3NEQA

Crystal structure of the chimeric muscarinic toxin mt7 with loop 3 from mt1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKPTNVRETIRCCGTDKCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three-finger muscarinic toxin 7
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3neqA00
1FSSB 1KU6B 2BTXA 2H7ZB 2NBTA 2QJ9C 4OM5A 1CDTA 4XJJA 1KL8A 1IDLA 2CTXA 2MHYA 1NTXA 1IJCA 3BT1U 2MJYA 1CREA 1CB9A 1ZADA 1ONJA 2H64B 1NYUA 2UX2A 2ABXA 4HQPF 1CCQA 4BIKB 1RL5A 2CDXA 1B41B 2K3GA 1ES7B 1BTEA 1LX5B 2MJ4A 4ZQYA 5IMTD 3NH7A 1CRFA 1HC9A 1NXBA 1KBTA 1IDGA 1W6BA 2MUOA 1JBDA 4FAOC 3PLCA 2MUPA 3ERAA 1YWHA 1HOYA 1HAAA 2N99A 1CVOA 1FRAA 2HLRA 2JQPA 1NTNA 4P7UA 3NDSA 1IDIA 1VB0A 1CDRA 2VLWA 1LXHA 1M9ZA 1IK8A 2QC1A 1L4WA 1TFSA 1TGXA 1RGJA 1UG4A 1DRSA 1NORA 2J8BA 2BHIA 3U74U 3FEVA 2LCRA 1V6PA 1KBSA 2X8BB 2MFAA 1CDQA 5IMYC 4RUDA 1PLOA 1BXPA 1ERAA 1FF4A 4OM4A 1H0JA 1QKDA 1KS6A 2H8UA 3HH7A 2OFSA 1NEAA 2H7ZA 2PJYB 4QTIU 3EVSC 1KTZB 1TXBA 2H64C 1CXOA 1CHVS 1REWC 4AEAA 1COEA 2L5SA 1LXGA 1HAJA 2QJAC 1JGKA 3NEQA 3BT2U 1I02A 3U73U 1F94A 1TXAA 4BDTB 1IDHA 2GOOB 2I9BE 1IQ9A 2CCXA 3QB4B 1S4YA 1QM7A 1XT3A 5DU1A 1HC9B 2H62C 2FD6U 1F8UB 5EBXA 3KFDE 1CTXA 1CDSA 1ERGA 6EBXA 2QJBC 3VTSA 1KFHA 2HLQA 1LJZA 2UWRA 1LSIA 2GOOC 2CRTA 2L03A 1CODA 3LAQU 2ERAA 1IKCA 4IYEA 2LA1A 4UY2C 5DZ5A 1NYSA 1CXNA 1KC4A 1KBAA 2H62D 5DO6A 2CRSA 1MAHF 4DO8A 3KFDI 1G6MA 1FFJA 2MJ0A 4LFTA 1FSCA 2H5FA 2PJYC 1JE9A 1FASA 3EBXA 4FAOE 2JVEA 1KXIA 4EY8B 1ABTA 1QKEA 1MR6A
chains in the Genus database with same CATH superfamily
1FSSB 1KU6B 2BTXA 2H7ZB 2NBTA 2QJ9C 4OM5A 1CDTA 4XJJA 1KL8A 1IDLA 2CTXA 2MHYA 1NTXA 1IJCA 3BT1U 2MJYA 1CREA 1CB9A 1ZADA 1ONJA 2H64B 1NYUA 2UX2A 2ABXA 4HQPF 1CCQA 4BIKB 1RL5A 2CDXA 1B41B 2K3GA 1ES7B 1BTEA 1LX5B 2MJ4A 4ZQYA 5IMTD 3NH7A 1CRFA 1HC9A 1NXBA 1KBTA 1IDGA 1W6BA 2MUOA 1JBDA 4FAOC 3PLCA 2MUPA 3ERAA 1YWHA 1HOYA 1HAAA 2N99A 1CVOA 1FRAA 