3NEQA

Crystal structure of the chimeric muscarinic toxin mt7 with loop 3 from mt1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
LTCVKSNSIWFPTSEDCPDGQNLCFKRWQYISPRMYDFTRGCAATCPKPTNVRETIRCCGTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Three-finger muscarinic toxin 7
publication title Engineering of three-finger fold toxins creates ligands with original pharmacological profiles for muscarinic and adrenergic receptors.
pubmed doi rcsb
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3neqA00
1ONJA 4BIKB 2LA1A 1I02A 1FF4A 2K3GA 1ZADA 3NEQA 1H0JA 5IMYC 2MHYA 1CCQA 1W6BA 1TFSA 4FAOC 1CDRA 2MUOA 3BT2U 1DRSA 1V6PA 2UX2A 3BT1U 5DU1A 1NYUA 1FRAA 4LFTA 1KC4A 1IK8A 1IDHA 1CTXA 5EBXA 5DZ5A 2CRTA 1F94A 1CRFA 2MJYA 3KFDE 2ERAA 1G6MA 4DO8A 2H7ZB 2H7ZA 1NEAA 1KFHA 1NYSA 1LXGA 1F8UB 1IJCA 4EY8B 1FFJA 1IDLA 1ABTA 1L4WA 2ABXA 2MUPA 4XJJA 2QJAC 4UY2C 1HC9B 1IDIA 1HC9A 2QJBC 2MJ4A 2CDXA 2UWRA 2X8BB 5IMTD 1ES7B 1NTNA 1CDSA 1S4YA 1CDTA 2QJ9C 1JGKA 1MR6A 3VTSA 1CB9A 2MJ0A 1JE9A 3QB4B 1XT3A 5DO6A 2BHIA 1CODA 1NTXA 2J8BA 4QTIU 3U73U 1KU6B 4AEAA 1NORA 1HAJA 1LXHA 1COEA 3U74U 2H62C 1CXOA 4ZQYA 1CREA 4BDTB 1VB0A 1UG4A 4RUDA 2CRSA 2NBTA 1RGJA 3NDSA 1PLOA 1BXPA 1CVOA 1NXBA 4OM4A 1M9ZA 1KBTA 2BTXA 1CHVS 4P7UA 1TXBA 2VLWA 1ERAA 1KS6A 2JVEA 1BTEA 1HAAA 2HLRA 3KFDI 2OFSA 3EBXA 1B41B 3LAQU 1TXAA 2CCXA 2L5SA 2HLQA 3PLCA 2PJYC 1LJZA 3EVSC 2H5FA 1QKDA 1IKCA 2FD6U 3FEVA 1FSCA 4IYEA 1MAHF 1QM7A 1CXNA 2LCRA 2H64C 1QKEA 2H62D 1KBAA 1TGXA 1KTZB 2MFAA 1HOYA 1IDGA 2QC1A 2PJYB 6EBXA 1KXIA 2GOOB 1RL5A 2N99A 3HH7A 3NH7A 1CDQA 2JQPA 2I9BE 1KL8A 1IQ9A 1LSIA 2L03A 1JBDA 1FASA 1LX5B 2H64B 2CTXA 1FSSB 1ERGA 1YWHA 3ERAA 2GOOC 4HQPF 4OM5A 2H8UA 1KBSA 1REWC 4FAOE
chains in the Genus database with same CATH superfamily
