2K3GA

Nmr structure analysis of a bmp receptor
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
102
structure length
102
Chain Sequence
GPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1A
publication title The solution structure of BMPR-IA reveals a local disorder-to-order transition upon BMP-2 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2k3gA00
1LSIA 2H7ZA 2LCRA 1ABTA 1XT3A 2H62D 2H8UA 5DO6A 1KBAA 1NTXA 1HC9A 4EY8B 3PLCA 1FSCA 1LXGA 2CDXA 2CTXA 1ERGA 1QKEA 2ABXA 1FF4A 1KBSA 1NYUA 1RGJA 1TFSA 2QJBC 2MHYA 1REWC 2VLWA 1IJCA 2H64B 2N99A 2OFSA 2UX2A 1YWHA 1LXHA 2CCXA 2H7ZB 4P7UA 1IKCA 3HH7A 4DO8A 1VB0A 3U74U 1TGXA 1W6BA 1HC9B 2MJYA 1CDQA 1HOYA 1NYSA 2PJYB 1NXBA 2J8BA 1DRSA 1CVOA 2L03A 3KFDE 3EVSC 2H64C 4RUDA 1COEA 2L5SA 2HLQA 5IMYC 2QJAC 2CRTA 1JGKA 1PLOA 5EBXA 4BDTB 3VTSA 2MJ0A 1NTNA 1IDIA 1CDSA 1TXAA 1LX5B 1KU6B 1TXBA 2H62C 1S4YA 4ZQYA 1FRAA 1IK8A 1KS6A 1KXIA 2I9BE 2JVEA 1B41B 1BTEA 1CREA 2MUPA 1KC4A 1ONJA 2PJYC 2X8BB 1IDHA 1IDGA 4AEAA 4UY2C 3LAQU 2LA1A 5DU1A 2H5FA 1F8UB 4FAOE 1I02A 2QC1A 6EBXA 1CXOA 1IDLA 4BIKB 5DZ5A 1LJZA 1HAJA 3BT2U 1HAAA 1KL8A 2JQPA 1UG4A 4XJJA 1MR6A 4LFTA 4HQPF 1IQ9A 1ES7B 3KFDI 2GOOC 1ZADA 4FAOC 2MJ4A 1NORA 1CDRA 1F94A 2BTXA 1JE9A 4OM5A 1FSSB 1CB9A 1CCQA 2NBTA 3EBXA 1H0JA 2FD6U 2QJ9C 2GOOB 2BHIA 2MUOA 4OM4A 1CHVS 4IYEA 1NEAA 1QM7A 1CTXA 3FEVA 2ERAA 1BXPA 1FFJA 3U73U 1ERAA 2MFAA 1MAHF 1CDTA 2CRSA 1JBDA 3QB4B 1KBTA 1QKDA 1V6PA 1RL5A 2K3GA 3NH7A 1CODA 5IMTD 3NDSA 1KTZB 2UWRA 2HLRA 1G6MA 1KFHA 1L4WA 1CRFA 3NEQA 3ERAA 3BT1U 1M9ZA 4QTIU 1CXNA 1FASA
chains in the Genus database with same CATH superfamily
1LSIA 2H7ZA 2LCRA 1ABTA 1XT3A 2H62D 2H8UA 5DO6A 1KBAA 1NTXA 1HC9A 4EY8B 3PLCA 1FSCA 1LXGA 2CDXA 2CTXA 1ERGA 1QKEA 2ABXA 1FF4A 1KBSA 1NYUA 1RGJA 1TFSA 2QJBC 2MHYA 1REWC 2VLWA 1IJCA 2H64B 2N99A 2OFSA 2UX2A 1YWHA 1LXHA 2CCXA 4KSNA 2H7ZB 4P7UA 1IKCA 3HH7A 4DO8A 1VB0A 3U74U 1TGXA 1W6BA 1HC9B 