3VTSA

Crystal structure of a three finger toxin from snake venom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
LKCHNKLVPFLSKTCPEGKNLCYKMTLMKMPKIPIKRGCTDACPKSSLLVKVVCCNKDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 1
publication title Identification and structural characterization of a new three-finger toxin hemachatoxin from Hemachatus haemachatus venom.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3vtsA00
3VTSA 2UWRA 1CDRA 3BT2U 2CCXA 1H0JA 1XT3A 1FSCA 4EY8B 1IJCA 1KS6A 2CTXA 2GOOC 2K3GA 2MHYA 1CVOA 2MJ4A 3KFDI 3U74U 4HQPF 1HAAA 1IDIA 4DO8A 2LA1A 1I02A 1HOYA 4OM4A 1NYUA 5DO6A 2H62C 2J8BA 1CHVS 2MJYA 5DZ5A 2I9BE 2MUPA 3HH7A 2L03A 1LXGA 2MFAA 1KBTA 2QJBC 4BIKB 1ERGA 1UG4A 1JBDA 3NEQA 2H7ZB 5EBXA 2BTXA 1ABTA 1KXIA 1QKDA 1CDQA 1FSSB 4FAOC 4P7UA 1MR6A 2LCRA 3EVSC 3NH7A 3PLCA 5DU1A 1V6PA 1LSIA 1TXBA 1HAJA 1FFJA 1IKCA 4BDTB 2H8UA 4IYEA 1HC9A 1TFSA 3KFDE 1KC4A 3BT1U 4FAOE 1B41B 2MUOA 1IK8A 5IMTD 4AEAA 1ZADA 2H7ZA 4LFTA 1IDGA 1QKEA 1ERAA 1F8UB 2VLWA 1ONJA 1CDTA 2H62D 2CDXA 1YWHA 1KFHA 2JVEA 1L4WA 2X8BB 3ERAA 3LAQU 2HLQA 2OFSA 1RGJA 2QJ9C 1NYSA 2PJYB 1CRFA 1W6BA 1JE9A 1G6MA 1KL8A 1LX5B 1CTXA 1LJZA 1FF4A 1CXOA 2H5FA 2ERAA 4UY2C 1NXBA 1RL5A 4QTIU 2N99A 2MJ0A 2QJAC 1IDHA 3QB4B 1VB0A 1KTZB 2L5SA 1COEA 2GOOB 2QC1A 1DRSA 1QM7A 1BTEA 1FASA 1PLOA 3U73U 1IQ9A 2NBTA 3NDSA 3FEVA 1CDSA 1TGXA 1NTXA 1MAHF 1IDLA 1ES7B 2H64B 1CCQA 1TXAA 1F94A 1CXNA 1S4YA 1REWC 1CB9A 1KBSA 2H64C 1JGKA 1KBAA 4OM5A 1HC9B 1NEAA 2UX2A 5IMYC 2ABXA 2BHIA 2CRTA 4XJJA 1FRAA 1NORA 2FD6U 2PJYC 1CODA 2JQPA 4RUDA 1NTNA 1KU6B 6EBXA 1BXPA 1M9ZA 1LXHA 4ZQYA 2HLRA 2CRSA 3EBXA 1CREA
chains in the Genus database with same CATH superfamily
