2K3GA

Nmr structure analysis of a bmp receptor
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
102
structure length
102
Chain Sequence
GPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Bone morphogenetic protein receptor type-1A
publication title The solution structure of BMPR-IA reveals a local disorder-to-order transition upon BMP-2 binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 102
sequence length 102
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2008-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2k3gA00
2ABXA 1V6PA 3U73U 2QJBC 1IDHA 2NBTA 2MUOA 1TGXA 3PLCA 1HAAA 2CRSA 1LSIA 1UG4A 1LX5B 1HC9B 3NEQA 1CXOA 2CDXA 1YWHA 1NEAA 4UY2C 2H64B 3FEVA 3VTSA 1KBAA 4FAOC 5IMYC 5DO6A 1H0JA 1JE9A 1NTXA 3HH7A 1REWC 1ONJA 1VB0A 1COEA 3EBXA 2JVEA 4LFTA 2H62D 1MAHF 1CRFA 1RGJA 2X8BB 4RUDA 1IJCA 2QC1A 4OM5A 1NYSA 1IDLA 1CREA 2UWRA 1IDGA 2I9BE 1F8UB 3BT1U 1ABTA 4OM4A 2MUPA 2LA1A 1IKCA 1MR6A 2OFSA 3U74U 4AEAA 6EBXA 1RL5A 1CDSA 1ZADA 2L5SA 3NH7A 4EY8B 2H8UA 2PJYC 2PJYB 3ERAA 2H7ZB 1QKDA 1LJZA 1QKEA 2FD6U 1IK8A 1FF4A 2BTXA 2JQPA 2QJ9C 2GOOC 1NYUA 3KFDI 1KS6A 1S4YA 2HLRA 2VLWA 1KBTA 2MJ0A 1CDRA 1CXNA 1NORA 2L03A 1CDQA 4BIKB 1FSCA 1L4WA 2MFAA 2MJYA 1KU6B 1JGKA 2HLQA 2CRTA 4BDTB 1KXIA 1CDTA 5DU1A 1HC9A 1IQ9A 2LCRA 2N99A 2ERAA 1CTXA 1TXBA 1FSSB 1LXHA 1W6BA 3BT2U 4DO8A 2CCXA 1DRSA 2H7ZA 1CHVS 1B41B 1ES7B 4ZQYA 1FASA 1XT3A 2K3GA 1CB9A 1I02A 1KFHA 1HAJA 1TXAA 3QB4B 2GOOB 1F94A 4QTIU 1CODA 1TFSA 1KL8A 1JBDA 1LXGA 1HOYA 1KTZB 1CCQA 1BTEA 2H5FA 1NTNA 2BHIA 5EBXA 1BXPA 1IDIA 2UX2A 1NXBA 2H62C 2H64C 5IMTD 3KFDE 1CVOA 1KC4A 2QJAC 4XJJA 4HQPF 3EVSC 1FFJA 3LAQU 1ERGA 2J8BA 4FAOE 1ERAA 1QM7A 3NDSA 2MJ4A 1FRAA 4IYEA 4P7UA 2CTXA 1PLOA 1M9ZA 5DZ5A 2MHYA 1KBSA 1G6MA
chains in the Genus database with same CATH superfamily