1ONJA 4BIKB 2LA1A 1I02A 1FF4A 2K3GA 1ZADA 3NEQA 1H0JA 5IMYC 2MHYA 1CCQA 1W6BA 1TFSA 4FAOC 1CDRA 2MUOA 3BT2U 1DRSA 1V6PA 2UX2A 3BT1U 5DU1A 1NYUA 1FRAA 4LFTA 1KC4A 1IK8A 1IDHA 1CTXA 5EBXA 5DZ5A 2CRTA 1F94A 1CRFA 2MJYA 3KFDE 2ERAA 1G6MA 4DO8A 2H7ZB 2H7ZA 1NEAA 1KFHA 1NYSA 1LXGA 1F8UB 1IJCA 4EY8B 1FFJA 1IDLA 1ABTA 1L4WA 2ABXA 2MUPA 4XJJA 2QJAC 4UY2C 1HC9B 1IDIA 1HC9A 2QJBC 2MJ4A 2CDXA 2UWRA 2X8BB 5IMTD 1ES7B 1NTNA 1CDSA 1S4YA 1CDTA 2QJ9C 1JGKA 1MR6A 3VTSA 1CB9A 2MJ0A 1JE9A 4KSNA 3QB4B 1XT3A 5DO6A 2BHIA 1CODA 1NTXA 2J8BA 4QTIU 3U73U 1KU6B 4AEAA 1NORA 1HAJA 1LXHA 1COEA 3U74U 2H62C 1CXOA 4ZQYA 1CREA 4BDTB 1VB0A 1UG4A 4RUDA 2CRSA 2NBTA 1RGJA 3NDSA 1PLOA 1BXPA 1CVOA 1NXBA 4OM4A 1M9ZA 1KBTA 2BTXA 1CHVS 4P7UA 1TXBA 2VLWA 1ERAA 1KS6A 2JVEA 1BTEA 1HAAA 2HLRA 3KFDI 2OFSA 3EBXA 1B41B 3LAQU 1TXAA 2CCXA 2L5SA 2HLQA 3PLCA 2PJYC 1LJZA 3EVSC 2H5FA 1QKDA 1IKCA 2FD6U 3FEVA 1FSCA 4IYEA 1MAHF 1QM7A 1CXNA 2LCRA 2H64C 1QKEA 2H62D 1KBAA 1TGXA 1KTZB 2MFAA 1HOYA 1IDGA 2QC1A 2PJYB 6EBXA 1KXIA 2GOOB 1RL5A 2N99A 3HH7A 3NH7A 1CDQA 2JQPA 2I9BE 1KL8A 1IQ9A 1LSIA 2L03A 1JBDA 1FASA 1LX5B 2H64B 2CTXA 1FSSB 1ERGA 1YWHA 3ERAA 2GOOC 4HQPF 4OM5A 2H8UA 1KBSA 1REWC 4FAOE
chains in the Genus database with same CATH topology
1ONJA 4BIKB 2LA1A 1I02A 1FF4A 2K3GA 1ZADA 3NEQA 1H0JA 5IMYC 2MHYA 1CCQA 1W6BA 1TFSA 4FAOC 1CDRA 2MUOA 3BT2U 1DRSA 1V6PA 2UX2A 3BT1U 5DU1A 1NYUA 1FRAA 4LFTA 1KC4A 1IK8A 1IDHA 1CTXA 5EBXA 5DZ5A 2CRTA 1F94A 1CRFA 2MJYA 3KFDE 2ERAA 1G6MA 4DO8A 2H7ZB 2H7ZA 1NEAA 1KFHA 1NYSA 1LXGA 1F8UB 1IJCA 4EY8B 1FFJA 1IDLA 1ABTA 1L4WA 2ABXA 2MUPA 4XJJA 2QJAC 4UY2C 1HC9B 1IDIA 1HC9A 2QJBC 2MJ4A 2CDXA 2UWRA 2X8BB 5IMTD 1ES7B 1NTNA 1CDSA 1S4YA 1CDTA 2QJ9C 1JGKA 1MR6A 3VTSA 1CB9A 2MJ0A 1JE9A 4KSNA 3QB4B 1XT3A 5DO6A 2BHIA 1CODA 1NTXA 2J8BA 4QTIU 3U73U 1KU6B 4AEAA 1NORA 1HAJA 1LXHA 1COEA 3U74U 2H62C 1CXOA 4ZQYA 1CREA 4BDTB 1VB0A 1UG4A 4RUDA 2CRSA 2NBTA 1RGJA 3NDSA 1PLOA 1BXPA 1CVOA 1NXBA 4OM4A 1M9ZA 1KBTA 2BTXA 1CHVS 4P7UA 1TXBA 2VLWA 1ERAA 1KS6A 2JVEA 1BTEA 1HAAA 2HLRA 3KFDI 2OFSA 3EBXA 1B41B 3LAQU 1TXAA 2CCXA 2L5SA 2HLQA 3PLCA 2PJYC 1LJZA 3EVSC 2H5FA 1QKDA 1IKCA 2FD6U 