3VTSA 2UWRA 1CDRA 3BT2U 2CCXA 1H0JA 1XT3A 1FSCA 4EY8B 1IJCA 1KS6A 2CTXA 2GOOC 2K3GA 2MHYA 1CVOA 2MJ4A 3KFDI 3U74U 4HQPF 1HAAA 1IDIA 4DO8A 2LA1A 1I02A 1HOYA 4OM4A 1NYUA 5DO6A 2H62C 2J8BA 1CHVS 2MJYA 5DZ5A 2I9BE 2MUPA 3HH7A 2L03A 1LXGA 2MFAA 1KBTA 2QJBC 4BIKB 1ERGA 1UG4A 1JBDA 3NEQA 2H7ZB 5EBXA 2BTXA 1ABTA 1KXIA 1QKDA 1CDQA 1FSSB 4FAOC 4P7UA 1MR6A 2LCRA 3EVSC 3NH7A 3PLCA 5DU1A 1V6PA 1LSIA 1TXBA 1HAJA 1FFJA 1IKCA 4BDTB 2H8UA 4IYEA 1HC9A 1TFSA 3KFDE 1KC4A 3BT1U 4FAOE 1B41B 2MUOA 1IK8A 5IMTD 4AEAA 1ZADA 2H7ZA 4LFTA 1IDGA 1QKEA 1ERAA 1F8UB 2VLWA 1ONJA 1CDTA 2H62D 2CDXA 1YWHA 1KFHA 2JVEA 1L4WA 2X8BB 3ERAA 3LAQU 2HLQA 2OFSA 1RGJA 2QJ9C 1NYSA 2PJYB 1CRFA 1W6BA 1JE9A 1G6MA 1KL8A 1LX5B 1CTXA 1LJZA 1FF4A 1CXOA 2H5FA 2ERAA 4UY2C 1NXBA 1RL5A 4QTIU 2N99A 2MJ0A 2QJAC 1IDHA 3QB4B 1VB0A 1KTZB 2L5SA 1COEA 2GOOB 2QC1A 1DRSA 1QM7A 1BTEA 1FASA 1PLOA 3U73U 1IQ9A 2NBTA 3NDSA 3FEVA 1CDSA 1TGXA 1NTXA 1MAHF 1IDLA 1ES7B 2H64B 1CCQA 1TXAA 1F94A 1CXNA 1S4YA 1REWC 1CB9A 1KBSA 2H64C 1JGKA 1KBAA 4KSNA 4OM5A 1HC9B 1NEAA 2UX2A 5IMYC 2ABXA 2BHIA 2CRTA 4XJJA 1FRAA 1NORA 2FD6U 2PJYC 1CODA 2JQPA 4RUDA 1NTNA 1KU6B 6EBXA 1BXPA 1M9ZA 1LXHA 4ZQYA 2HLRA 2CRSA 3EBXA 1CREA
chains in the Genus database with same CATH topology
3VTSA 2UWRA 1CDRA 3BT2U 2CCXA 1H0JA 1XT3A 1FSCA 4EY8B 1IJCA 1KS6A 2CTXA 2GOOC 2K3GA 2MHYA 1CVOA 2MJ4A 3KFDI 3U74U 4HQPF 1HAAA 1IDIA 4DO8A 2LA1A 1I02A 1HOYA 4OM4A 1NYUA 5DO6A 2H62C 2J8BA 1CHVS 2MJYA 5DZ5A 2I9BE 2MUPA 3HH7A 2L03A 1LXGA 2MFAA 1KBTA 2QJBC 4BIKB 1ERGA 1UG4A 1JBDA 3NEQA 2H7ZB 5EBXA 2BTXA 1ABTA 1KXIA 1QKDA 1CDQA 1FSSB 4FAOC 4P7UA 1MR6A 2LCRA 3EVSC 3NH7A 3PLCA 5DU1A 1V6PA 1LSIA 1TXBA 1HAJA 1FFJA 1IKCA 4BDTB 2H8UA 4IYEA 1HC9A 1TFSA 3KFDE 1KC4A 3BT1U 4FAOE 1B41B 2MUOA 1IK8A 5IMTD 4AEAA 1ZADA 2H7ZA 4LFTA 1IDGA 1QKEA 1ERAA 1F8UB 2VLWA 1ONJA 1CDTA 2H62D 2CDXA 1YWHA 1KFHA 2JVEA 1L4WA 2X8BB 3ERAA 3LAQU 2HLQA 2OFSA 1RGJA 2QJ9C 1NYSA 2PJYB 1CRFA 1W6BA 1JE9A 1G6MA 1KL8A 1LX5B 1CTXA 1LJZA 1FF4A 1CXOA 2H5FA 2ERAA 4UY2C 1NXBA 1RL5A 4QTIU 2N99A 2MJ0A 2QJAC 1IDHA 3QB4B 1VB0A 1KTZB 2L5SA 1COEA 2GOOB 2QC1A 1DRSA 1QM7A 1BTEA 1FASA 1PLOA 3U73U 1IQ9A 2NBTA 3NDSA 3FEVA 1CDSA 1TGXA 1NTXA 1MAHF 1IDLA 1ES7B 