3VTSA

Crystal structure of a three finger toxin from snake venom
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
61
structure length
61
Chain Sequence
LKCHNKLVPFLSKTCPEGKNLCYKMTLMKMPKIPIKRGCTDACPKSSLLVKVVCCNKDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cytotoxin 1
publication title Identification and structural characterization of a new three-finger toxin hemachatoxin from Hemachatus haemachatus venom.
pubmed doi rcsb
total genus 9
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3vtsA00
2MJ4A 2QC1A 3LAQU 2X8BB 3NEQA 1CODA 1BXPA 2QJ9C 1FASA 1LJZA 1HC9A 3EBXA 1NXBA 1QM7A 1BTEA 1IQ9A 4LFTA 1ES7B 2LA1A 2N99A 1KBAA 1DRSA 2LCRA 2L5SA 1RGJA 1KBSA 1FRAA 4HQPF 1CDTA 2MUOA 1KS6A 1FSCA 3KFDE 1HC9B 3BT1U 5DU1A 3BT2U 1KFHA 1KTZB 1CCQA 1TXAA 2HLQA 1F8UB 3ERAA 4QTIU 1CDQA 1F94A 1ERAA 2CRSA 4AEAA 1RL5A 2MJ0A 3U74U 4BDTB 1CVOA 1NYUA 2FD6U 1JBDA 2H64C 1FF4A 3PLCA 4P7UA 3EVSC 1LSIA 1JE9A 2BHIA 2ABXA 1MAHF 6EBXA 3QB4B 1NYSA 1CXNA 1CRFA 1ERGA 1KC4A 3NH7A 2L03A 2H64B 4EY8B 2JVEA 1TGXA 4ZQYA 2CRTA 2H62D 1G6MA 2H5FA 1XT3A 2QJAC 5DZ5A 4OM4A 1TFSA 3VTSA 1NTNA 1KXIA 1KBTA 1I02A 1UG4A 1V6PA 1L4WA 1S4YA 2CDXA 1HOYA 1JGKA 1ZADA 2CTXA 2UX2A 1CREA 1CXOA 1M9ZA 1LXGA 1LXHA 1ONJA 1NORA 1TXBA 4RUDA 3HH7A 3FEVA 5DO6A 2H7ZB 1VB0A 1FFJA 1IDLA 1CDSA 2GOOB 2VLWA 1LX5B 1NEAA 2QJBC 4FAOC 1IDHA 1IK8A 2HLRA 1IDGA 2MJYA 1FSSB 1HAJA 2BTXA 1CTXA 2UWRA 4BIKB 2OFSA 1B41B 1CHVS 2GOOC 5IMTD 1NTXA 1COEA 4FAOE 3KFDI 1IKCA 2MHYA 1KL8A 2H7ZA 1QKDA 2H8UA 2PJYC 1HAAA 1CB9A 2ERAA 4UY2C 1KU6B 2K3GA 2JQPA 4XJJA 4OM5A 2MFAA 1MR6A 4DO8A 1REWC 1H0JA 3NDSA 3U73U 1CDRA 2H62C 5IMYC 2I9BE 1ABTA 1PLOA 1QKEA 2PJYB 2CCXA 1IJCA 5EBXA 4IYEA 2J8BA 2NBTA 1IDIA 1W6BA 2MUPA 1YWHA
chains in the Genus database with same CATH superfamily