2ABXA 1V6PA 3U73U 2QJBC 1IDHA 2NBTA 2MUOA 1TGXA 3PLCA 1HAAA 2CRSA 1LSIA 1UG4A 1LX5B 1HC9B 3NEQA 1CXOA 2CDXA 1YWHA 1NEAA 4UY2C 2H64B 3FEVA 3VTSA 1KBAA 4FAOC 5IMYC 5DO6A 1H0JA 1JE9A 1NTXA 3HH7A 1REWC 1ONJA 1VB0A 1COEA 3EBXA 2JVEA 4LFTA 2H62D 1MAHF 1CRFA 1RGJA 2X8BB 4RUDA 1IJCA 2QC1A 4OM5A 1NYSA 1IDLA 1CREA 2UWRA 1IDGA 2I9BE 1F8UB 3BT1U 1ABTA 4OM4A 2MUPA 2LA1A 4KSNA 1IKCA 1MR6A 2OFSA 3U74U 4AEAA 6EBXA 1RL5A 1CDSA 1ZADA 2L5SA 3NH7A 4EY8B 2H8UA 2PJYC 2PJYB 3ERAA 2H7ZB 1QKDA 1LJZA 1QKEA 2FD6U 1IK8A 1FF4A 2BTXA 2JQPA 2QJ9C 2GOOC 1NYUA 3KFDI 1KS6A 1S4YA 2HLRA 2VLWA 1KBTA 2MJ0A 1CDRA 1CXNA 1NORA 2L03A 1CDQA 4BIKB 1FSCA 1L4WA 2MFAA 2MJYA 1KU6B 1JGKA 2HLQA 2CRTA 4BDTB 1KXIA 1CDTA 5DU1A 1HC9A 1IQ9A 2LCRA 2N99A 2ERAA 1CTXA 1TXBA 1FSSB 1LXHA 1W6BA 3BT2U 4DO8A 2CCXA 1DRSA 2H7ZA 1CHVS 1B41B 1ES7B 4ZQYA 1FASA 1XT3A 2K3GA 1CB9A 1I02A 1KFHA 1HAJA 1TXAA 3QB4B 2GOOB 1F94A 4QTIU 1CODA 1TFSA 1KL8A 1JBDA 1LXGA 1HOYA 1KTZB 1CCQA 1BTEA 2H5FA 1NTNA 2BHIA 5EBXA 1BXPA 1IDIA 2UX2A 1NXBA 2H62C 2H64C 5IMTD 3KFDE 1CVOA 1KC4A 2QJAC 4XJJA 4HQPF 3EVSC 1FFJA 3LAQU 1ERGA 2J8BA 4FAOE 1ERAA 1QM7A 3NDSA 2MJ4A 1FRAA 4IYEA 4P7UA 2CTXA 1PLOA 1M9ZA 5DZ5A 2MHYA 1KBSA 1G6MA
chains in the Genus database with same CATH topology
2ABXA 1V6PA 3U73U 2QJBC 1IDHA 2NBTA 2MUOA 1TGXA 3PLCA 1HAAA 2CRSA 1LSIA 1UG4A 1LX5B 1HC9B 3NEQA 1CXOA 2CDXA 1YWHA 1NEAA 4UY2C 2H64B 3FEVA 3VTSA 1KBAA 4FAOC 5IMYC 5DO6A 1H0JA 1JE9A 1NTXA 3HH7A 1REWC 1ONJA 1VB0A 1COEA 3EBXA 2JVEA 4LFTA 2H62D 1MAHF 1CRFA 1RGJA 2X8BB 4RUDA 1IJCA 2QC1A 4OM5A 1NYSA 1IDLA 1CREA 2UWRA 1IDGA 2I9BE 1F8UB 3BT1U 1ABTA 4OM4A 2MUPA 2LA1A 4KSNA 1IKCA 1MR6A 2OFSA 3U74U 4AEAA 6EBXA 1RL5A 1CDSA 1ZADA 2L5SA 3NH7A 4EY8B 2H8UA 2PJYC 2PJYB 3ERAA 2H7ZB 1QKDA 1LJZA 1QKEA 2FD6U 1IK8A 1FF4A 2BTXA 2JQPA 2QJ9C 2GOOC 1NYUA 3KFDI 1KS6A 1S4YA 2HLRA 2VLWA 1KBTA 2MJ0A 1CDRA 1CXNA 1NORA 2L03A 1CDQA 4BIKB 1FSCA 1L4WA 2MFAA 2MJYA 1KU6B 1JGKA 2HLQA 2CRTA 4BDTB 1KXIA 1CDTA 5DU1A 1HC9A 1IQ9A 2LCRA 2N99A 2ERAA 1CTXA 1TXBA 1FSSB 1LXHA 1W6BA 3BT2U 4DO8A 2CCXA 1DRSA 2H7ZA 1CHVS 1B41B 1ES7B 4ZQYA 1FASA 1XT3A 2K3GA 1CB9A 1I02A 1KFHA 