2K3GA

Nmr structure analysis of a bmp receptor
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
102
structure length
102
Chain Sequence
GPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein receptor type-1A
publication title The solution structure of BMPR-IA reveals a local disorder-to-order transition upon BMP-2 binding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2k3gA00
2ERAA 1G6MA 3FEVA 2GOOB 2JQPA 5DO6A 4BIKB 1CRFA 1MAHF 3U73U 2VLWA 5IMTD 1KU6B 1JE9A 3ERAA 1BTEA 2N99A 1JBDA 1B41B 1KBSA 4UY2C 2H8UA 1F94A 1ERAA 4OM4A 4OM5A 2JVEA 3EVSC 1KL8A 4BDTB 1CB9A 1CVOA 1TFSA 2MJ4A 3PLCA 4QTIU 1IJCA 1CDQA 1FRAA 5EBXA 4FAOC 1HAJA 4EY8B 3BT1U 1NEAA 3EBXA 1NTXA 2H62D 2CRTA 1QKDA 3LAQU 2H7ZA 1IDHA 2LCRA 1RGJA 1NTNA 4FAOE 2H7ZB 4DO8A 2CRSA 3QB4B 1KS6A 4RUDA 1I02A 1KFHA 1REWC 1HC9A 4P7UA 1UG4A 2QJBC 1V6PA 1DRSA 1HC9B 2MJ0A 1FFJA 1CXNA 2HLRA 4AEAA 3VTSA 2BHIA 1L4WA 2L03A 3NEQA 1H0JA 1IDIA 1NORA 4ZQYA 1ABTA 1ERGA 1FASA 2CTXA 1MR6A 1PLOA 1W6BA 1IDLA 1KC4A 1CDSA 3KFDE 2L5SA 1KXIA 6EBXA 2LA1A 2HLQA 2CCXA 1NXBA 1CHVS 2QC1A 1CODA 2H64C 1QKEA 1TXBA 2UWRA 1KBAA 2CDXA 2MUPA 1CREA 2UX2A 2OFSA 4LFTA 2MFAA 2PJYB 2ABXA 1IK8A 1FSSB 1ZADA 2FD6U 2H64B 1ONJA 2H5FA 2QJAC 1RL5A 1FF4A 1JGKA 2H62C 1IQ9A 3BT2U 1TXAA 1M9ZA 1TGXA 2MJYA 3HH7A 2MHYA 1YWHA 5DU1A 5IMYC 2J8BA 1CDRA 1KBTA 1LSIA 3NH7A 1CCQA 2MUOA 1CTXA 1KTZB 1LXGA 1COEA 4IYEA 1HAAA 2BTXA 2PJYC 1NYUA 2I9BE 1IKCA 2X8BB 1S4YA 1LJZA 1BXPA 2K3GA 1CXOA 1F8UB 2QJ9C 1XT3A 4XJJA 3U74U 1QM7A 1LXHA 3NDSA 1IDGA 1HOYA 4HQPF 2GOOC 3KFDI 5DZ5A 1FSCA 1NYSA 1LX5B 2NBTA 1CDTA 1VB0A 1ES7B
chains in the Genus database with same CATH superfamily