2MJ4A 2QC1A 3LAQU 2X8BB 3NEQA 1CODA 1BXPA 2QJ9C 1FASA 1LJZA 1HC9A 3EBXA 1NXBA 1QM7A 1BTEA 1IQ9A 4LFTA 1ES7B 2LA1A 2N99A 1KBAA 1DRSA 2LCRA 2L5SA 1RGJA 1KBSA 1FRAA 4HQPF 1CDTA 2MUOA 1KS6A 1FSCA 3KFDE 1HC9B 3BT1U 5DU1A 3BT2U 1KFHA 1KTZB 1CCQA 1TXAA 2HLQA 1F8UB 3ERAA 4QTIU 1CDQA 1F94A 1ERAA 2CRSA 4AEAA 1RL5A 2MJ0A 3U74U 4BDTB 1CVOA 1NYUA 2FD6U 1JBDA 2H64C 1FF4A 3PLCA 4P7UA 3EVSC 1LSIA 1JE9A 2BHIA 2ABXA 1MAHF 6EBXA 3QB4B 1NYSA 1CXNA 1CRFA 1ERGA 1KC4A 3NH7A 2L03A 2H64B 4EY8B 2JVEA 1TGXA 4ZQYA 2CRTA 2H62D 1G6MA 2H5FA 1XT3A 2QJAC 5DZ5A 4OM4A 1TFSA 3VTSA 1NTNA 1KXIA 1KBTA 1I02A 1UG4A 1V6PA 1L4WA 1S4YA 2CDXA 1HOYA 1JGKA 1ZADA 2CTXA 2UX2A 1CREA 1CXOA 1M9ZA 1LXGA 1LXHA 1ONJA 1NORA 1TXBA 4RUDA 3HH7A 3FEVA 5DO6A 2H7ZB 1VB0A 1FFJA 1IDLA 1CDSA 2GOOB 2VLWA 1LX5B 1NEAA 2QJBC 4FAOC 1IDHA 1IK8A 2HLRA 1IDGA 2MJYA 1FSSB 1HAJA 2BTXA 1CTXA 2UWRA 4BIKB 2OFSA 1B41B 1CHVS 4KSNA 2GOOC 5IMTD 1NTXA 1COEA 4FAOE 3KFDI 1IKCA 2MHYA 1KL8A 2H7ZA 1QKDA 2H8UA 2PJYC 1HAAA 1CB9A 2ERAA 4UY2C 1KU6B 2K3GA 2JQPA 4XJJA 4OM5A 2MFAA 1MR6A 4DO8A 1REWC 1H0JA 3NDSA 3U73U 1CDRA 2H62C 5IMYC 2I9BE 1ABTA 1PLOA 1QKEA 2PJYB 2CCXA 1IJCA 5EBXA 4IYEA 2J8BA 2NBTA 1IDIA 1W6BA 2MUPA 1YWHA
chains in the Genus database with same CATH topology
2MJ4A 2QC1A 3LAQU 2X8BB 3NEQA 1CODA 1BXPA 2QJ9C 1FASA 1LJZA 1HC9A 3EBXA 1NXBA 1QM7A 1BTEA 1IQ9A 4LFTA 1ES7B 2LA1A 2N99A 1KBAA 1DRSA 2LCRA 2L5SA 1RGJA 1KBSA 1FRAA 4HQPF 1CDTA 2MUOA 1KS6A 1FSCA 3KFDE 1HC9B 3BT1U 5DU1A 3BT2U 1KFHA 1KTZB 1CCQA 1TXAA 2HLQA 1F8UB 3ERAA 4QTIU 1CDQA 1F94A 1ERAA 2CRSA 4AEAA 1RL5A 2MJ0A 3U74U 4BDTB 1CVOA 1NYUA 2FD6U 1JBDA 2H64C 1FF4A 3PLCA 4P7UA 3EVSC 1LSIA 1JE9A 2BHIA 2ABXA 1MAHF 6EBXA 3QB4B 1NYSA 1CXNA 1CRFA 1ERGA 1KC4A 3NH7A 2L03A 2H64B 4EY8B 2JVEA 1TGXA 4ZQYA 2CRTA 2H62D 1G6MA 2H5FA 1XT3A 2QJAC 5DZ5A 4OM4A 1TFSA 3VTSA 1NTNA 1KXIA 1KBTA 1I02A 1UG4A 1V6PA 1L4WA 1S4YA 2CDXA 1HOYA 1JGKA 1ZADA 2CTXA 2UX2A 1CREA 1CXOA 1M9ZA 1LXGA 1LXHA 1ONJA 1NORA 1TXBA 4RUDA 3HH7A 3FEVA 5DO6A 2H7ZB 1VB0A 1FFJA 1IDLA 1CDSA 2GOOB 2VLWA 1LX5B 1NEAA 2QJBC 4FAOC 1IDHA 1IK8A 2HLRA 1IDGA 2MJYA 1FSSB 1HAJA 2BTXA 1CTXA 2UWRA 4BIKB 2OFSA 1B41B 1CHVS 