1HAJA 1TXAA 3QB4B 2GOOB 1F94A 4QTIU 1CODA 1TFSA 1KL8A 1JBDA 1LXGA 1HOYA 1KTZB 1CCQA 1BTEA 2H5FA 1NTNA 2BHIA 5EBXA 1BXPA 1IDIA 2UX2A 1NXBA 2H62C 2H64C 5IMTD 3KFDE 1CVOA 1KC4A 2QJAC 4XJJA 4HQPF 3EVSC 1FFJA 3LAQU 1ERGA 2J8BA 4FAOE 1ERAA 1QM7A 3NDSA 2MJ4A 1FRAA 4IYEA 4P7UA 2CTXA 1PLOA 1M9ZA 5DZ5A 2MHYA 1KBSA 1G6MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABX A;  1V6P A;  3U73 U;  2QJB C;  1IDH A;  2NBT A;  2MUO A;  1TGX A;  3PLC A;  1HAA A;  2CRS A;  1LSI A;  1UG4 A;  1LX5 B;  1HC9 B;  3NEQ A;  1CXO A;  2CDX A;  1YWH A;  1NEA A;  4UY2 C;  2H64 B;  3FEV A;  3VTS A;  1KBA A;  4FAO C;  5IMY C;  5DO6 A;  1H0J A;  1JE9 A;  1NTX A;  3HH7 A;  1REW C;  1ONJ A;  1VB0 A;  1COE A;  3EBX A;  2JVE A;  4LFT A;  2H62 D;  1MAH F;  1CRF A;  1RGJ A;  2X8B B;  4RUD A;  1IJC A;  2QC1 A;  4OM5 A;  1NYS A;  1IDL A;  1CRE A;  2UWR A;  1IDG A;  2I9B E;  1F8U B;  3BT1 U;  1ABT A;  4OM4 A;  2MUP A;  2LA1 A;  1IKC A;  1MR6 A;  2OFS A;  3U74 U;  4AEA A;  6EBX A;  1RL5 A;  1CDS A;  1ZAD A;  2L5S A;  3NH7 A;  4EY8 B;  2H8U A;  2PJY C;  2PJY B;  3ERA A;  2H7Z B;  1QKD A;  1LJZ A;  1QKE A;  2FD6 U;  1IK8 A;  1FF4 A;  2BTX A;  2JQP A;  2QJ9 C;  2GOO C;  1NYU A;  3KFD I;  1KS6 A;  1S4Y A;  2HLR A;  2VLW A;  1KBT A;  2MJ0 A;  1CDR A;  1CXN A;  1NOR A;  2L03 A;  1CDQ A;  4BIK B;  1FSC A;  1L4W A;  2MFA A;  2MJY A;  1KU6 B;  1JGK A;  2HLQ A;  2CRT A;  4BDT B;  1KXI A;  1CDT A;  5DU1 A;  1HC9 A;  1IQ9 A;  2LCR A;  2N99 A;  2ERA A;  1CTX A;  1TXB A;  1FSS B;  1LXH A;  1W6B A;  3BT2 U;  4DO8 A;  2CCX A;  1DRS A;  2H7Z A;  1CHV S;  1B41 B;  1ES7 B;  4ZQY A;  1FAS A;  1XT3 A;  2K3G A;  1CB9 A;  1I02 A;  1KFH A;  1HAJ A;  1TXA A;  3QB4 B;  2GOO B;  1F94 A;  4QTI U;  1COD A;  1TFS A;  1KL8 A;  1JBD A;  1LXG A;  1HOY A;  1KTZ B;  1CCQ A;  1BTE A;  2H5F A;  1NTN A;  2BHI A;  5EBX A;  1BXP A;  1IDI A;  2UX2 A;  1NXB A;  2H62 C;  2H64 C;  5IMT D;  3KFD E;  1CVO A;  1KC4 A;  2QJA C;  4XJJ A;  4HQP F;  3EVS C;  1FFJ A;  3LAQ U;  1ERG A;  2J8B A;  4FAO E;  1ERA A;  1QM7 A;  3NDS A;  2MJ4 A;  1FRA A;  4IYE A;  4P7U A;  2CTX A;  1PLO A;  1M9Z A;  5DZ5 A;  2MHY A;  1KBS A;  1G6M A; 