2MJYA 1CDQA 1HOYA 1NYSA 2PJYB 1NXBA 2J8BA 1DRSA 1CVOA 2L03A 3KFDE 3EVSC 2H64C 4RUDA 1COEA 2L5SA 2HLQA 5IMYC 2QJAC 2CRTA 1JGKA 1PLOA 5EBXA 4BDTB 3VTSA 2MJ0A 1NTNA 1IDIA 1CDSA 1TXAA 1LX5B 1KU6B 1TXBA 2H62C 1S4YA 4ZQYA 1FRAA 1IK8A 1KS6A 1KXIA 2I9BE 2JVEA 1B41B 1BTEA 1CREA 2MUPA 1KC4A 1ONJA 2PJYC 2X8BB 1IDHA 1IDGA 4AEAA 4UY2C 3LAQU 2LA1A 5DU1A 2H5FA 1F8UB 4FAOE 1I02A 2QC1A 6EBXA 1CXOA 1IDLA 4BIKB 5DZ5A 1LJZA 1HAJA 3BT2U 1HAAA 1KL8A 2JQPA 1UG4A 4XJJA 1MR6A 4LFTA 4HQPF 1IQ9A 1ES7B 3KFDI 2GOOC 1ZADA 4FAOC 2MJ4A 1NORA 1CDRA 1F94A 2BTXA 1JE9A 4OM5A 1FSSB 1CB9A 1CCQA 2NBTA 3EBXA 1H0JA 2FD6U 2QJ9C 2GOOB 2BHIA 2MUOA 4OM4A 1CHVS 4IYEA 1NEAA 1QM7A 1CTXA 3FEVA 2ERAA 1BXPA 1FFJA 3U73U 1ERAA 2MFAA 1MAHF 1CDTA 2CRSA 1JBDA 3QB4B 1KBTA 1QKDA 1V6PA 1RL5A 2K3GA 3NH7A 1CODA 5IMTD 3NDSA 1KTZB 2UWRA 2HLRA 1G6MA 1KFHA 1L4WA 1CRFA 3NEQA 3ERAA 3BT1U 1M9ZA 4QTIU 1CXNA 1FASA
chains in the Genus database with same CATH topology
1LSIA 2H7ZA 2LCRA 1ABTA 1XT3A 2H62D 2H8UA 5DO6A 1KBAA 1NTXA 1HC9A 4EY8B 3PLCA 1FSCA 1LXGA 2CDXA 2CTXA 1ERGA 1QKEA 2ABXA 1FF4A 1KBSA 1NYUA 1RGJA 1TFSA 2QJBC 2MHYA 1REWC 2VLWA 1IJCA 2H64B 2N99A 2OFSA 2UX2A 1YWHA 1LXHA 2CCXA 4KSNA 2H7ZB 4P7UA 1IKCA 3HH7A 4DO8A 1VB0A 3U74U 1TGXA 1W6BA 1HC9B 2MJYA 1CDQA 1HOYA 1NYSA 2PJYB 1NXBA 2J8BA 1DRSA 1CVOA 2L03A 3KFDE 3EVSC 2H64C 4RUDA 1COEA 2L5SA 2HLQA 5IMYC 2QJAC 2CRTA 1JGKA 1PLOA 5EBXA 4BDTB 3VTSA 2MJ0A 1NTNA 1IDIA 1CDSA 1TXAA 1LX5B 1KU6B 1TXBA 2H62C 1S4YA 4ZQYA 1FRAA 1IK8A 1KS6A 1KXIA 2I9BE 2JVEA 1B41B 1BTEA 1CREA 2MUPA 1KC4A 1ONJA 2PJYC 2X8BB 1IDHA 1IDGA 4AEAA 4UY2C 3LAQU 2LA1A 5DU1A 2H5FA 1F8UB 4FAOE 1I02A 2QC1A 6EBXA 1CXOA 1IDLA 4BIKB 5DZ5A 1LJZA 1HAJA 3BT2U 1HAAA 1KL8A 2JQPA 1UG4A 4XJJA 1MR6A 4LFTA 4HQPF 1IQ9A 1ES7B 3KFDI 2GOOC 1ZADA 4FAOC 2MJ4A 1NORA 1CDRA 1F94A 2BTXA 1JE9A 4OM5A 1FSSB 1CB9A 1CCQA 2NBTA 3EBXA 1H0JA 2FD6U 2QJ9C 2GOOB 2BHIA 2MUOA 4OM4A 1CHVS 4IYEA 1NEAA 1QM7A 1CTXA 3FEVA 