3NEQA

Crystal structure of the chimeric muscarinic toxin mt7 with loop 3 from mt1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKPTNVRETIRCCGTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three-finger muscarinic toxin 7
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3neqA00
1JE9A 2HLRA 5DO6A 2NBTA 1CDQA 1CXOA 2H8UA 2UWRA 1TFSA 1RGJA 2GOOC 1HOYA 1MR6A 1FRAA 1BTEA 1UG4A 1KC4A 1IKCA 1LXHA 1KBAA 2I9BE 1F94A 1ES7B 2H7ZA 1CVOA 1HC9A 1HAAA 2LCRA 5DU1A 3EBXA 5EBXA 1NYUA 1F8UB 1B41B 1FSSB 1KU6B 1TXBA 2UX2A 2CCXA 1FFJA 2N99A 3NEQA 1FASA 4LFTA 3U74U 2GOOB 1LX5B 4P7UA 1XT3A 1NORA 4XJJA 1PLOA 3PLCA 3VTSA 3ERAA 3KFDE 3LAQU 3U73U 3BT2U 3KFDI 1IJCA 1COEA 2MJYA 2CRSA 3NH7A 4ZQYA 1CTXA 1IDLA 2MJ0A 1BXPA 1S4YA 4BIKB 1FSCA 3QB4B 2MHYA 1IDIA 2BTXA 2H7ZB 2X8BB 4QTIU 1ONJA 2FD6U 4AEAA 1V6PA 1IQ9A 2ERAA 4FAOE 1NTNA 2MUPA 2MFAA 1JBDA 4BDTB 2LA1A 4OM4A 2H64C 4HQPF 3BT1U 2VLWA 2K3GA 4IYEA 1DRSA 2BHIA 1TXAA 1FF4A 1NEAA 2ABXA 2MJ4A 1ABTA 1QM7A 1QKDA 2OFSA 5DZ5A 1CRFA 1M9ZA 1CXNA 1KXIA 1RL5A 2CDXA 1NYSA 1CB9A 1IDHA 2JVEA 4UY2C 1HC9B 2CRTA 2J8BA 2L5SA 1LJZA 2PJYB 2H64B 1ERGA 2L03A 2MUOA 1IDGA 3NDSA 1CODA 1I02A 5IMYC 1W6BA 2QJBC 1KBTA 4OM5A 2PJYC 1CCQA 1CDTA 1G6MA 1YWHA 1NXBA 1KS6A 2QJAC 1QKEA 1JGKA 5IMTD 1KBSA 1L4WA 1KTZB 4FAOC 1H0JA 1LSIA 2H5FA 1CDRA 1NTXA 1CREA 2QC1A 4DO8A 1CHVS 4RUDA 2CTXA 2JQPA 2H62C 1LXGA 1TGXA 4EY8B 1HAJA 2H62D 1IK8A 2QJ9C 3FEVA 1REWC 6EBXA 1ERAA 1KL8A 1ZADA 2HLQA 3EVSC 1KFHA 1VB0A 1MAHF 1CDSA 3HH7A
chains in the Genus database with same CATH superfamily
1JE9A 2HLRA 5DO6A 2NBTA 1CDQA 1CXOA 2H8UA 2UWRA 1TFSA 1RGJA 2GOOC 1HOYA 1MR6A 1FRAA 1BTEA 1UG4A 1KC4A 1IKCA 1LXHA 1KBAA 2I9BE 1F94A 1ES7B 2H7ZA 1CVOA 1HC9A 1HAAA 2LCRA 5DU1A 3EBXA 5EBXA 1NYUA 1F8UB 1B41B 1FSSB 1KU6B 1TXBA 2UX2A 2CCXA 1FFJA 2N99A 3NEQA 1FASA 4LFTA 3U74U 2GOOB 1LX5B 4P7UA 1XT3A 1NORA 4XJJA 1PLOA 3PLCA 3VTSA 3ERAA 3KFDE 3LAQU 4KSNA 