#chains in the Genus database with same CATH topology
 2ABX A;  1V6P A;  3U73 U;  2QJB C;  1IDH A;  2NBT A;  2MUO A;  1TGX A;  3PLC A;  1HAA A;  2CRS A;  1LSI A;  1UG4 A;  1LX5 B;  1HC9 B;  3NEQ A;  1CXO A;  2CDX A;  1YWH A;  1NEA A;  4UY2 C;  2H64 B;  3FEV A;  3VTS A;  1KBA A;  4FAO C;  5IMY C;  5DO6 A;  1H0J A;  1JE9 A;  1NTX A;  3HH7 A;  1REW C;  1ONJ A;  1VB0 A;  1COE A;  3EBX A;  2JVE A;  4LFT A;  2H62 D;  1MAH F;  1CRF A;  1RGJ A;  2X8B B;  4RUD A;  1IJC A;  2QC1 A;  4OM5 A;  1NYS A;  1IDL A;  1CRE A;  2UWR A;  1IDG A;  2I9B E;  1F8U B;  3BT1 U;  1ABT A;  4OM4 A;  2MUP A;  2LA1 A;  4KSN A;  1IKC A;  1MR6 A;  2OFS A;  3U74 U;  4AEA A;  6EBX A;  1RL5 A;  1CDS A;  1ZAD A;  2L5S A;  3NH7 A;  4EY8 B;  2H8U A;  2PJY C;  2PJY B;  3ERA A;  2H7Z B;  1QKD A;  1LJZ A;  1QKE A;  2FD6 U;  1IK8 A;  1FF4 A;  2BTX A;  2JQP A;  2QJ9 C;  2GOO C;  1NYU A;  3KFD I;  1KS6 A;  1S4Y A;  2HLR A;  2VLW A;  1KBT A;  2MJ0 A;  1CDR A;  1CXN A;  1NOR A;  2L03 A;  1CDQ A;  4BIK B;  1FSC A;  1L4W A;  2MFA A;  2MJY A;  1KU6 B;  1JGK A;  2HLQ A;  2CRT A;  4BDT B;  1KXI A;  1CDT A;  5DU1 A;  1HC9 A;  1IQ9 A;  2LCR A;  2N99 A;  2ERA A;  1CTX A;  1TXB A;  1FSS B;  1LXH A;  1W6B A;  3BT2 U;  4DO8 A;  2CCX A;  1DRS A;  2H7Z A;  1CHV S;  1B41 B;  1ES7 B;  4ZQY A;  1FAS A;  1XT3 A;  2K3G A;  1CB9 A;  1I02 A;  1KFH A;  1HAJ A;  1TXA A;  3QB4 B;  2GOO B;  1F94 A;  4QTI U;  1COD A;  1TFS A;  1KL8 A;  1JBD A;  1LXG A;  1HOY A;  1KTZ B;  1CCQ A;  1BTE A;  2H5F A;  1NTN A;  2BHI A;  5EBX A;  1BXP A;  1IDI A;  2UX2 A;  1NXB A;  2H62 C;  2H64 C;  5IMT D;  3KFD E;  1CVO A;  1KC4 A;  2QJA C;  4XJJ A;  4HQP F;  3EVS C;  1FFJ A;  3LAQ U;  1ERG A;  2J8B A;  4FAO E;  1ERA A;  1QM7 A;  3NDS A;  2MJ4 A;  1FRA A;  4IYE A;  4P7U A;  2CTX A;  1PLO A;  1M9Z A;  5DZ5 A;  2MHY A;  1KBS A;  1G6M A; 