2ERAA 1G6MA 3FEVA 2GOOB 2JQPA 5DO6A 4BIKB 1CRFA 1MAHF 3U73U 2VLWA 5IMTD 1KU6B 1JE9A 3ERAA 1BTEA 2N99A 1JBDA 1B41B 1KBSA 4UY2C 2H8UA 1F94A 1ERAA 4OM4A 4OM5A 2JVEA 3EVSC 1KL8A 4BDTB 1CB9A 1CVOA 1TFSA 2MJ4A 3PLCA 4QTIU 4KSNA 1IJCA 1CDQA 5EBXA 1FRAA 4FAOC 1HAJA 4EY8B 3BT1U 1NEAA 3EBXA 1NTXA 2H62D 2CRTA 1QKDA 3LAQU 2H7ZA 1IDHA 2LCRA 1RGJA 1NTNA 4FAOE 2H7ZB 4DO8A 2CRSA 3QB4B 1KS6A 4RUDA 1I02A 1KFHA 1REWC 1HC9A 4P7UA 1UG4A 2QJBC 1V6PA 1DRSA 1HC9B 2MJ0A 1FFJA 1CXNA 2HLRA 4AEAA 3VTSA 2BHIA 1L4WA 2L03A 3NEQA 1H0JA 1IDIA 1NORA 4ZQYA 1ABTA 1ERGA 1FASA 2CTXA 1MR6A 1PLOA 1W6BA 1IDLA 1KC4A 1CDSA 3KFDE 2L5SA 1KXIA 6EBXA 2LA1A 2HLQA 2CCXA 1NXBA 1CHVS 2QC1A 1CODA 2H64C 1QKEA 1TXBA 2UWRA 1KBAA 2CDXA 2MUPA 1CREA 2UX2A 2OFSA 4LFTA 2MFAA 2PJYB 2ABXA 1IK8A 1FSSB 1ZADA 2FD6U 2H64B 1ONJA 2H5FA 2QJAC 1RL5A 1FF4A 1JGKA 2H62C 1IQ9A 3BT2U 1TXAA 1M9ZA 1TGXA 2MJYA 3HH7A 2MHYA 1YWHA 5DU1A 5IMYC 2J8BA 1CDRA 1KBTA 1LSIA 3NH7A 1CCQA 2MUOA 1CTXA 1KTZB 1LXGA 1COEA 4IYEA 1HAAA 2BTXA 2PJYC 1NYUA 2I9BE 1IKCA 2X8BB 1S4YA 1LJZA 1BXPA 2K3GA 1CXOA 1F8UB 2QJ9C 1XT3A 4XJJA 3U74U 1QM7A 1LXHA 3NDSA 1IDGA 1HOYA 4HQPF 2GOOC 3KFDI 5DZ5A 1FSCA 1NYSA 1LX5B 2NBTA 1CDTA 1VB0A 1ES7B
chains in the Genus database with same CATH topology
2ERAA 1G6MA 3FEVA 2GOOB 2JQPA 5DO6A 4BIKB 1CRFA 1MAHF 3U73U 2VLWA 5IMTD 1KU6B 1JE9A 3ERAA 1BTEA 2N99A 1JBDA 1B41B 1KBSA 4UY2C 2H8UA 1F94A 1ERAA 4OM4A 4OM5A 2JVEA 3EVSC 1KL8A 4BDTB 1CB9A 1CVOA 1TFSA 2MJ4A 3PLCA 4QTIU 4KSNA 1IJCA 1CDQA 5EBXA 1FRAA 4FAOC 1HAJA 4EY8B 3BT1U 1NEAA 3EBXA 1NTXA 2H62D 2CRTA 1QKDA 3LAQU 2H7ZA 1IDHA 2LCRA 1RGJA 1NTNA 4FAOE 2H7ZB 4DO8A 2CRSA 3QB4B 1KS6A 4RUDA 1I02A 1KFHA 1REWC 1HC9A 4P7UA 1UG4A 2QJBC 1V6PA 1DRSA 1HC9B 2MJ0A 1FFJA 1CXNA 2HLRA 4AEAA 3VTSA 2BHIA 1L4WA 2L03A 3NEQA 1H0JA 1IDIA 1NORA 4ZQYA 1ABTA 1ERGA 1FASA 2CTXA 1MR6A 1PLOA 1W6BA 1IDLA 1KC4A 1CDSA 3KFDE 2L5SA 1KXIA 6EBXA 2LA1A 2HLQA 2CCXA 1NXBA 1CHVS 2QC1A 1CODA 2H64C 1QKEA 1TXBA 2UWRA 1KBAA 2CDXA 2MUPA 1CREA 2UX2A 2OFSA 4LFTA 2MFAA 2PJYB 2ABXA 1IK8A 1FSSB 1ZADA 2FD6U 2H64B 1ONJA 2H5FA 2QJAC 1RL5A 1FF4A 1JGKA 2H62C 1IQ9A 3BT2U 1TXAA 1M9ZA 1TGXA 2MJYA 3HH7A 2MHYA 1YWHA 5DU1A 5IMYC 2J8BA 1CDRA 1KBTA 1LSIA 3NH7A 1CCQA 2MUOA 1CTXA 1KTZB 