3FEVA 1FSCA 4IYEA 1MAHF 1QM7A 1CXNA 2LCRA 2H64C 1QKEA 2H62D 1KBAA 1TGXA 1KTZB 2MFAA 1HOYA 1IDGA 2QC1A 2PJYB 6EBXA 1KXIA 2GOOB 1RL5A 2N99A 3HH7A 3NH7A 1CDQA 2JQPA 2I9BE 1KL8A 1IQ9A 1LSIA 2L03A 1JBDA 1FASA 1LX5B 2H64B 2CTXA 1FSSB 1ERGA 1YWHA 3ERAA 2GOOC 4HQPF 4OM5A 2H8UA 1KBSA 1REWC 4FAOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONJ A;  4BIK B;  2LA1 A;  1I02 A;  1FF4 A;  2K3G A;  1ZAD A;  3NEQ A;  1H0J A;  5IMY C;  2MHY A;  1CCQ A;  1W6B A;  1TFS A;  4FAO C;  1CDR A;  2MUO A;  3BT2 U;  1DRS A;  1V6P A;  2UX2 A;  3BT1 U;  5DU1 A;  1NYU A;  1FRA A;  4LFT A;  1KC4 A;  1IK8 A;  1IDH A;  1CTX A;  5EBX A;  5DZ5 A;  2CRT A;  1F94 A;  1CRF A;  2MJY A;  3KFD E;  2ERA A;  1G6M A;  4DO8 A;  2H7Z B;  2H7Z A;  1NEA A;  1KFH A;  1NYS A;  1LXG A;  1F8U B;  1IJC A;  4EY8 B;  1FFJ A;  1IDL A;  1ABT A;  1L4W A;  2ABX A;  2MUP A;  4XJJ A;  2QJA C;  4UY2 C;  1HC9 B;  1IDI A;  1HC9 A;  2QJB C;  2MJ4 A;  2CDX A;  2UWR A;  2X8B B;  5IMT D;  1ES7 B;  1NTN A;  1CDS A;  1S4Y A;  1CDT A;  2QJ9 C;  1JGK A;  1MR6 A;  3VTS A;  1CB9 A;  2MJ0 A;  1JE9 A;  3QB4 B;  1XT3 A;  5DO6 A;  2BHI A;  1COD A;  1NTX A;  2J8B A;  4QTI U;  3U73 U;  1KU6 B;  4AEA A;  1NOR A;  1HAJ A;  1LXH A;  1COE A;  3U74 U;  2H62 C;  1CXO A;  4ZQY A;  1CRE A;  4BDT B;  1VB0 A;  1UG4 A;  4RUD A;  2CRS A;  2NBT A;  1RGJ A;  3NDS A;  1PLO A;  1BXP A;  1CVO A;  1NXB A;  4OM4 A;  1M9Z A;  1KBT A;  2BTX A;  1CHV S;  4P7U A;  1TXB A;  2VLW A;  1ERA A;  1KS6 A;  2JVE A;  1BTE A;  1HAA A;  2HLR A;  3KFD I;  2OFS A;  3EBX A;  1B41 B;  3LAQ U;  1TXA A;  2CCX A;  2L5S A;  2HLQ A;  3PLC A;  2PJY C;  1LJZ A;  3EVS C;  2H5F A;  1QKD A;  1IKC A;  2FD6 U;  3FEV A;  1FSC A;  4IYE A;  1MAH F;  1QM7 A;  1CXN A;  2LCR A;  2H64 C;  1QKE A;  2H62 D;  1KBA A;  1TGX A;  1KTZ B;  2MFA A;  1HOY A;  1IDG A;  2QC1 A;  2PJY B;  6EBX A;  1KXI A;  2GOO B;  1RL5 A;  2N99 A;  3HH7 A;  3NH7 A;  1CDQ A;  2JQP A;  2I9B E;  1KL8 A;  1IQ9 A;  1LSI A;  2L03 A;  1JBD A;  1FAS A;  1LX5 B;  2H64 B;  2CTX A;  1FSS B;  1ERG A;  1YWH A;  3ERA A;  2GOO C;  4HQP F;  4OM5 A;  2H8U A;  1KBS A;  1REW C;  4FAO E; 