3U73U 3BT2U 3KFDI 1IJCA 1COEA 2MJYA 2CRSA 3NH7A 4ZQYA 1CTXA 1IDLA 2MJ0A 1BXPA 1S4YA 4BIKB 1FSCA 3QB4B 2MHYA 1IDIA 2BTXA 2H7ZB 2X8BB 4QTIU 1ONJA 2FD6U 4AEAA 1V6PA 1IQ9A 2ERAA 4FAOE 1NTNA 2MUPA 2MFAA 1JBDA 4BDTB 2LA1A 4OM4A 2H64C 4HQPF 3BT1U 2VLWA 2K3GA 4IYEA 1DRSA 2BHIA 1TXAA 1FF4A 1NEAA 2ABXA 2MJ4A 1ABTA 1QM7A 1QKDA 2OFSA 5DZ5A 1CRFA 1M9ZA 1CXNA 1KXIA 1RL5A 2CDXA 1NYSA 1CB9A 1IDHA 2JVEA 4UY2C 1HC9B 2CRTA 2J8BA 2L5SA 1LJZA 2PJYB 2H64B 1ERGA 2L03A 2MUOA 1IDGA 3NDSA 1CODA 1I02A 5IMYC 1W6BA 2QJBC 1KBTA 4OM5A 2PJYC 1CCQA 1CDTA 1G6MA 1YWHA 1NXBA 1KS6A 2QJAC 1QKEA 1JGKA 5IMTD 1KBSA 1L4WA 1KTZB 4FAOC 1H0JA 1LSIA 2H5FA 1CDRA 1NTXA 1CREA 2QC1A 4DO8A 1CHVS 4RUDA 2CTXA 2JQPA 2H62C 1LXGA 1TGXA 4EY8B 1HAJA 2H62D 1IK8A 2QJ9C 3FEVA 1REWC 6EBXA 1ERAA 1KL8A 1ZADA 2HLQA 3EVSC 1KFHA 1VB0A 1MAHF 1CDSA 3HH7A
chains in the Genus database with same CATH topology
1JE9A 2HLRA 5DO6A 2NBTA 1CDQA 1CXOA 2H8UA 2UWRA 1TFSA 1RGJA 2GOOC 1HOYA 1MR6A 1FRAA 1BTEA 1UG4A 1KC4A 1IKCA 1LXHA 1KBAA 2I9BE 1F94A 1ES7B 2H7ZA 1CVOA 1HC9A 1HAAA 2LCRA 5DU1A 3EBXA 5EBXA 1NYUA 1F8UB 1B41B 1FSSB 1KU6B 1TXBA 2UX2A 2CCXA 1FFJA 2N99A 3NEQA 1FASA 4LFTA 3U74U 2GOOB 1LX5B 4P7UA 1XT3A 1NORA 4XJJA 1PLOA 3PLCA 3VTSA 3ERAA 3KFDE 3LAQU 4KSNA 3U73U 3BT2U 3KFDI 1IJCA 1COEA 2MJYA 2CRSA 3NH7A 4ZQYA 1CTXA 1IDLA 2MJ0A 1BXPA 1S4YA 4BIKB 1FSCA 3QB4B 2MHYA 1IDIA 2BTXA 2H7ZB 2X8BB 4QTIU 1ONJA 2FD6U 4AEAA 1V6PA 1IQ9A 2ERAA 4FAOE 1NTNA 2MUPA 2MFAA 1JBDA 4BDTB 2LA1A 4OM4A 2H64C 4HQPF 3BT1U 2VLWA 2K3GA 4IYEA 1DRSA 2BHIA 1TXAA 1FF4A 1NEAA 2ABXA 2MJ4A 1ABTA 1QM7A 1QKDA 2OFSA 5DZ5A 1CRFA 1M9ZA 1CXNA 1KXIA 1RL5A 2CDXA 1NYSA 1CB9A 1IDHA 2JVEA 4UY2C 1HC9B 2CRTA 2J8BA 2L5SA 1LJZA 2PJYB 2H64B 1ERGA 2L03A 2MUOA 1IDGA 3NDSA 1CODA 1I02A 5IMYC 1W6BA 2QJBC 1KBTA 4OM5A 2PJYC 1CCQA 1CDTA 1G6MA 1YWHA 1NXBA 1KS6A 2QJAC 1QKEA 1JGKA 5IMTD 1KBSA 1L4WA 1KTZB 4FAOC 1H0JA 1LSIA 2H5FA 1CDRA 1NTXA 1CREA 