4KSNA 2GOOC 5IMTD 1NTXA 1COEA 4FAOE 3KFDI 1IKCA 2MHYA 1KL8A 2H7ZA 1QKDA 2H8UA 2PJYC 1HAAA 1CB9A 2ERAA 4UY2C 1KU6B 2K3GA 2JQPA 4XJJA 4OM5A 2MFAA 1MR6A 4DO8A 1REWC 1H0JA 3NDSA 3U73U 1CDRA 2H62C 5IMYC 2I9BE 1ABTA 1PLOA 1QKEA 2PJYB 2CCXA 1IJCA 5EBXA 4IYEA 2J8BA 2NBTA 1IDIA 1W6BA 2MUPA 1YWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ4 A;  2QC1 A;  3LAQ U;  2X8B B;  3NEQ A;  1COD A;  1BXP A;  2QJ9 C;  1FAS A;  1LJZ A;  1HC9 A;  3EBX A;  1NXB A;  1QM7 A;  1BTE A;  1IQ9 A;  4LFT A;  1ES7 B;  2LA1 A;  2N99 A;  1KBA A;  1DRS A;  2LCR A;  2L5S A;  1RGJ A;  1KBS A;  1FRA A;  4HQP F;  1CDT A;  2MUO A;  1KS6 A;  1FSC A;  3KFD E;  1HC9 B;  3BT1 U;  5DU1 A;  3BT2 U;  1KFH A;  1KTZ B;  1CCQ A;  1TXA A;  2HLQ A;  1F8U B;  3ERA A;  4QTI U;  1CDQ A;  1F94 A;  1ERA A;  2CRS A;  4AEA A;  1RL5 A;  2MJ0 A;  3U74 U;  4BDT B;  1CVO A;  1NYU A;  2FD6 U;  1JBD A;  2H64 C;  1FF4 A;  3PLC A;  4P7U A;  3EVS C;  1LSI A;  1JE9 A;  2BHI A;  2ABX A;  1MAH F;  6EBX A;  3QB4 B;  1NYS A;  1CXN A;  1CRF A;  1ERG A;  1KC4 A;  3NH7 A;  2L03 A;  2H64 B;  4EY8 B;  2JVE A;  1TGX A;  4ZQY A;  2CRT A;  2H62 D;  1G6M A;  2H5F A;  1XT3 A;  2QJA C;  5DZ5 A;  4OM4 A;  1TFS A;  3VTS A;  1NTN A;  1KXI A;  1KBT A;  1I02 A;  1UG4 A;  1V6P A;  1L4W A;  1S4Y A;  2CDX A;  1HOY A;  1JGK A;  1ZAD A;  2CTX A;  2UX2 A;  1CRE A;  1CXO A;  1M9Z A;  1LXG A;  1LXH A;  1ONJ A;  1NOR A;  1TXB A;  4RUD A;  3HH7 A;  3FEV A;  5DO6 A;  2H7Z B;  1VB0 A;  1FFJ A;  1IDL A;  1CDS A;  2GOO B;  2VLW A;  1LX5 B;  1NEA A;  2QJB C;  4FAO C;  1IDH A;  1IK8 A;  2HLR A;  1IDG A;  2MJY A;  1FSS B;  1HAJ A;  2BTX A;  1CTX A;  2UWR A;  4BIK B;  2OFS A;  1B41 B;  1CHV S;  2GOO C;  5IMT D;  1NTX A;  1COE A;  4FAO E;  3KFD I;  1IKC A;  2MHY A;  1KL8 A;  2H7Z A;  1QKD A;  2H8U A;  2PJY C;  1HAA A;  1CB9 A;  2ERA A;  4UY2 C;  1KU6 B;  2K3G A;  2JQP A;  4XJJ A;  4OM5 A;  2MFA A;  1MR6 A;  4DO8 A;  1REW C;  1H0J A;  3NDS A;  3U73 U;  1CDR A;  2H62 C;  5IMY C;  2I9B E;  1ABT A;  1PLO A;  1QKE A;  2PJY B;  2CCX A;  1IJC A;  5EBX A;  4IYE A;  2J8B A;  2NBT A;  1IDI A;  1W6B A;  2MUP A;  1YWH A; 