#chains in the Genus database with same CATH homology
 2ABX A;  1V6P A;  3U73 U;  2QJB C;  1IDH A;  2NBT A;  2MUO A;  1TGX A;  3PLC A;  1HAA A;  2CRS A;  1LSI A;  1UG4 A;  1LX5 B;  1HC9 B;  3NEQ A;  1CXO A;  2CDX A;  1YWH A;  1NEA A;  4UY2 C;  2H64 B;  3FEV A;  3VTS A;  1KBA A;  4FAO C;  5IMY C;  5DO6 A;  1H0J A;  1JE9 A;  1NTX A;  3HH7 A;  1REW C;  1ONJ A;  1VB0 A;  1COE A;  3EBX A;  2JVE A;  4LFT A;  2H62 D;  1MAH F;  1CRF A;  1RGJ A;  2X8B B;  4RUD A;  1IJC A;  2QC1 A;  4OM5 A;  1NYS A;  1IDL A;  1CRE A;  2UWR A;  1IDG A;  2I9B E;  1F8U B;  3BT1 U;  1ABT A;  4OM4 A;  2MUP A;  2LA1 A;  4KSN A;  1IKC A;  1MR6 A;  2OFS A;  3U74 U;  4AEA A;  6EBX A;  1RL5 A;  1CDS A;  1ZAD A;  2L5S A;  3NH7 A;  4EY8 B;  2H8U A;  2PJY C;  2PJY B;  3ERA A;  2H7Z B;  1QKD A;  1LJZ A;  1QKE A;  2FD6 U;  1IK8 A;  1FF4 A;  2BTX A;  2JQP A;  2QJ9 C;  2GOO C;  1NYU A;  3KFD I;  1KS6 A;  1S4Y A;  2HLR A;  2VLW A;  1KBT A;  2MJ0 A;  1CDR A;  1CXN A;  1NOR A;  2L03 A;  1CDQ A;  4BIK B;  1FSC A;  1L4W A;  2MFA A;  2MJY A;  1KU6 B;  1JGK A;  2HLQ A;  2CRT A;  4BDT B;  1KXI A;  1CDT A;  5DU1 A;  1HC9 A;  1IQ9 A;  2LCR A;  2N99 A;  2ERA A;  1CTX A;  1TXB A;  1FSS B;  1LXH A;  1W6B A;  3BT2 U;  4DO8 A;  2CCX A;  1DRS A;  2H7Z A;  1CHV S;  1B41 B;  1ES7 B;  4ZQY A;  1FAS A;  1XT3 A;  2K3G A;  1CB9 A;  1I02 A;  1KFH A;  1HAJ A;  1TXA A;  3QB4 B;  2GOO B;  1F94 A;  4QTI U;  1COD A;  1TFS A;  1KL8 A;  1JBD A;  1LXG A;  1HOY A;  1KTZ B;  1CCQ A;  1BTE A;  2H5F A;  1NTN A;  2BHI A;  5EBX A;  1BXP A;  1IDI A;  2UX2 A;  1NXB A;  2H62 C;  2H64 C;  5IMT D;  3KFD E;  1CVO A;  1KC4 A;  2QJA C;  4XJJ A;  4HQP F;  3EVS C;  1FFJ A;  3LAQ U;  1ERG A;  2J8B A;  4FAO E;  1ERA A;  1QM7 A;  3NDS A;  2MJ4 A;  1FRA A;  4IYE A;  4P7U A;  2CTX A;  1PLO A;  1M9Z A;  5DZ5 A;  2MHY A;  1KBS A;  1G6M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...