2ERAA 1BXPA 1FFJA 3U73U 1ERAA 2MFAA 1MAHF 1CDTA 2CRSA 1JBDA 3QB4B 1KBTA 1QKDA 1V6PA 1RL5A 2K3GA 3NH7A 1CODA 5IMTD 3NDSA 1KTZB 2UWRA 2HLRA 1G6MA 1KFHA 1L4WA 1CRFA 3NEQA 3ERAA 3BT1U 1M9ZA 4QTIU 1CXNA 1FASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSI A;  2H7Z A;  2LCR A;  1ABT A;  1XT3 A;  2H62 D;  2H8U A;  5DO6 A;  1KBA A;  1NTX A;  1HC9 A;  4EY8 B;  3PLC A;  1FSC A;  1LXG A;  2CDX A;  2CTX A;  1ERG A;  1QKE A;  2ABX A;  1FF4 A;  1KBS A;  1NYU A;  1RGJ A;  1TFS A;  2QJB C;  2MHY A;  1REW C;  2VLW A;  1IJC A;  2H64 B;  2N99 A;  2OFS A;  2UX2 A;  1YWH A;  1LXH A;  2CCX A;  2H7Z B;  4P7U A;  1IKC A;  3HH7 A;  4DO8 A;  1VB0 A;  3U74 U;  1TGX A;  1W6B A;  1HC9 B;  2MJY A;  1CDQ A;  1HOY A;  1NYS A;  2PJY B;  1NXB A;  2J8B A;  1DRS A;  1CVO A;  2L03 A;  3KFD E;  3EVS C;  2H64 C;  4RUD A;  1COE A;  2L5S A;  2HLQ A;  5IMY C;  2QJA C;  2CRT A;  1JGK A;  1PLO A;  5EBX A;  4BDT B;  3VTS A;  2MJ0 A;  1NTN A;  1IDI A;  1CDS A;  1TXA A;  1LX5 B;  1KU6 B;  1TXB A;  2H62 C;  1S4Y A;  4ZQY A;  1FRA A;  1IK8 A;  1KS6 A;  1KXI A;  2I9B E;  2JVE A;  1B41 B;  1BTE A;  1CRE A;  2MUP A;  1KC4 A;  1ONJ A;  2PJY C;  2X8B B;  1IDH A;  1IDG A;  4AEA A;  4UY2 C;  3LAQ U;  2LA1 A;  5DU1 A;  2H5F A;  1F8U B;  4FAO E;  1I02 A;  2QC1 A;  6EBX A;  1CXO A;  1IDL A;  4BIK B;  5DZ5 A;  1LJZ A;  1HAJ A;  3BT2 U;  1HAA A;  1KL8 A;  2JQP A;  1UG4 A;  4XJJ A;  1MR6 A;  4LFT A;  4HQP F;  1IQ9 A;  1ES7 B;  3KFD I;  2GOO C;  1ZAD A;  4FAO C;  2MJ4 A;  1NOR A;  1CDR A;  1F94 A;  2BTX A;  1JE9 A;  4OM5 A;  1FSS B;  1CB9 A;  1CCQ A;  2NBT A;  3EBX A;  1H0J A;  2FD6 U;  2QJ9 C;  2GOO B;  2BHI A;  2MUO A;  4OM4 A;  1CHV S;  4IYE A;  1NEA A;  1QM7 A;  1CTX A;  3FEV A;  2ERA A;  1BXP A;  1FFJ A;  3U73 U;  1ERA A;  2MFA A;  1MAH F;  1CDT A;  2CRS A;  1JBD A;  3QB4 B;  1KBT A;  1QKD A;  1V6P A;  1RL5 A;  2K3G A;  3NH7 A;  1COD A;  5IMT D;  3NDS A;  1KTZ B;  2UWR A;  2HLR A;  1G6M A;  1KFH A;  1L4W A;  1CRF A;  3NEQ A;  3ERA A;  3BT1 U;  1M9Z A;  4QTI U;  1CXN A;  1FAS A; 