2HLRA 2JQPA 1NTNA 4P7UA 3NDSA 1IDIA 1VB0A 1CDRA 2VLWA 1LXHA 1M9ZA 1IK8A 2QC1A 1L4WA 1TFSA 1TGXA 1RGJA 1UG4A 1DRSA 1NORA 2J8BA 2BHIA 3U74U 3FEVA 2LCRA 1V6PA 1KBSA 2X8BB 2MFAA 1CDQA 5IMYC 4RUDA 1PLOA 1BXPA 1ERAA 1FF4A 4OM4A 1H0JA 1QKDA 1KS6A 2H8UA 3HH7A 2OFSA 1NEAA 2H7ZA 2PJYB 4QTIU 3EVSC 1KTZB 1TXBA 2H64C 1CXOA 1CHVS 1REWC 4AEAA 1COEA 2L5SA 1LXGA 1HAJA 2QJAC 1JGKA 3NEQA 3BT2U 1I02A 3U73U 1F94A 1TXAA 4BDTB 1IDHA 2GOOB 2I9BE 1IQ9A 2CCXA 3QB4B 1S4YA 1QM7A 1XT3A 5DU1A 1HC9B 2H62C 2FD6U 1F8UB 5EBXA 3KFDE 1CTXA 1CDSA 1ERGA 6EBXA 2QJBC 3VTSA 1KFHA 2HLQA 1LJZA 2UWRA 1LSIA 2GOOC 2CRTA 2L03A 1CODA 3LAQU 2ERAA 1IKCA 4IYEA 2LA1A 4UY2C 5DZ5A 1NYSA 1CXNA 1KC4A 1KBAA 2H62D 5DO6A 2CRSA 1MAHF 4DO8A 3KFDI 1G6MA 1FFJA 2MJ0A 4LFTA 1FSCA 2H5FA 2PJYC 1JE9A 1FASA 3EBXA 4FAOE 2JVEA 1KXIA 4EY8B 4KSNA 1ABTA 1QKEA 1MR6A
chains in the Genus database with same CATH topology
1FSSB 1KU6B 2BTXA 2H7ZB 2NBTA 2QJ9C 4OM5A 1CDTA 4XJJA 1KL8A 1IDLA 2CTXA 2MHYA 1NTXA 1IJCA 3BT1U 2MJYA 1CREA 1CB9A 1ZADA 1ONJA 2H64B 1NYUA 2UX2A 2ABXA 4HQPF 1CCQA 4BIKB 1RL5A 2CDXA 1B41B 2K3GA 1ES7B 1BTEA 1LX5B 2MJ4A 4ZQYA 5IMTD 3NH7A 1CRFA 1HC9A 1NXBA 1KBTA 1IDGA 1W6BA 2MUOA 1JBDA 4FAOC 3PLCA 2MUPA 3ERAA 1YWHA 1HOYA 1HAAA 2N99A 1CVOA 1FRAA 2HLRA 2JQPA 1NTNA 4P7UA 3NDSA 1IDIA 1VB0A 1CDRA 2VLWA 1LXHA 1M9ZA 1IK8A 2QC1A 1L4WA 1TFSA 1TGXA 1RGJA 1UG4A 1DRSA 1NORA 2J8BA 2BHIA 3U74U 3FEVA 2LCRA 1V6PA 1KBSA 2X8BB 2MFAA 1CDQA 5IMYC 4RUDA 1PLOA 1BXPA 1ERAA 1FF4A 4OM4A 1H0JA 1QKDA 1KS6A 2H8UA 3HH7A 2OFSA 1NEAA 2H7ZA 2PJYB 4QTIU 3EVSC 1KTZB 1TXBA 2H64C 1CXOA 1CHVS 1REWC 4AEAA 1COEA 2L5SA 1LXGA 1HAJA 2QJAC 1JGKA 3NEQA 3BT2U 1I02A 3U73U 1F94A 1TXAA 4BDTB 1IDHA 2GOOB 2I9BE 1IQ9A 2CCXA 3QB4B 1S4YA 1QM7A 1XT3A 5DU1A 1HC9B 2H62C 2FD6U 1F8UB 5EBXA 3KFDE 1CTXA 1CDSA 1ERGA 6EBXA 2QJBC 3VTSA 1KFHA 2HLQA 1LJZA 2UWRA 1LSIA 2GOOC 2CRTA 2L03A 1CODA 3LAQU 2ERAA 1IKCA 4IYEA 2LA1A 4UY2C 5DZ5A 1NYSA 