1LXGA 1COEA 4IYEA 1HAAA 2BTXA 2PJYC 1NYUA 2I9BE 1IKCA 2X8BB 1S4YA 1LJZA 1BXPA 2K3GA 1CXOA 1F8UB 2QJ9C 1XT3A 4XJJA 3U74U 1QM7A 1LXHA 3NDSA 1IDGA 1HOYA 4HQPF 2GOOC 3KFDI 5DZ5A 1FSCA 1NYSA 1LX5B 2NBTA 1CDTA 1VB0A 1ES7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERA A;  1G6M A;  3FEV A;  2GOO B;  2JQP A;  5DO6 A;  4BIK B;  1CRF A;  1MAH F;  3U73 U;  2VLW A;  5IMT D;  1KU6 B;  1JE9 A;  3ERA A;  1BTE A;  2N99 A;  1JBD A;  1B41 B;  1KBS A;  4UY2 C;  2H8U A;  1F94 A;  1ERA A;  4OM4 A;  4OM5 A;  2JVE A;  3EVS C;  1KL8 A;  4BDT B;  1CB9 A;  1CVO A;  1TFS A;  2MJ4 A;  3PLC A;  4QTI U;  1IJC A;  1CDQ A;  1FRA A;  5EBX A;  4FAO C;  1HAJ A;  4EY8 B;  3BT1 U;  1NEA A;  3EBX A;  1NTX A;  2H62 D;  2CRT A;  1QKD A;  3LAQ U;  2H7Z A;  1IDH A;  2LCR A;  1RGJ A;  1NTN A;  4FAO E;  2H7Z B;  4DO8 A;  2CRS A;  3QB4 B;  1KS6 A;  4RUD A;  1I02 A;  1KFH A;  1REW C;  1HC9 A;  4P7U A;  1UG4 A;  2QJB C;  1V6P A;  1DRS A;  1HC9 B;  2MJ0 A;  1FFJ A;  1CXN A;  2HLR A;  4AEA A;  3VTS A;  2BHI A;  1L4W A;  2L03 A;  3NEQ A;  1H0J A;  1IDI A;  1NOR A;  4ZQY A;  1ABT A;  1ERG A;  1FAS A;  2CTX A;  1MR6 A;  1PLO A;  1W6B A;  1IDL A;  1KC4 A;  1CDS A;  3KFD E;  2L5S A;  1KXI A;  6EBX A;  2LA1 A;  2HLQ A;  2CCX A;  1NXB A;  1CHV S;  2QC1 A;  1COD A;  2H64 C;  1QKE A;  1TXB A;  2UWR A;  1KBA A;  2CDX A;  2MUP A;  1CRE A;  2UX2 A;  2OFS A;  4LFT A;  2MFA A;  2PJY B;  2ABX A;  1IK8 A;  1FSS B;  1ZAD A;  2FD6 U;  2H64 B;  1ONJ A;  2H5F A;  2QJA C;  1RL5 A;  1FF4 A;  1JGK A;  2H62 C;  1IQ9 A;  3BT2 U;  1TXA A;  1M9Z A;  1TGX A;  2MJY A;  3HH7 A;  2MHY A;  1YWH A;  5DU1 A;  5IMY C;  2J8B A;  1CDR A;  1KBT A;  1LSI A;  3NH7 A;  1CCQ A;  2MUO A;  1CTX A;  1KTZ B;  1LXG A;  1COE A;  4IYE A;  1HAA A;  2BTX A;  2PJY C;  1NYU A;  2I9B E;  1IKC A;  2X8B B;  1S4Y A;  1LJZ A;  1BXP A;  2K3G A;  1CXO A;  1F8U B;  2QJ9 C;  1XT3 A;  4XJJ A;  3U74 U;  1QM7 A;  1LXH A;  3NDS A;  1IDG A;  1HOY A;  4HQP F;  2GOO C;  3KFD I;  5DZ5 A;  1FSC A;  1NYS A;  1LX5 B;  2NBT A;  1CDT A;  1VB0 A;  1ES7 B; 