2H64B 1CCQA 1TXAA 1F94A 1CXNA 1S4YA 1REWC 1CB9A 1KBSA 2H64C 1JGKA 1KBAA 4KSNA 4OM5A 1HC9B 1NEAA 2UX2A 5IMYC 2ABXA 2BHIA 2CRTA 4XJJA 1FRAA 1NORA 2FD6U 2PJYC 1CODA 2JQPA 4RUDA 1NTNA 1KU6B 6EBXA 1BXPA 1M9ZA 1LXHA 4ZQYA 2HLRA 2CRSA 3EBXA 1CREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTS A;  2UWR A;  1CDR A;  3BT2 U;  2CCX A;  1H0J A;  1XT3 A;  1FSC A;  4EY8 B;  1IJC A;  1KS6 A;  2CTX A;  2GOO C;  2K3G A;  2MHY A;  1CVO A;  2MJ4 A;  3KFD I;  3U74 U;  4HQP F;  1HAA A;  1IDI A;  4DO8 A;  2LA1 A;  1I02 A;  1HOY A;  4OM4 A;  1NYU A;  5DO6 A;  2H62 C;  2J8B A;  1CHV S;  2MJY A;  5DZ5 A;  2I9B E;  2MUP A;  3HH7 A;  2L03 A;  1LXG A;  2MFA A;  1KBT A;  2QJB C;  4BIK B;  1ERG A;  1UG4 A;  1JBD A;  3NEQ A;  2H7Z B;  5EBX A;  2BTX A;  1ABT A;  1KXI A;  1QKD A;  1CDQ A;  1FSS B;  4FAO C;  4P7U A;  1MR6 A;  2LCR A;  3EVS C;  3NH7 A;  3PLC A;  5DU1 A;  1V6P A;  1LSI A;  1TXB A;  1HAJ A;  1FFJ A;  1IKC A;  4BDT B;  2H8U A;  4IYE A;  1HC9 A;  1TFS A;  3KFD E;  1KC4 A;  3BT1 U;  4FAO E;  1B41 B;  2MUO A;  1IK8 A;  5IMT D;  4AEA A;  1ZAD A;  2H7Z A;  4LFT A;  1IDG A;  1QKE A;  1ERA A;  1F8U B;  2VLW A;  1ONJ A;  1CDT A;  2H62 D;  2CDX A;  1YWH A;  1KFH A;  2JVE A;  1L4W A;  2X8B B;  3ERA A;  3LAQ U;  2HLQ A;  2OFS A;  1RGJ A;  2QJ9 C;  1NYS A;  2PJY B;  1CRF A;  1W6B A;  1JE9 A;  1G6M A;  1KL8 A;  1LX5 B;  1CTX A;  1LJZ A;  1FF4 A;  1CXO A;  2H5F A;  2ERA A;  4UY2 C;  1NXB A;  1RL5 A;  4QTI U;  2N99 A;  2MJ0 A;  2QJA C;  1IDH A;  3QB4 B;  1VB0 A;  1KTZ B;  2L5S A;  1COE A;  2GOO B;  2QC1 A;  1DRS A;  1QM7 A;  1BTE A;  1FAS A;  1PLO A;  3U73 U;  1IQ9 A;  2NBT A;  3NDS A;  3FEV A;  1CDS A;  1TGX A;  1NTX A;  1MAH F;  1IDL A;  1ES7 B;  2H64 B;  1CCQ A;  1TXA A;  1F94 A;  1CXN A;  1S4Y A;  1REW C;  1CB9 A;  1KBS A;  2H64 C;  1JGK A;  1KBA A;  4OM5 A;  1HC9 B;  1NEA A;  2UX2 A;  5IMY C;  2ABX A;  2BHI A;  2CRT A;  4XJJ A;  1FRA A;  1NOR A;  2FD6 U;  2PJY C;  1COD A;  2JQP A;  4RUD A;  1NTN A;  1KU6 B;  6EBX A;  1BXP A;  1M9Z A;  1LXH A;  4ZQY A;  2HLR A;  2CRS A;  3EBX A;  1CRE A; 