#chains in the Genus database with same CATH topology
 1ONJ A;  4BIK B;  2LA1 A;  1I02 A;  1FF4 A;  2K3G A;  1ZAD A;  3NEQ A;  1H0J A;  5IMY C;  2MHY A;  1CCQ A;  1W6B A;  1TFS A;  4FAO C;  1CDR A;  2MUO A;  3BT2 U;  1DRS A;  1V6P A;  2UX2 A;  3BT1 U;  5DU1 A;  1NYU A;  1FRA A;  4LFT A;  1KC4 A;  1IK8 A;  1IDH A;  1CTX A;  5EBX A;  5DZ5 A;  2CRT A;  1F94 A;  1CRF A;  2MJY A;  3KFD E;  2ERA A;  1G6M A;  4DO8 A;  2H7Z B;  2H7Z A;  1NEA A;  1KFH A;  1NYS A;  1LXG A;  1F8U B;  1IJC A;  4EY8 B;  1FFJ A;  1IDL A;  1ABT A;  1L4W A;  2ABX A;  2MUP A;  4XJJ A;  2QJA C;  4UY2 C;  1HC9 B;  1IDI A;  1HC9 A;  2QJB C;  2MJ4 A;  2CDX A;  2UWR A;  2X8B B;  5IMT D;  1ES7 B;  1NTN A;  1CDS A;  1S4Y A;  1CDT A;  2QJ9 C;  1JGK A;  1MR6 A;  3VTS A;  1CB9 A;  2MJ0 A;  1JE9 A;  4KSN A;  3QB4 B;  1XT3 A;  5DO6 A;  2BHI A;  1COD A;  1NTX A;  2J8B A;  4QTI U;  3U73 U;  1KU6 B;  4AEA A;  1NOR A;  1HAJ A;  1LXH A;  1COE A;  3U74 U;  2H62 C;  1CXO A;  4ZQY A;  1CRE A;  4BDT B;  1VB0 A;  1UG4 A;  4RUD A;  2CRS A;  2NBT A;  1RGJ A;  3NDS A;  1PLO A;  1BXP A;  1CVO A;  1NXB A;  4OM4 A;  1M9Z A;  1KBT A;  2BTX A;  1CHV S;  4P7U A;  1TXB A;  2VLW A;  1ERA A;  1KS6 A;  2JVE A;  1BTE A;  1HAA A;  2HLR A;  3KFD I;  2OFS A;  3EBX A;  1B41 B;  3LAQ U;  1TXA A;  2CCX A;  2L5S A;  2HLQ A;  3PLC A;  2PJY C;  1LJZ A;  3EVS C;  2H5F A;  1QKD A;  1IKC A;  2FD6 U;  3FEV A;  1FSC A;  4IYE A;  1MAH F;  1QM7 A;  1CXN A;  2LCR A;  2H64 C;  1QKE A;  2H62 D;  1KBA A;  1TGX A;  1KTZ B;  2MFA A;  1HOY A;  1IDG A;  2QC1 A;  2PJY B;  6EBX A;  1KXI A;  2GOO B;  1RL5 A;  2N99 A;  3HH7 A;  3NH7 A;  1CDQ A;  2JQP A;  2I9B E;  1KL8 A;  1IQ9 A;  1LSI A;  2L03 A;  1JBD A;  1FAS A;  1LX5 B;  2H64 B;  2CTX A;  1FSS B;  1ERG A;  1YWH A;  3ERA A;  2GOO C;  4HQP F;  4OM5 A;  2H8U A;  1KBS A;  1REW C;  4FAO E; 
