3NEQA

Crystal structure of the chimeric muscarinic toxin mt7 with loop 3 from mt1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKPTNVRETIRCCGTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Three-finger muscarinic toxin 7
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
molecule tags Toxin
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3neqA00
1ONJA 1LSIA 1IQ9A 1CXNA 2NBTA 3KFDE 1FFJA 1KXIA 2ABXA 3PLCA 1NTNA 3U74U 1NTXA 1ERGA 1B41B 1KL8A 1IDGA 4OM4A 2OFSA 1REWC 2PJYC 2QC1A 1UG4A 1XT3A 3BT1U 1IDLA 4BIKB 2I9BE 1QM7A 2MFAA 3LAQU 1CODA 2H5FA 2N99A 2QJBC 1IK8A 2L03A 1FSSB 3FEVA 5DZ5A 1I02A 4BDTB 1NORA 4EY8B 4XJJA 1HOYA 1NEAA 1KBAA 1MAHF 3U73U 2CCXA 1KBTA 2JVEA 4UY2C 2H64C 2CRTA 2X8BB 1JGKA 2H62D 1QKDA 2ERAA 5IMYC 2QJ9C 3EBXA 3ERAA 3QB4B 2HLRA 1S4YA 1CDSA 5DO6A 2CTXA 2MJ4A 2CDXA 1BXPA 2FD6U 3VTSA 1DRSA 1QKEA 4HQPF 1HC9B 1HAJA 1CREA 2UWRA 5IMTD 1FF4A 3KFDI 1MR6A 1FSCA 1HC9A 1M9ZA 4OM5A 1IJCA 3HH7A 2UX2A 1ZADA 2LA1A 4AEAA 1CXOA 2PJYB 1IKCA 1NXBA 4DO8A 1KTZB 2L5SA 1LXHA 1FASA 2MUOA 3NDSA 1KU6B 1YWHA 1CDQA 2BTXA 1NYUA 1IDIA 2GOOC 1ABTA 1TXBA 2JQPA 1JE9A 1ERAA 1FRAA 1RL5A 1RGJA 1TXAA 4ZQYA 1KS6A 5DU1A 3EVSC 1CRFA 1IDHA 1W6BA 1VB0A 2MJ0A 1CHVS 1V6PA 1JBDA 2QJAC 2HLQA 1H0JA 1KC4A 6EBXA 1COEA 2K3GA 1F8UB 1KFHA 1CTXA 5EBXA 4FAOC 1BTEA 1CDRA 4LFTA 1ES7B 1G6MA 3BT2U 2VLWA 3NH7A 2J8BA 2MUPA 1LXGA 4RUDA 1L4WA 2MJYA 2H64B 2H8UA 2BHIA 1KBSA 2H7ZB 4QTIU 4FAOE 1TFSA 1F94A 1CVOA 2LCRA 1CCQA 2H7ZA 2GOOB 1HAAA 1NYSA 1CB9A 4P7UA 1CDTA 2MHYA 4IYEA 3NEQA 1TGXA 2CRSA 1PLOA 2H62C 1LJZA 1LX5B
chains in the Genus database with same CATH superfamily
1ONJA 1LSIA 1IQ9A 1CXNA 2NBTA 3KFDE 1FFJA 1KXIA 2ABXA 3PLCA 1NTNA 3U74U 1NTXA 1ERGA 1B41B 1KL8A 1IDGA 4OM4A 2OFSA 1REWC 2PJYC 2QC1A 1UG4A 1XT3A 3BT1U 1IDLA 4BIKB 2I9BE 1QM7A 2MFAA 3LAQU 1CODA 2H5FA 2N99A 2QJBC 1IK8A 2L03A 1FSSB 3FEVA 5DZ5A 1I02A 4BDTB 1NORA 4EY8B 4XJJA 1HOYA 1NEAA 1KBAA 