#chains in the Genus database with same CATH topology
 2MJ4 A;  2QC1 A;  3LAQ U;  2X8B B;  3NEQ A;  1COD A;  1BXP A;  2QJ9 C;  1FAS A;  1LJZ A;  1HC9 A;  3EBX A;  1NXB A;  1QM7 A;  1BTE A;  1IQ9 A;  4LFT A;  1ES7 B;  2LA1 A;  2N99 A;  1KBA A;  1DRS A;  2LCR A;  2L5S A;  1RGJ A;  1KBS A;  1FRA A;  4HQP F;  1CDT A;  2MUO A;  1KS6 A;  1FSC A;  3KFD E;  1HC9 B;  3BT1 U;  5DU1 A;  3BT2 U;  1KFH A;  1KTZ B;  1CCQ A;  1TXA A;  2HLQ A;  1F8U B;  3ERA A;  4QTI U;  1CDQ A;  1F94 A;  1ERA A;  2CRS A;  4AEA A;  1RL5 A;  2MJ0 A;  3U74 U;  4BDT B;  1CVO A;  1NYU A;  2FD6 U;  1JBD A;  2H64 C;  1FF4 A;  3PLC A;  4P7U A;  3EVS C;  1LSI A;  1JE9 A;  2BHI A;  2ABX A;  1MAH F;  6EBX A;  3QB4 B;  1NYS A;  1CXN A;  1CRF A;  1ERG A;  1KC4 A;  3NH7 A;  2L03 A;  2H64 B;  4EY8 B;  2JVE A;  1TGX A;  4ZQY A;  2CRT A;  2H62 D;  1G6M A;  2H5F A;  1XT3 A;  2QJA C;  5DZ5 A;  4OM4 A;  1TFS A;  3VTS A;  1NTN A;  1KXI A;  1KBT A;  1I02 A;  1UG4 A;  1V6P A;  1L4W A;  1S4Y A;  2CDX A;  1HOY A;  1JGK A;  1ZAD A;  2CTX A;  2UX2 A;  1CRE A;  1CXO A;  1M9Z A;  1LXG A;  1LXH A;  1ONJ A;  1NOR A;  1TXB A;  4RUD A;  3HH7 A;  3FEV A;  5DO6 A;  2H7Z B;  1VB0 A;  1FFJ A;  1IDL A;  1CDS A;  2GOO B;  2VLW A;  1LX5 B;  1NEA A;  2QJB C;  4FAO C;  1IDH A;  1IK8 A;  2HLR A;  1IDG A;  2MJY A;  1FSS B;  1HAJ A;  2BTX A;  1CTX A;  2UWR A;  4BIK B;  2OFS A;  1B41 B;  1CHV S;  4KSN A;  2GOO C;  5IMT D;  1NTX A;  1COE A;  4FAO E;  3KFD I;  1IKC A;  2MHY A;  1KL8 A;  2H7Z A;  1QKD A;  2H8U A;  2PJY C;  1HAA A;  1CB9 A;  2ERA A;  4UY2 C;  1KU6 B;  2K3G A;  2JQP A;  4XJJ A;  4OM5 A;  2MFA A;  1MR6 A;  4DO8 A;  1REW C;  1H0J A;  3NDS A;  3U73 U;  1CDR A;  2H62 C;  5IMY C;  2I9B E;  1ABT A;  1PLO A;  1QKE A;  2PJY B;  2CCX A;  1IJC A;  5EBX A;  4IYE A;  2J8B A;  2NBT A;  1IDI A;  1W6B A;  2MUP A;  1YWH A; 
