD6 U;  3BT1 U;  1IQ9 A;  1LX5 B;  1KBT A;  1NYS A;  1ONJ A;  3PLC A;  1CVO A;  2X8B B;  1ERG A;  3U73 U;  1JBD A;  1G6M A;  3KFD I;  4DO8 A;  2H64 C;  3EVS C;  1FRA A;  2QJB C;  1LXH A;  1MR6 A;  1TXB A;  3NEQ A;  5DZ5 A;  1YWH A;  1F8U B;  1FAS A;  1HC9 A;  2HLQ A;  1HOY A;  1IDL A;  1LJZ A;  1FSC A;  1BTE A;  2ABX A;  2H8U A;  2I9B E;  1HAA A;  2CRS A;  1LXG A;  1IDI A;  1CXN A;  2H62 D;  1CDR A;  1ABT A;  2MUO A;  1M9Z A;  1VB0 A;  2H5F A;  1CDT A;  1QM7 A;  2QJ9 C;  1CCQ A;  4UY2 C;  1FSS B;  1NTX A;  2MFA A;  1COD A;  1BXP A;  1I02 A;  4OM4 A;  1XT3 A;  2MJ4 A;  3EBX A;  1ERA A;  2JQP A;  1QKD A;  2H62 C;  2GOO B;  1NYU A;  3BT2 U;  1RGJ A;  1CTX A;  5DO6 A;  1LSI A;  2CRT A;  4ZQY A;  1ZAD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...