1MAHF 3U73U 2CCXA 1KBTA 2JVEA 4UY2C 2H64C 2CRTA 2X8BB 1JGKA 2H62D 1QKDA 2ERAA 5IMYC 2QJ9C 3EBXA 3ERAA 3QB4B 2HLRA 1S4YA 1CDSA 5DO6A 2CTXA 2MJ4A 2CDXA 1BXPA 2FD6U 3VTSA 1DRSA 1QKEA 4HQPF 1HC9B 1HAJA 1CREA 2UWRA 5IMTD 1FF4A 3KFDI 1MR6A 1FSCA 1HC9A 1M9ZA 4OM5A 1IJCA 3HH7A 2UX2A 1ZADA 2LA1A 4AEAA 1CXOA 2PJYB 1IKCA 1NXBA 4DO8A 1KTZB 2L5SA 1LXHA 1FASA 2MUOA 3NDSA 1KU6B 1YWHA 1CDQA 2BTXA 1NYUA 1IDIA 2GOOC 1ABTA 1TXBA 2JQPA 1JE9A 1ERAA 1FRAA 1RL5A 1RGJA 1TXAA 4ZQYA 1KS6A 5DU1A 3EVSC 1CRFA 1IDHA 1W6BA 1VB0A 2MJ0A 1CHVS 1V6PA 1JBDA 2QJAC 2HLQA 1H0JA 1KC4A 6EBXA 1COEA 2K3GA 1F8UB 4KSNA 1KFHA 1CTXA 5EBXA 4FAOC 1BTEA 1CDRA 4LFTA 1ES7B 1G6MA 3BT2U 2VLWA 3NH7A 2J8BA 2MUPA 1LXGA 4RUDA 1L4WA 2MJYA 2H64B 2H8UA 2BHIA 1KBSA 2H7ZB 4QTIU 4FAOE 1TFSA 1F94A 1CVOA 2LCRA 1CCQA 2H7ZA 2GOOB 1HAAA 1NYSA 1CB9A 4P7UA 1CDTA 2MHYA 4IYEA 3NEQA 1TGXA 2CRSA 1PLOA 2H62C 1LJZA 1LX5B
chains in the Genus database with same CATH topology
1ONJA 1LSIA 1IQ9A 1CXNA 2NBTA 3KFDE 1FFJA 1KXIA 2ABXA 3PLCA 1NTNA 3U74U 1NTXA 1ERGA 1B41B 1KL8A 1IDGA 4OM4A 2OFSA 1REWC 2PJYC 2QC1A 1UG4A 1XT3A 3BT1U 1IDLA 4BIKB 2I9BE 1QM7A 2MFAA 3LAQU 1CODA 2H5FA 2N99A 2QJBC 1IK8A 2L03A 1FSSB 3FEVA 5DZ5A 1I02A 4BDTB 1NORA 4EY8B 4XJJA 1HOYA 1NEAA 1KBAA 1MAHF 3U73U 2CCXA 1KBTA 2JVEA 4UY2C 2H64C 2CRTA 2X8BB 1JGKA 2H62D 1QKDA 2ERAA 5IMYC 2QJ9C 3EBXA 3ERAA 3QB4B 2HLRA 1S4YA 1CDSA 5DO6A 2CTXA 2MJ4A 2CDXA 1BXPA 2FD6U 3VTSA 1DRSA 1QKEA 4HQPF 1HC9B 1HAJA 1CREA 2UWRA 5IMTD 1FF4A 3KFDI 1MR6A 1FSCA 1HC9A 1M9ZA 4OM5A 1IJCA 3HH7A 2UX2A 1ZADA 2LA1A 4AEAA 1CXOA 2PJYB 1IKCA 1NXBA 4DO8A 1KTZB 2L5SA 1LXHA 1FASA 2MUOA 3NDSA 1KU6B 1YWHA 1CDQA 2BTXA 1NYUA 1IDIA 2GOOC 1ABTA 1TXBA 2JQPA 1JE9A 1ERAA 1FRAA 1RL5A 1RGJA 1TXAA 4ZQYA 1KS6A 5DU1A 3EVSC 1CRFA 1IDHA 1W6BA 1VB0A 2MJ0A 1CHVS 1V6PA 1JBDA 2QJAC 2HLQA 1H0JA 1KC4A 6EBXA 1COEA 2K3GA 1F8UB 4KSNA 1KFHA 1CTXA 5EBXA 4FAOC 1BTEA 1CDRA 4LFTA 1ES7B 1G6MA 3BT2U 2VLWA 3NH7A 