#chains in the Genus database with same CATH homology
 2MJ4 A;  2QC1 A;  3LAQ U;  2X8B B;  3NEQ A;  1COD A;  1BXP A;  2QJ9 C;  1FAS A;  1LJZ A;  1HC9 A;  3EBX A;  1NXB A;  1QM7 A;  1BTE A;  1IQ9 A;  4LFT A;  1ES7 B;  2LA1 A;  2N99 A;  1KBA A;  1DRS A;  2LCR A;  2L5S A;  1RGJ A;  1KBS A;  1FRA A;  4HQP F;  1CDT A;  2MUO A;  1KS6 A;  1FSC A;  3KFD E;  1HC9 B;  3BT1 U;  5DU1 A;  3BT2 U;  1KFH A;  1KTZ B;  1CCQ A;  1TXA A;  2HLQ A;  1F8U B;  3ERA A;  4QTI U;  1CDQ A;  1F94 A;  1ERA A;  2CRS A;  4AEA A;  1RL5 A;  2MJ0 A;  3U74 U;  4BDT B;  1CVO A;  1NYU A;  2FD6 U;  1JBD A;  2H64 C;  1FF4 A;  3PLC A;  4P7U A;  3EVS C;  1LSI A;  1JE9 A;  2BHI A;  2ABX A;  1MAH F;  6EBX A;  3QB4 B;  1NYS A;  1CXN A;  1CRF A;  1ERG A;  1KC4 A;  3NH7 A;  2L03 A;  2H64 B;  4EY8 B;  2JVE A;  1TGX A;  4ZQY A;  2CRT A;  2H62 D;  1G6M A;  2H5F A;  1XT3 A;  2QJA C;  5DZ5 A;  4OM4 A;  1TFS A;  3VTS A;  1NTN A;  1KXI A;  1KBT A;  1I02 A;  1UG4 A;  1V6P A;  1L4W A;  1S4Y A;  2CDX A;  1HOY A;  1JGK A;  1ZAD A;  2CTX A;  2UX2 A;  1CRE A;  1CXO A;  1M9Z A;  1LXG A;  1LXH A;  1ONJ A;  1NOR A;  1TXB A;  4RUD A;  3HH7 A;  3FEV A;  5DO6 A;  2H7Z B;  1VB0 A;  1FFJ A;  1IDL A;  1CDS A;  2GOO B;  2VLW A;  1LX5 B;  1NEA A;  2QJB C;  4FAO C;  1IDH A;  1IK8 A;  2HLR A;  1IDG A;  2MJY A;  1FSS B;  1HAJ A;  2BTX A;  1CTX A;  2UWR A;  4BIK B;  2OFS A;  1B41 B;  1CHV S;  4KSN A;  2GOO C;  5IMT D;  1NTX A;  1COE A;  4FAO E;  3KFD I;  1IKC A;  2MHY A;  1KL8 A;  2H7Z A;  1QKD A;  2H8U A;  2PJY C;  1HAA A;  1CB9 A;  2ERA A;  4UY2 C;  1KU6 B;  2K3G A;  2JQP A;  4XJJ A;  4OM5 A;  2MFA A;  1MR6 A;  4DO8 A;  1REW C;  1H0J A;  3NDS A;  3U73 U;  1CDR A;  2H62 C;  5IMY C;  2I9B E;  1ABT A;  1PLO A;  1QKE A;  2PJY B;  2CCX A;  1IJC A;  5EBX A;  4IYE A;  2J8B A;  2NBT A;  1IDI A;  1W6B A;  2MUP A;  1YWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...