#chains in the Genus database with same CATH homology
 1ONJ A;  4BIK B;  2LA1 A;  1I02 A;  1FF4 A;  2K3G A;  1ZAD A;  3NEQ A;  1H0J A;  5IMY C;  2MHY A;  1CCQ A;  1W6B A;  1TFS A;  4FAO C;  1CDR A;  2MUO A;  3BT2 U;  1DRS A;  1V6P A;  2UX2 A;  3BT1 U;  5DU1 A;  1NYU A;  1FRA A;  4LFT A;  1KC4 A;  1IK8 A;  1IDH A;  1CTX A;  5EBX A;  5DZ5 A;  2CRT A;  1F94 A;  1CRF A;  2MJY A;  3KFD E;  2ERA A;  1G6M A;  4DO8 A;  2H7Z B;  2H7Z A;  1NEA A;  1KFH A;  1NYS A;  1LXG A;  1F8U B;  1IJC A;  4EY8 B;  1FFJ A;  1IDL A;  1ABT A;  1L4W A;  2ABX A;  2MUP A;  4XJJ A;  2QJA C;  4UY2 C;  1HC9 B;  1IDI A;  1HC9 A;  2QJB C;  2MJ4 A;  2CDX A;  2UWR A;  2X8B B;  5IMT D;  1ES7 B;  1NTN A;  1CDS A;  1S4Y A;  1CDT A;  2QJ9 C;  1JGK A;  1MR6 A;  3VTS A;  1CB9 A;  2MJ0 A;  1JE9 A;  4KSN A;  3QB4 B;  1XT3 A;  5DO6 A;  2BHI A;  1COD A;  1NTX A;  2J8B A;  4QTI U;  3U73 U;  1KU6 B;  4AEA A;  1NOR A;  1HAJ A;  1LXH A;  1COE A;  3U74 U;  2H62 C;  1CXO A;  4ZQY A;  1CRE A;  4BDT B;  1VB0 A;  1UG4 A;  4RUD A;  2CRS A;  2NBT A;  1RGJ A;  3NDS A;  1PLO A;  1BXP A;  1CVO A;  1NXB A;  4OM4 A;  1M9Z A;  1KBT A;  2BTX A;  1CHV S;  4P7U A;  1TXB A;  2VLW A;  1ERA A;  1KS6 A;  2JVE A;  1BTE A;  1HAA A;  2HLR A;  3KFD I;  2OFS A;  3EBX A;  1B41 B;  3LAQ U;  1TXA A;  2CCX A;  2L5S A;  2HLQ A;  3PLC A;  2PJY C;  1LJZ A;  3EVS C;  2H5F A;  1QKD A;  1IKC A;  2FD6 U;  3FEV A;  1FSC A;  4IYE A;  1MAH F;  1QM7 A;  1CXN A;  2LCR A;  2H64 C;  1QKE A;  2H62 D;  1KBA A;  1TGX A;  1KTZ B;  2MFA A;  1HOY A;  1IDG A;  2QC1 A;  2PJY B;  6EBX A;  1KXI A;  2GOO B;  1RL5 A;  2N99 A;  3HH7 A;  3NH7 A;  1CDQ A;  2JQP A;  2I9B E;  1KL8 A;  1IQ9 A;  1LSI A;  2L03 A;  1JBD A;  1FAS A;  1LX5 B;  2H64 B;  2CTX A;  1FSS B;  1ERG A;  1YWH A;  3ERA A;  2GOO C;  4HQP F;  4OM5 A;  2H8U A;  1KBS A;  1REW C;  4FAO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...