2J8BA 2MUPA 1LXGA 4RUDA 1L4WA 2MJYA 2H64B 2H8UA 2BHIA 1KBSA 2H7ZB 4QTIU 4FAOE 1TFSA 1F94A 1CVOA 2LCRA 1CCQA 2H7ZA 2GOOB 1HAAA 1NYSA 1CB9A 4P7UA 1CDTA 2MHYA 4IYEA 3NEQA 1TGXA 2CRSA 1PLOA 2H62C 1LJZA 1LX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONJ A;  1LSI A;  1IQ9 A;  1CXN A;  2NBT A;  3KFD E;  1FFJ A;  1KXI A;  2ABX A;  3PLC A;  1NTN A;  3U74 U;  1NTX A;  1ERG A;  1B41 B;  1KL8 A;  1IDG A;  4OM4 A;  2OFS A;  1REW C;  2PJY C;  2QC1 A;  1UG4 A;  1XT3 A;  3BT1 U;  1IDL A;  4BIK B;  2I9B E;  1QM7 A;  2MFA A;  3LAQ U;  1COD A;  2H5F A;  2N99 A;  2QJB C;  1IK8 A;  2L03 A;  1FSS B;  3FEV A;  5DZ5 A;  1I02 A;  4BDT B;  1NOR A;  4EY8 B;  4XJJ A;  1HOY A;  1NEA A;  1KBA A;  1MAH F;  3U73 U;  2CCX A;  1KBT A;  2JVE A;  4UY2 C;  2H64 C;  2CRT A;  2X8B B;  1JGK A;  2H62 D;  1QKD A;  2ERA A;  5IMY C;  2QJ9 C;  3EBX A;  3ERA A;  3QB4 B;  2HLR A;  1S4Y A;  1CDS A;  5DO6 A;  2CTX A;  2MJ4 A;  2CDX A;  1BXP A;  2FD6 U;  3VTS A;  1DRS A;  1QKE A;  4HQP F;  1HC9 B;  1HAJ A;  1CRE A;  2UWR A;  5IMT D;  1FF4 A;  3KFD I;  1MR6 A;  1FSC A;  1HC9 A;  1M9Z A;  4OM5 A;  1IJC A;  3HH7 A;  2UX2 A;  1ZAD A;  2LA1 A;  4AEA A;  1CXO A;  2PJY B;  1IKC A;  1NXB A;  4DO8 A;  1KTZ B;  2L5S A;  1LXH A;  1FAS A;  2MUO A;  3NDS A;  1KU6 B;  1YWH A;  1CDQ A;  2BTX A;  1NYU A;  1IDI A;  2GOO C;  1ABT A;  1TXB A;  2JQP A;  1JE9 A;  1ERA A;  1FRA A;  1RL5 A;  1RGJ A;  1TXA A;  4ZQY A;  1KS6 A;  5DU1 A;  3EVS C;  1CRF A;  1IDH A;  1W6B A;  1VB0 A;  2MJ0 A;  1CHV S;  1V6P A;  1JBD A;  2QJA C;  2HLQ A;  1H0J A;  1KC4 A;  6EBX A;  1COE A;  2K3G A;  1F8U B;  1KFH A;  1CTX A;  5EBX A;  4FAO C;  1BTE A;  1CDR A;  4LFT A;  1ES7 B;  1G6M A;  3BT2 U;  2VLW A;  3NH7 A;  2J8B A;  2MUP A;  1LXG A;  4RUD A;  1L4W A;  2MJY A;  2H64 B;  2H8U A;  2BHI A;  1KBS A;  2H7Z B;  4QTI U;  4FAO E;  1TFS A;  1F94 A;  1CVO A;  2LCR A;  1CCQ A;  2H7Z A;  2GOO B;  1HAA A;  1NYS A;  1CB9 A;  4P7U A;  1CDT A;  2MHY A;  4IYE A;  3NEQ A;  1TGX A;  2CRS A;  1PLO A;  2H62 C;  1LJZ A;  1LX5 B; 