#chains in the Genus database with same CATH topology
 1LSI A;  2H7Z A;  2LCR A;  1ABT A;  1XT3 A;  2H62 D;  2H8U A;  5DO6 A;  1KBA A;  1NTX A;  1HC9 A;  4EY8 B;  3PLC A;  1FSC A;  1LXG A;  2CDX A;  2CTX A;  1ERG A;  1QKE A;  2ABX A;  1FF4 A;  1KBS A;  1NYU A;  1RGJ A;  1TFS A;  2QJB C;  2MHY A;  1REW C;  2VLW A;  1IJC A;  2H64 B;  2N99 A;  2OFS A;  2UX2 A;  1YWH A;  1LXH A;  2CCX A;  4KSN A;  2H7Z B;  4P7U A;  1IKC A;  3HH7 A;  4DO8 A;  1VB0 A;  3U74 U;  1TGX A;  1W6B A;  1HC9 B;  2MJY A;  1CDQ A;  1HOY A;  1NYS A;  2PJY B;  1NXB A;  2J8B A;  1DRS A;  1CVO A;  2L03 A;  3KFD E;  3EVS C;  2H64 C;  4RUD A;  1COE A;  2L5S A;  2HLQ A;  5IMY C;  2QJA C;  2CRT A;  1JGK A;  1PLO A;  5EBX A;  4BDT B;  3VTS A;  2MJ0 A;  1NTN A;  1IDI A;  1CDS A;  1TXA A;  1LX5 B;  1KU6 B;  1TXB A;  2H62 C;  1S4Y A;  4ZQY A;  1FRA A;  1IK8 A;  1KS6 A;  1KXI A;  2I9B E;  2JVE A;  1B41 B;  1BTE A;  1CRE A;  2MUP A;  1KC4 A;  1ONJ A;  2PJY C;  2X8B B;  1IDH A;  1IDG A;  4AEA A;  4UY2 C;  3LAQ U;  2LA1 A;  5DU1 A;  2H5F A;  1F8U B;  4FAO E;  1I02 A;  2QC1 A;  6EBX A;  1CXO A;  1IDL A;  4BIK B;  5DZ5 A;  1LJZ A;  1HAJ A;  3BT2 U;  1HAA A;  1KL8 A;  2JQP A;  1UG4 A;  4XJJ A;  1MR6 A;  4LFT A;  4HQP F;  1IQ9 A;  1ES7 B;  3KFD I;  2GOO C;  1ZAD A;  4FAO C;  2MJ4 A;  1NOR A;  1CDR A;  1F94 A;  2BTX A;  1JE9 A;  4OM5 A;  1FSS B;  1CB9 A;  1CCQ A;  2NBT A;  3EBX A;  1H0J A;  2FD6 U;  2QJ9 C;  2GOO B;  2BHI A;  2MUO A;  4OM4 A;  1CHV S;  4IYE A;  1NEA A;  1QM7 A;  1CTX A;  3FEV A;  2ERA A;  1BXP A;  1FFJ A;  3U73 U;  1ERA A;  2MFA A;  1MAH F;  1CDT A;  2CRS A;  1JBD A;  3QB4 B;  1KBT A;  1QKD A;  1V6P A;  1RL5 A;  2K3G A;  3NH7 A;  1COD A;  5IMT D;  3NDS A;  1KTZ B;  2UWR A;  2HLR A;  1G6M A;  1KFH A;  1L4W A;  1CRF A;  3NEQ A;  3ERA A;  3BT1 U;  1M9Z A;  4QTI U;  1CXN A;  1FAS A; 