2QC1A 4DO8A 1CHVS 4RUDA 2CTXA 2JQPA 2H62C 1LXGA 1TGXA 4EY8B 1HAJA 2H62D 1IK8A 2QJ9C 3FEVA 1REWC 6EBXA 1ERAA 1KL8A 1ZADA 2HLQA 3EVSC 1KFHA 1VB0A 1MAHF 1CDSA 3HH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE9 A;  2HLR A;  5DO6 A;  2NBT A;  1CDQ A;  1CXO A;  2H8U A;  2UWR A;  1TFS A;  1RGJ A;  2GOO C;  1HOY A;  1MR6 A;  1FRA A;  1BTE A;  1UG4 A;  1KC4 A;  1IKC A;  1LXH A;  1KBA A;  2I9B E;  1F94 A;  1ES7 B;  2H7Z A;  1CVO A;  1HC9 A;  1HAA A;  2LCR A;  5DU1 A;  3EBX A;  5EBX A;  1NYU A;  1F8U B;  1B41 B;  1FSS B;  1KU6 B;  1TXB A;  2UX2 A;  2CCX A;  1FFJ A;  2N99 A;  3NEQ A;  1FAS A;  4LFT A;  3U74 U;  2GOO B;  1LX5 B;  4P7U A;  1XT3 A;  1NOR A;  4XJJ A;  1PLO A;  3PLC A;  3VTS A;  3ERA A;  3KFD E;  3LAQ U;  3U73 U;  3BT2 U;  3KFD I;  1IJC A;  1COE A;  2MJY A;  2CRS A;  3NH7 A;  4ZQY A;  1CTX A;  1IDL A;  2MJ0 A;  1BXP A;  1S4Y A;  4BIK B;  1FSC A;  3QB4 B;  2MHY A;  1IDI A;  2BTX A;  2H7Z B;  2X8B B;  4QTI U;  1ONJ A;  2FD6 U;  4AEA A;  1V6P A;  1IQ9 A;  2ERA A;  4FAO E;  1NTN A;  2MUP A;  2MFA A;  1JBD A;  4BDT B;  2LA1 A;  4OM4 A;  2H64 C;  4HQP F;  3BT1 U;  2VLW A;  2K3G A;  4IYE A;  1DRS A;  2BHI A;  1TXA A;  1FF4 A;  1NEA A;  2ABX A;  2MJ4 A;  1ABT A;  1QM7 A;  1QKD A;  2OFS A;  5DZ5 A;  1CRF A;  1M9Z A;  1CXN A;  1KXI A;  1RL5 A;  2CDX A;  1NYS A;  1CB9 A;  1IDH A;  2JVE A;  4UY2 C;  1HC9 B;  2CRT A;  2J8B A;  2L5S A;  1LJZ A;  2PJY B;  2H64 B;  1ERG A;  2L03 A;  2MUO A;  1IDG A;  3NDS A;  1COD A;  1I02 A;  5IMY C;  1W6B A;  2QJB C;  1KBT A;  4OM5 A;  2PJY C;  1CCQ A;  1CDT A;  1G6M A;  1YWH A;  1NXB A;  1KS6 A;  2QJA C;  1QKE A;  1JGK A;  5IMT D;  1KBS A;  1L4W A;  1KTZ B;  4FAO C;  1H0J A;  1LSI A;  2H5F A;  1CDR A;  1NTX A;  1CRE A;  2QC1 A;  4DO8 A;  1CHV S;  4RUD A;  2CTX A;  2JQP A;  2H62 C;  1LXG A;  1TGX A;  4EY8 B;  1HAJ A;  2H62 D;  1IK8 A;  2QJ9 C;  3FEV A;  1REW C;  6EBX A;  1ERA A;  1KL8 A;  1ZAD A;  2HLQ A;  3EVS C;  1KFH A;  1VB0 A;  1MAH F;  1CDS A;  3HH7 A; 