1CXNA 1KC4A 1KBAA 2H62D 5DO6A 2CRSA 1MAHF 4DO8A 3KFDI 1G6MA 1FFJA 2MJ0A 4LFTA 1FSCA 2H5FA 2PJYC 1JE9A 1FASA 3EBXA 4FAOE 2JVEA 1KXIA 4EY8B 4KSNA 1ABTA 1QKEA 1MR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSS B;  1KU6 B;  2BTX A;  2H7Z B;  2NBT A;  2QJ9 C;  4OM5 A;  1CDT A;  4XJJ A;  1KL8 A;  1IDL A;  2CTX A;  2MHY A;  1NTX A;  1IJC A;  3BT1 U;  2MJY A;  1CRE A;  1CB9 A;  1ZAD A;  1ONJ A;  2H64 B;  1NYU A;  2UX2 A;  2ABX A;  4HQP F;  1CCQ A;  4BIK B;  1RL5 A;  2CDX A;  1B41 B;  2K3G A;  1ES7 B;  1BTE A;  1LX5 B;  2MJ4 A;  4ZQY A;  5IMT D;  3NH7 A;  1CRF A;  1HC9 A;  1NXB A;  1KBT A;  1IDG A;  1W6B A;  2MUO A;  1JBD A;  4FAO C;  3PLC A;  2MUP A;  3ERA A;  1YWH A;  1HOY A;  1HAA A;  2N99 A;  1CVO A;  1FRA A;  2HLR A;  2JQP A;  1NTN A;  4P7U A;  3NDS A;  1IDI A;  1VB0 A;  1CDR A;  2VLW A;  1LXH A;  1M9Z A;  1IK8 A;  2QC1 A;  1L4W A;  1TFS A;  1TGX A;  1RGJ A;  1UG4 A;  1DRS A;  1NOR A;  2J8B A;  2BHI A;  3U74 U;  3FEV A;  2LCR A;  1V6P A;  1KBS A;  2X8B B;  2MFA A;  1CDQ A;  5IMY C;  4RUD A;  1PLO A;  1BXP A;  1ERA A;  1FF4 A;  4OM4 A;  1H0J A;  1QKD A;  1KS6 A;  2H8U A;  3HH7 A;  2OFS A;  1NEA A;  2H7Z A;  2PJY B;  4QTI U;  3EVS C;  1KTZ B;  1TXB A;  2H64 C;  1CXO A;  1CHV S;  1REW C;  4AEA A;  1COE A;  2L5S A;  1LXG A;  1HAJ A;  2QJA C;  1JGK A;  3NEQ A;  3BT2 U;  1I02 A;  3U73 U;  1F94 A;  1TXA A;  4BDT B;  1IDH A;  2GOO B;  2I9B E;  1IQ9 A;  2CCX A;  3QB4 B;  1S4Y A;  1QM7 A;  1XT3 A;  5DU1 A;  1HC9 B;  2H62 C;  2FD6 U;  1F8U B;  5EBX A;  3KFD E;  1CTX A;  1CDS A;  1ERG A;  6EBX A;  2QJB C;  3VTS A;  1KFH A;  2HLQ A;  1LJZ A;  2UWR A;  1LSI A;  2GOO C;  2CRT A;  2L03 A;  1COD A;  3LAQ U;  2ERA A;  1IKC A;  4IYE A;  2LA1 A;  4UY2 C;  5DZ5 A;  1NYS A;  1CXN A;  1KC4 A;  1KBA A;  2H62 D;  5DO6 A;  2CRS A;  1MAH F;  4DO8 A;  3KFD I;  1G6M A;  1FFJ A;  2MJ0 A;  4LFT A;  1FSC A;  2H5F A;  2PJY C;  1JE9 A;  1FAS A;  3EBX A;  4FAO E;  2JVE A;  1KXI A;  4EY8 B;  1ABT A;  1QKE A;  1MR6 A; 