#chains in the Genus database with same CATH homology
 1LSI A;  2H7Z A;  2LCR A;  1ABT A;  1XT3 A;  2H62 D;  2H8U A;  5DO6 A;  1KBA A;  1NTX A;  1HC9 A;  4EY8 B;  3PLC A;  1FSC A;  1LXG A;  2CDX A;  2CTX A;  1ERG A;  1QKE A;  2ABX A;  1FF4 A;  1KBS A;  1NYU A;  1RGJ A;  1TFS A;  2QJB C;  2MHY A;  1REW C;  2VLW A;  1IJC A;  2H64 B;  2N99 A;  2OFS A;  2UX2 A;  1YWH A;  1LXH A;  2CCX A;  4KSN A;  2H7Z B;  4P7U A;  1IKC A;  3HH7 A;  4DO8 A;  1VB0 A;  3U74 U;  1TGX A;  1W6B A;  1HC9 B;  2MJY A;  1CDQ A;  1HOY A;  1NYS A;  2PJY B;  1NXB A;  2J8B A;  1DRS A;  1CVO A;  2L03 A;  3KFD E;  3EVS C;  2H64 C;  4RUD A;  1COE A;  2L5S A;  2HLQ A;  5IMY C;  2QJA C;  2CRT A;  1JGK A;  1PLO A;  5EBX A;  4BDT B;  3VTS A;  2MJ0 A;  1NTN A;  1IDI A;  1CDS A;  1TXA A;  1LX5 B;  1KU6 B;  1TXB A;  2H62 C;  1S4Y A;  4ZQY A;  1FRA A;  1IK8 A;  1KS6 A;  1KXI A;  2I9B E;  2JVE A;  1B41 B;  1BTE A;  1CRE A;  2MUP A;  1KC4 A;  1ONJ A;  2PJY C;  2X8B B;  1IDH A;  1IDG A;  4AEA A;  4UY2 C;  3LAQ U;  2LA1 A;  5DU1 A;  2H5F A;  1F8U B;  4FAO E;  1I02 A;  2QC1 A;  6EBX A;  1CXO A;  1IDL A;  4BIK B;  5DZ5 A;  1LJZ A;  1HAJ A;  3BT2 U;  1HAA A;  1KL8 A;  2JQP A;  1UG4 A;  4XJJ A;  1MR6 A;  4LFT A;  4HQP F;  1IQ9 A;  1ES7 B;  3KFD I;  2GOO C;  1ZAD A;  4FAO C;  2MJ4 A;  1NOR A;  1CDR A;  1F94 A;  2BTX A;  1JE9 A;  4OM5 A;  1FSS B;  1CB9 A;  1CCQ A;  2NBT A;  3EBX A;  1H0J A;  2FD6 U;  2QJ9 C;  2GOO B;  2BHI A;  2MUO A;  4OM4 A;  1CHV S;  4IYE A;  1NEA A;  1QM7 A;  1CTX A;  3FEV A;  2ERA A;  1BXP A;  1FFJ A;  3U73 U;  1ERA A;  2MFA A;  1MAH F;  1CDT A;  2CRS A;  1JBD A;  3QB4 B;  1KBT A;  1QKD A;  1V6P A;  1RL5 A;  2K3G A;  3NH7 A;  1COD A;  5IMT D;  3NDS A;  1KTZ B;  2UWR A;  2HLR A;  1G6M A;  1KFH A;  1L4W A;  1CRF A;  3NEQ A;  3ERA A;  3BT1 U;  1M9Z A;  4QTI U;  1CXN A;  1FAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...