#chains in the Genus database with same CATH topology
 2ERA A;  1G6M A;  3FEV A;  2GOO B;  2JQP A;  5DO6 A;  4BIK B;  1CRF A;  1MAH F;  3U73 U;  2VLW A;  5IMT D;  1KU6 B;  1JE9 A;  3ERA A;  1BTE A;  2N99 A;  1JBD A;  1B41 B;  1KBS A;  4UY2 C;  2H8U A;  1F94 A;  1ERA A;  4OM4 A;  4OM5 A;  2JVE A;  3EVS C;  1KL8 A;  4BDT B;  1CB9 A;  1CVO A;  1TFS A;  2MJ4 A;  3PLC A;  4QTI U;  4KSN A;  1IJC A;  1CDQ A;  5EBX A;  1FRA A;  4FAO C;  1HAJ A;  4EY8 B;  3BT1 U;  1NEA A;  3EBX A;  1NTX A;  2H62 D;  2CRT A;  1QKD A;  3LAQ U;  2H7Z A;  1IDH A;  2LCR A;  1RGJ A;  1NTN A;  4FAO E;  2H7Z B;  4DO8 A;  2CRS A;  3QB4 B;  1KS6 A;  4RUD A;  1I02 A;  1KFH A;  1REW C;  1HC9 A;  4P7U A;  1UG4 A;  2QJB C;  1V6P A;  1DRS A;  1HC9 B;  2MJ0 A;  1FFJ A;  1CXN A;  2HLR A;  4AEA A;  3VTS A;  2BHI A;  1L4W A;  2L03 A;  3NEQ A;  1H0J A;  1IDI A;  1NOR A;  4ZQY A;  1ABT A;  1ERG A;  1FAS A;  2CTX A;  1MR6 A;  1PLO A;  1W6B A;  1IDL A;  1KC4 A;  1CDS A;  3KFD E;  2L5S A;  1KXI A;  6EBX A;  2LA1 A;  2HLQ A;  2CCX A;  1NXB A;  1CHV S;  2QC1 A;  1COD A;  2H64 C;  1QKE A;  1TXB A;  2UWR A;  1KBA A;  2CDX A;  2MUP A;  1CRE A;  2UX2 A;  2OFS A;  4LFT A;  2MFA A;  2PJY B;  2ABX A;  1IK8 A;  1FSS B;  1ZAD A;  2FD6 U;  2H64 B;  1ONJ A;  2H5F A;  2QJA C;  1RL5 A;  1FF4 A;  1JGK A;  2H62 C;  1IQ9 A;  3BT2 U;  1TXA A;  1M9Z A;  1TGX A;  2MJY A;  3HH7 A;  2MHY A;  1YWH A;  5DU1 A;  5IMY C;  2J8B A;  1CDR A;  1KBT A;  1LSI A;  3NH7 A;  1CCQ A;  2MUO A;  1CTX A;  1KTZ B;  1LXG A;  1COE A;  4IYE A;  1HAA A;  2BTX A;  2PJY C;  1NYU A;  2I9B E;  1IKC A;  2X8B B;  1S4Y A;  1LJZ A;  1BXP A;  2K3G A;  1CXO A;  1F8U B;  2QJ9 C;  1XT3 A;  4XJJ A;  3U74 U;  1QM7 A;  1LXH A;  3NDS A;  1IDG A;  1HOY A;  4HQP F;  2GOO C;  3KFD I;  5DZ5 A;  1FSC A;  1NYS A;  1LX5 B;  2NBT A;  1CDT A;  1VB0 A;  1ES7 B; 