#chains in the Genus database with same CATH topology
 1FSS B;  1KU6 B;  2BTX A;  2H7Z B;  2NBT A;  2QJ9 C;  4OM5 A;  1CDT A;  4XJJ A;  1KL8 A;  1IDL A;  2CTX A;  2MHY A;  1NTX A;  1IJC A;  3BT1 U;  2MJY A;  1CRE A;  1CB9 A;  1ZAD A;  1ONJ A;  2H64 B;  1NYU A;  2UX2 A;  2ABX A;  4HQP F;  1CCQ A;  4BIK B;  1RL5 A;  2CDX A;  1B41 B;  2K3G A;  1ES7 B;  1BTE A;  1LX5 B;  2MJ4 A;  4ZQY A;  5IMT D;  3NH7 A;  1CRF A;  1HC9 A;  1NXB A;  1KBT A;  1IDG A;  1W6B A;  2MUO A;  1JBD A;  4FAO C;  3PLC A;  2MUP A;  3ERA A;  1YWH A;  1HOY A;  1HAA A;  2N99 A;  1CVO A;  1FRA A;  2HLR A;  2JQP A;  1NTN A;  4P7U A;  3NDS A;  1IDI A;  1VB0 A;  1CDR A;  2VLW A;  1LXH A;  1M9Z A;  1IK8 A;  2QC1 A;  1L4W A;  1TFS A;  1TGX A;  1RGJ A;  1UG4 A;  1DRS A;  1NOR A;  2J8B A;  2BHI A;  3U74 U;  3FEV A;  2LCR A;  1V6P A;  1KBS A;  2X8B B;  2MFA A;  1CDQ A;  5IMY C;  4RUD A;  1PLO A;  1BXP A;  1ERA A;  1FF4 A;  4OM4 A;  1H0J A;  1QKD A;  1KS6 A;  2H8U A;  3HH7 A;  2OFS A;  1NEA A;  2H7Z A;  2PJY B;  4QTI U;  3EVS C;  1KTZ B;  1TXB A;  2H64 C;  1CXO A;  1CHV S;  1REW C;  4AEA A;  1COE A;  2L5S A;  1LXG A;  1HAJ A;  2QJA C;  1JGK A;  3NEQ A;  3BT2 U;  1I02 A;  3U73 U;  1F94 A;  1TXA A;  4BDT B;  1IDH A;  2GOO B;  2I9B E;  1IQ9 A;  2CCX A;  3QB4 B;  1S4Y A;  1QM7 A;  1XT3 A;  5DU1 A;  1HC9 B;  2H62 C;  2FD6 U;  1F8U B;  5EBX A;  3KFD E;  1CTX A;  1CDS A;  1ERG A;  6EBX A;  2QJB C;  3VTS A;  1KFH A;  2HLQ A;  1LJZ A;  2UWR A;  1LSI A;  2GOO C;  2CRT A;  2L03 A;  1COD A;  3LAQ U;  2ERA A;  1IKC A;  4IYE A;  2LA1 A;  4UY2 C;  5DZ5 A;  1NYS A;  1CXN A;  1KC4 A;  1KBA A;  2H62 D;  5DO6 A;  2CRS A;  1MAH F;  4DO8 A;  3KFD I;  1G6M A;  1FFJ A;  2MJ0 A;  4LFT A;  1FSC A;  2H5F A;  2PJY C;  1JE9 A;  1FAS A;  3EBX A;  4FAO E;  2JVE A;  1KXI A;  4EY8 B;  4KSN A;  1ABT A;  1QKE A;  1MR6 A; 