#chains in the Genus database with same CATH topology
 1JE9 A;  2HLR A;  5DO6 A;  2NBT A;  1CDQ A;  1CXO A;  2H8U A;  2UWR A;  1TFS A;  1RGJ A;  2GOO C;  1HOY A;  1MR6 A;  1FRA A;  1BTE A;  1UG4 A;  1KC4 A;  1IKC A;  1LXH A;  1KBA A;  2I9B E;  1F94 A;  1ES7 B;  2H7Z A;  1CVO A;  1HC9 A;  1HAA A;  2LCR A;  5DU1 A;  3EBX A;  5EBX A;  1NYU A;  1F8U B;  1B41 B;  1FSS B;  1KU6 B;  1TXB A;  2UX2 A;  2CCX A;  1FFJ A;  2N99 A;  3NEQ A;  1FAS A;  4LFT A;  3U74 U;  2GOO B;  1LX5 B;  4P7U A;  1XT3 A;  1NOR A;  4XJJ A;  1PLO A;  3PLC A;  3VTS A;  3ERA A;  3KFD E;  3LAQ U;  4KSN A;  3U73 U;  3BT2 U;  3KFD I;  1IJC A;  1COE A;  2MJY A;  2CRS A;  3NH7 A;  4ZQY A;  1CTX A;  1IDL A;  2MJ0 A;  1BXP A;  1S4Y A;  4BIK B;  1FSC A;  3QB4 B;  2MHY A;  1IDI A;  2BTX A;  2H7Z B;  2X8B B;  4QTI U;  1ONJ A;  2FD6 U;  4AEA A;  1V6P A;  1IQ9 A;  2ERA A;  4FAO E;  1NTN A;  2MUP A;  2MFA A;  1JBD A;  4BDT B;  2LA1 A;  4OM4 A;  2H64 C;  4HQP F;  3BT1 U;  2VLW A;  2K3G A;  4IYE A;  1DRS A;  2BHI A;  1TXA A;  1FF4 A;  1NEA A;  2ABX A;  2MJ4 A;  1ABT A;  1QM7 A;  1QKD A;  2OFS A;  5DZ5 A;  1CRF A;  1M9Z A;  1CXN A;  1KXI A;  1RL5 A;  2CDX A;  1NYS A;  1CB9 A;  1IDH A;  2JVE A;  4UY2 C;  1HC9 B;  2CRT A;  2J8B A;  2L5S A;  1LJZ A;  2PJY B;  2H64 B;  1ERG A;  2L03 A;  2MUO A;  1IDG A;  3NDS A;  1COD A;  1I02 A;  5IMY C;  1W6B A;  2QJB C;  1KBT A;  4OM5 A;  2PJY C;  1CCQ A;  1CDT A;  1G6M A;  1YWH A;  1NXB A;  1KS6 A;  2QJA C;  1QKE A;  1JGK A;  5IMT D;  1KBS A;  1L4W A;  1KTZ B;  4FAO C;  1H0J A;  1LSI A;  2H5F A;  1CDR A;  1NTX A;  1CRE A;  2QC1 A;  4DO8 A;  1CHV S;  4RUD A;  2CTX A;  2JQP A;  2H62 C;  1LXG A;  1TGX A;  4EY8 B;  1HAJ A;  2H62 D;  1IK8 A;  2QJ9 C;  3FEV A;  1REW C;  6EBX A;  1ERA A;  1KL8 A;  1ZAD A;  2HLQ A;  3EVS C;  1KFH A;  1VB0 A;  1MAH F;  1CDS A;  3HH7 A; 