#chains in the Genus database with same CATH topology
 1ONJ A;  1LSI A;  1IQ9 A;  1CXN A;  2NBT A;  3KFD E;  1FFJ A;  1KXI A;  2ABX A;  3PLC A;  1NTN A;  3U74 U;  1NTX A;  1ERG A;  1B41 B;  1KL8 A;  1IDG A;  4OM4 A;  2OFS A;  1REW C;  2PJY C;  2QC1 A;  1UG4 A;  1XT3 A;  3BT1 U;  1IDL A;  4BIK B;  2I9B E;  1QM7 A;  2MFA A;  3LAQ U;  1COD A;  2H5F A;  2N99 A;  2QJB C;  1IK8 A;  2L03 A;  1FSS B;  3FEV A;  5DZ5 A;  1I02 A;  4BDT B;  1NOR A;  4EY8 B;  4XJJ A;  1HOY A;  1NEA A;  1KBA A;  1MAH F;  3U73 U;  2CCX A;  1KBT A;  2JVE A;  4UY2 C;  2H64 C;  2CRT A;  2X8B B;  1JGK A;  2H62 D;  1QKD A;  2ERA A;  5IMY C;  2QJ9 C;  3EBX A;  3ERA A;  3QB4 B;  2HLR A;  1S4Y A;  1CDS A;  5DO6 A;  2CTX A;  2MJ4 A;  2CDX A;  1BXP A;  2FD6 U;  3VTS A;  1DRS A;  1QKE A;  4HQP F;  1HC9 B;  1HAJ A;  1CRE A;  2UWR A;  5IMT D;  1FF4 A;  3KFD I;  1MR6 A;  1FSC A;  1HC9 A;  1M9Z A;  4OM5 A;  1IJC A;  3HH7 A;  2UX2 A;  1ZAD A;  2LA1 A;  4AEA A;  1CXO A;  2PJY B;  1IKC A;  1NXB A;  4DO8 A;  1KTZ B;  2L5S A;  1LXH A;  1FAS A;  2MUO A;  3NDS A;  1KU6 B;  1YWH A;  1CDQ A;  2BTX A;  1NYU A;  1IDI A;  2GOO C;  1ABT A;  1TXB A;  2JQP A;  1JE9 A;  1ERA A;  1FRA A;  1RL5 A;  1RGJ A;  1TXA A;  4ZQY A;  1KS6 A;  5DU1 A;  3EVS C;  1CRF A;  1IDH A;  1W6B A;  1VB0 A;  2MJ0 A;  1CHV S;  1V6P A;  1JBD A;  2QJA C;  2HLQ A;  1H0J A;  1KC4 A;  6EBX A;  1COE A;  2K3G A;  1F8U B;  4KSN A;  1KFH A;  1CTX A;  5EBX A;  4FAO C;  1BTE A;  1CDR A;  4LFT A;  1ES7 B;  1G6M A;  3BT2 U;  2VLW A;  3NH7 A;  2J8B A;  2MUP A;  1LXG A;  4RUD A;  1L4W A;  2MJY A;  2H64 B;  2H8U A;  2BHI A;  1KBS A;  2H7Z B;  4QTI U;  4FAO E;  1TFS A;  1F94 A;  1CVO A;  2LCR A;  1CCQ A;  2H7Z A;  2GOO B;  1HAA A;  1NYS A;  1CB9 A;  4P7U A;  1CDT A;  2MHY A;  4IYE A;  3NEQ A;  1TGX A;  2CRS A;  1PLO A;  2H62 C;  1LJZ A;  1LX5 B; 