#chains in the Genus database with same CATH homology
 1FSS B;  1KU6 B;  2BTX A;  2H7Z B;  2NBT A;  2QJ9 C;  4OM5 A;  1CDT A;  4XJJ A;  1KL8 A;  1IDL A;  2CTX A;  2MHY A;  1NTX A;  1IJC A;  3BT1 U;  2MJY A;  1CRE A;  1CB9 A;  1ZAD A;  1ONJ A;  2H64 B;  1NYU A;  2UX2 A;  2ABX A;  4HQP F;  1CCQ A;  4BIK B;  1RL5 A;  2CDX A;  1B41 B;  2K3G A;  1ES7 B;  1BTE A;  1LX5 B;  2MJ4 A;  4ZQY A;  5IMT D;  3NH7 A;  1CRF A;  1HC9 A;  1NXB A;  1KBT A;  1IDG A;  1W6B A;  2MUO A;  1JBD A;  4FAO C;  3PLC A;  2MUP A;  3ERA A;  1YWH A;  1HOY A;  1HAA A;  2N99 A;  1CVO A;  1FRA A;  2HLR A;  2JQP A;  1NTN A;  4P7U A;  3NDS A;  1IDI A;  1VB0 A;  1CDR A;  2VLW A;  1LXH A;  1M9Z A;  1IK8 A;  2QC1 A;  1L4W A;  1TFS A;  1TGX A;  1RGJ A;  1UG4 A;  1DRS A;  1NOR A;  2J8B A;  2BHI A;  3U74 U;  3FEV A;  2LCR A;  1V6P A;  1KBS A;  2X8B B;  2MFA A;  1CDQ A;  5IMY C;  4RUD A;  1PLO A;  1BXP A;  1ERA A;  1FF4 A;  4OM4 A;  1H0J A;  1QKD A;  1KS6 A;  2H8U A;  3HH7 A;  2OFS A;  1NEA A;  2H7Z A;  2PJY B;  4QTI U;  3EVS C;  1KTZ B;  1TXB A;  2H64 C;  1CXO A;  1CHV S;  1REW C;  4AEA A;  1COE A;  2L5S A;  1LXG A;  1HAJ A;  2QJA C;  1JGK A;  3NEQ A;  3BT2 U;  1I02 A;  3U73 U;  1F94 A;  1TXA A;  4BDT B;  1IDH A;  2GOO B;  2I9B E;  1IQ9 A;  2CCX A;  3QB4 B;  1S4Y A;  1QM7 A;  1XT3 A;  5DU1 A;  1HC9 B;  2H62 C;  2FD6 U;  1F8U B;  5EBX A;  3KFD E;  1CTX A;  1CDS A;  1ERG A;  6EBX A;  2QJB C;  3VTS A;  1KFH A;  2HLQ A;  1LJZ A;  2UWR A;  1LSI A;  2GOO C;  2CRT A;  2L03 A;  1COD A;  3LAQ U;  2ERA A;  1IKC A;  4IYE A;  2LA1 A;  4UY2 C;  5DZ5 A;  1NYS A;  1CXN A;  1KC4 A;  1KBA A;  2H62 D;  5DO6 A;  2CRS A;  1MAH F;  4DO8 A;  3KFD I;  1G6M A;  1FFJ A;  2MJ0 A;  4LFT A;  1FSC A;  2H5F A;  2PJY C;  1JE9 A;  1FAS A;  3EBX A;  4FAO E;  2JVE A;  1KXI A;  4EY8 B;  4KSN A;  1ABT A;  1QKE A;  1MR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...