#chains in the Genus database with same CATH topology
 3VTS A;  2UWR A;  1CDR A;  3BT2 U;  2CCX A;  1H0J A;  1XT3 A;  1FSC A;  4EY8 B;  1IJC A;  1KS6 A;  2CTX A;  2GOO C;  2K3G A;  2MHY A;  1CVO A;  2MJ4 A;  3KFD I;  3U74 U;  4HQP F;  1HAA A;  1IDI A;  4DO8 A;  2LA1 A;  1I02 A;  1HOY A;  4OM4 A;  1NYU A;  5DO6 A;  2H62 C;  2J8B A;  1CHV S;  2MJY A;  5DZ5 A;  2I9B E;  2MUP A;  3HH7 A;  2L03 A;  1LXG A;  2MFA A;  1KBT A;  2QJB C;  4BIK B;  1ERG A;  1UG4 A;  1JBD A;  3NEQ A;  2H7Z B;  5EBX A;  2BTX A;  1ABT A;  1KXI A;  1QKD A;  1CDQ A;  1FSS B;  4FAO C;  4P7U A;  1MR6 A;  2LCR A;  3EVS C;  3NH7 A;  3PLC A;  5DU1 A;  1V6P A;  1LSI A;  1TXB A;  1HAJ A;  1FFJ A;  1IKC A;  4BDT B;  2H8U A;  4IYE A;  1HC9 A;  1TFS A;  3KFD E;  1KC4 A;  3BT1 U;  4FAO E;  1B41 B;  2MUO A;  1IK8 A;  5IMT D;  4AEA A;  1ZAD A;  2H7Z A;  4LFT A;  1IDG A;  1QKE A;  1ERA A;  1F8U B;  2VLW A;  1ONJ A;  1CDT A;  2H62 D;  2CDX A;  1YWH A;  1KFH A;  2JVE A;  1L4W A;  2X8B B;  3ERA A;  3LAQ U;  2HLQ A;  2OFS A;  1RGJ A;  2QJ9 C;  1NYS A;  2PJY B;  1CRF A;  1W6B A;  1JE9 A;  1G6M A;  1KL8 A;  1LX5 B;  1CTX A;  1LJZ A;  1FF4 A;  1CXO A;  2H5F A;  2ERA A;  4UY2 C;  1NXB A;  1RL5 A;  4QTI U;  2N99 A;  2MJ0 A;  2QJA C;  1IDH A;  3QB4 B;  1VB0 A;  1KTZ B;  2L5S A;  1COE A;  2GOO B;  2QC1 A;  1DRS A;  1QM7 A;  1BTE A;  1FAS A;  1PLO A;  3U73 U;  1IQ9 A;  2NBT A;  3NDS A;  3FEV A;  1CDS A;  1TGX A;  1NTX A;  1MAH F;  1IDL A;  1ES7 B;  2H64 B;  1CCQ A;  1TXA A;  1F94 A;  1CXN A;  1S4Y A;  1REW C;  1CB9 A;  1KBS A;  2H64 C;  1JGK A;  1KBA A;  4KSN A;  4OM5 A;  1HC9 B;  1NEA A;  2UX2 A;  5IMY C;  2ABX A;  2BHI A;  2CRT A;  4XJJ A;  1FRA A;  1NOR A;  2FD6 U;  2PJY C;  1COD A;  2JQP A;  4RUD A;  1NTN A;  1KU6 B;  6EBX A;  1BXP A;  1M9Z A;  1LXH A;  4ZQY A;  2HLR A;  2CRS A;  3EBX A;  1CRE A; 