#chains in the Genus database with same CATH homology
 1ONJ A;  1LSI A;  1IQ9 A;  1CXN A;  2NBT A;  3KFD E;  1FFJ A;  1KXI A;  2ABX A;  3PLC A;  1NTN A;  3U74 U;  1NTX A;  1ERG A;  1B41 B;  1KL8 A;  1IDG A;  4OM4 A;  2OFS A;  1REW C;  2PJY C;  2QC1 A;  1UG4 A;  1XT3 A;  3BT1 U;  1IDL A;  4BIK B;  2I9B E;  1QM7 A;  2MFA A;  3LAQ U;  1COD A;  2H5F A;  2N99 A;  2QJB C;  1IK8 A;  2L03 A;  1FSS B;  3FEV A;  5DZ5 A;  1I02 A;  4BDT B;  1NOR A;  4EY8 B;  4XJJ A;  1HOY A;  1NEA A;  1KBA A;  1MAH F;  3U73 U;  2CCX A;  1KBT A;  2JVE A;  4UY2 C;  2H64 C;  2CRT A;  2X8B B;  1JGK A;  2H62 D;  1QKD A;  2ERA A;  5IMY C;  2QJ9 C;  3EBX A;  3ERA A;  3QB4 B;  2HLR A;  1S4Y A;  1CDS A;  5DO6 A;  2CTX A;  2MJ4 A;  2CDX A;  1BXP A;  2FD6 U;  3VTS A;  1DRS A;  1QKE A;  4HQP F;  1HC9 B;  1HAJ A;  1CRE A;  2UWR A;  5IMT D;  1FF4 A;  3KFD I;  1MR6 A;  1FSC A;  1HC9 A;  1M9Z A;  4OM5 A;  1IJC A;  3HH7 A;  2UX2 A;  1ZAD A;  2LA1 A;  4AEA A;  1CXO A;  2PJY B;  1IKC A;  1NXB A;  4DO8 A;  1KTZ B;  2L5S A;  1LXH A;  1FAS A;  2MUO A;  3NDS A;  1KU6 B;  1YWH A;  1CDQ A;  2BTX A;  1NYU A;  1IDI A;  2GOO C;  1ABT A;  1TXB A;  2JQP A;  1JE9 A;  1ERA A;  1FRA A;  1RL5 A;  1RGJ A;  1TXA A;  4ZQY A;  1KS6 A;  5DU1 A;  3EVS C;  1CRF A;  1IDH A;  1W6B A;  1VB0 A;  2MJ0 A;  1CHV S;  1V6P A;  1JBD A;  2QJA C;  2HLQ A;  1H0J A;  1KC4 A;  6EBX A;  1COE A;  2K3G A;  1F8U B;  4KSN A;  1KFH A;  1CTX A;  5EBX A;  4FAO C;  1BTE A;  1CDR A;  4LFT A;  1ES7 B;  1G6M A;  3BT2 U;  2VLW A;  3NH7 A;  2J8B A;  2MUP A;  1LXG A;  4RUD A;  1L4W A;  2MJY A;  2H64 B;  2H8U A;  2BHI A;  1KBS A;  2H7Z B;  4QTI U;  4FAO E;  1TFS A;  1F94 A;  1CVO A;  2LCR A;  1CCQ A;  2H7Z A;  2GOO B;  1HAA A;  1NYS A;  1CB9 A;  4P7U A;  1CDT A;  2MHY A;  4IYE A;  3NEQ A;  1TGX A;  2CRS A;  1PLO A;  2H62 C;  1LJZ A;  1LX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...