#chains in the Genus database with same CATH homology
 2ERA A;  1G6M A;  3FEV A;  2GOO B;  2JQP A;  5DO6 A;  4BIK B;  1CRF A;  1MAH F;  3U73 U;  2VLW A;  5IMT D;  1KU6 B;  1JE9 A;  3ERA A;  1BTE A;  2N99 A;  1JBD A;  1B41 B;  1KBS A;  4UY2 C;  2H8U A;  1F94 A;  1ERA A;  4OM4 A;  4OM5 A;  2JVE A;  3EVS C;  1KL8 A;  4BDT B;  1CB9 A;  1CVO A;  1TFS A;  2MJ4 A;  3PLC A;  4QTI U;  4KSN A;  1IJC A;  1CDQ A;  5EBX A;  1FRA A;  4FAO C;  1HAJ A;  4EY8 B;  3BT1 U;  1NEA A;  3EBX A;  1NTX A;  2H62 D;  2CRT A;  1QKD A;  3LAQ U;  2H7Z A;  1IDH A;  2LCR A;  1RGJ A;  1NTN A;  4FAO E;  2H7Z B;  4DO8 A;  2CRS A;  3QB4 B;  1KS6 A;  4RUD A;  1I02 A;  1KFH A;  1REW C;  1HC9 A;  4P7U A;  1UG4 A;  2QJB C;  1V6P A;  1DRS A;  1HC9 B;  2MJ0 A;  1FFJ A;  1CXN A;  2HLR A;  4AEA A;  3VTS A;  2BHI A;  1L4W A;  2L03 A;  3NEQ A;  1H0J A;  1IDI A;  1NOR A;  4ZQY A;  1ABT A;  1ERG A;  1FAS A;  2CTX A;  1MR6 A;  1PLO A;  1W6B A;  1IDL A;  1KC4 A;  1CDS A;  3KFD E;  2L5S A;  1KXI A;  6EBX A;  2LA1 A;  2HLQ A;  2CCX A;  1NXB A;  1CHV S;  2QC1 A;  1COD A;  2H64 C;  1QKE A;  1TXB A;  2UWR A;  1KBA A;  2CDX A;  2MUP A;  1CRE A;  2UX2 A;  2OFS A;  4LFT A;  2MFA A;  2PJY B;  2ABX A;  1IK8 A;  1FSS B;  1ZAD A;  2FD6 U;  2H64 B;  1ONJ A;  2H5F A;  2QJA C;  1RL5 A;  1FF4 A;  1JGK A;  2H62 C;  1IQ9 A;  3BT2 U;  1TXA A;  1M9Z A;  1TGX A;  2MJY A;  3HH7 A;  2MHY A;  1YWH A;  5DU1 A;  5IMY C;  2J8B A;  1CDR A;  1KBT A;  1LSI A;  3NH7 A;  1CCQ A;  2MUO A;  1CTX A;  1KTZ B;  1LXG A;  1COE A;  4IYE A;  1HAA A;  2BTX A;  2PJY C;  1NYU A;  2I9B E;  1IKC A;  2X8B B;  1S4Y A;  1LJZ A;  1BXP A;  2K3G A;  1CXO A;  1F8U B;  2QJ9 C;  1XT3 A;  4XJJ A;  3U74 U;  1QM7 A;  1LXH A;  3NDS A;  1IDG A;  1HOY A;  4HQP F;  2GOO C;  3KFD I;  5DZ5 A;  1FSC A;  1NYS A;  1LX5 B;  2NBT A;  1CDT A;  1VB0 A;  1ES7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...