#chains in the Genus database with same CATH homology
 3VTS A;  2UWR A;  1CDR A;  3BT2 U;  2CCX A;  1H0J A;  1XT3 A;  1FSC A;  4EY8 B;  1IJC A;  1KS6 A;  2CTX A;  2GOO C;  2K3G A;  2MHY A;  1CVO A;  2MJ4 A;  3KFD I;  3U74 U;  4HQP F;  1HAA A;  1IDI A;  4DO8 A;  2LA1 A;  1I02 A;  1HOY A;  4OM4 A;  1NYU A;  5DO6 A;  2H62 C;  2J8B A;  1CHV S;  2MJY A;  5DZ5 A;  2I9B E;  2MUP A;  3HH7 A;  2L03 A;  1LXG A;  2MFA A;  1KBT A;  2QJB C;  4BIK B;  1ERG A;  1UG4 A;  1JBD A;  3NEQ A;  2H7Z B;  5EBX A;  2BTX A;  1ABT A;  1KXI A;  1QKD A;  1CDQ A;  1FSS B;  4FAO C;  4P7U A;  1MR6 A;  2LCR A;  3EVS C;  3NH7 A;  3PLC A;  5DU1 A;  1V6P A;  1LSI A;  1TXB A;  1HAJ A;  1FFJ A;  1IKC A;  4BDT B;  2H8U A;  4IYE A;  1HC9 A;  1TFS A;  3KFD E;  1KC4 A;  3BT1 U;  4FAO E;  1B41 B;  2MUO A;  1IK8 A;  5IMT D;  4AEA A;  1ZAD A;  2H7Z A;  4LFT A;  1IDG A;  1QKE A;  1ERA A;  1F8U B;  2VLW A;  1ONJ A;  1CDT A;  2H62 D;  2CDX A;  1YWH A;  1KFH A;  2JVE A;  1L4W A;  2X8B B;  3ERA A;  3LAQ U;  2HLQ A;  2OFS A;  1RGJ A;  2QJ9 C;  1NYS A;  2PJY B;  1CRF A;  1W6B A;  1JE9 A;  1G6M A;  1KL8 A;  1LX5 B;  1CTX A;  1LJZ A;  1FF4 A;  1CXO A;  2H5F A;  2ERA A;  4UY2 C;  1NXB A;  1RL5 A;  4QTI U;  2N99 A;  2MJ0 A;  2QJA C;  1IDH A;  3QB4 B;  1VB0 A;  1KTZ B;  2L5S A;  1COE A;  2GOO B;  2QC1 A;  1DRS A;  1QM7 A;  1BTE A;  1FAS A;  1PLO A;  3U73 U;  1IQ9 A;  2NBT A;  3NDS A;  3FEV A;  1CDS A;  1TGX A;  1NTX A;  1MAH F;  1IDL A;  1ES7 B;  2H64 B;  1CCQ A;  1TXA A;  1F94 A;  1CXN A;  1S4Y A;  1REW C;  1CB9 A;  1KBS A;  2H64 C;  1JGK A;  1KBA A;  4KSN A;  4OM5 A;  1HC9 B;  1NEA A;  2UX2 A;  5IMY C;  2ABX A;  2BHI A;  2CRT A;  4XJJ A;  1FRA A;  1NOR A;  2FD6 U;  2PJY C;  1COD A;  2JQP A;  4RUD A;  1NTN A;  1KU6 B;  6EBX A;  1BXP A;  1M9Z A;  1LXH A;  4ZQY A;  2HLR A;  2CRS A;  3EBX A;  1CRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...