#chains in the Genus database with same CATH homology
 1JE9 A;  2HLR A;  5DO6 A;  2NBT A;  1CDQ A;  1CXO A;  2H8U A;  2UWR A;  1TFS A;  1RGJ A;  2GOO C;  1HOY A;  1MR6 A;  1FRA A;  1BTE A;  1UG4 A;  1KC4 A;  1IKC A;  1LXH A;  1KBA A;  2I9B E;  1F94 A;  1ES7 B;  2H7Z A;  1CVO A;  1HC9 A;  1HAA A;  2LCR A;  5DU1 A;  3EBX A;  5EBX A;  1NYU A;  1F8U B;  1B41 B;  1FSS B;  1KU6 B;  1TXB A;  2UX2 A;  2CCX A;  1FFJ A;  2N99 A;  3NEQ A;  1FAS A;  4LFT A;  3U74 U;  2GOO B;  1LX5 B;  4P7U A;  1XT3 A;  1NOR A;  4XJJ A;  1PLO A;  3PLC A;  3VTS A;  3ERA A;  3KFD E;  3LAQ U;  4KSN A;  3U73 U;  3BT2 U;  3KFD I;  1IJC A;  1COE A;  2MJY A;  2CRS A;  3NH7 A;  4ZQY A;  1CTX A;  1IDL A;  2MJ0 A;  1BXP A;  1S4Y A;  4BIK B;  1FSC A;  3QB4 B;  2MHY A;  1IDI A;  2BTX A;  2H7Z B;  2X8B B;  4QTI U;  1ONJ A;  2FD6 U;  4AEA A;  1V6P A;  1IQ9 A;  2ERA A;  4FAO E;  1NTN A;  2MUP A;  2MFA A;  1JBD A;  4BDT B;  2LA1 A;  4OM4 A;  2H64 C;  4HQP F;  3BT1 U;  2VLW A;  2K3G A;  4IYE A;  1DRS A;  2BHI A;  1TXA A;  1FF4 A;  1NEA A;  2ABX A;  2MJ4 A;  1ABT A;  1QM7 A;  1QKD A;  2OFS A;  5DZ5 A;  1CRF A;  1M9Z A;  1CXN A;  1KXI A;  1RL5 A;  2CDX A;  1NYS A;  1CB9 A;  1IDH A;  2JVE A;  4UY2 C;  1HC9 B;  2CRT A;  2J8B A;  2L5S A;  1LJZ A;  2PJY B;  2H64 B;  1ERG A;  2L03 A;  2MUO A;  1IDG A;  3NDS A;  1COD A;  1I02 A;  5IMY C;  1W6B A;  2QJB C;  1KBT A;  4OM5 A;  2PJY C;  1CCQ A;  1CDT A;  1G6M A;  1YWH A;  1NXB A;  1KS6 A;  2QJA C;  1QKE A;  1JGK A;  5IMT D;  1KBS A;  1L4W A;  1KTZ B;  4FAO C;  1H0J A;  1LSI A;  2H5F A;  1CDR A;  1NTX A;  1CRE A;  2QC1 A;  4DO8 A;  1CHV S;  4RUD A;  2CTX A;  2JQP A;  2H62 C;  1LXG A;  1TGX A;  4EY8 B;  1HAJ A;  2H62 D;  1IK8 A;  2QJ9 C;  3FEV A;  1REW C;  6EBX A;  1ERA A;  1KL8 A;  1ZAD A;  2HLQ A;  3EVS C;  1KFH A;  1VB0 A;  1MAH F;  1CDS A;  3HH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...