2FD6U

Structure of human urokinase plasminogen activator in complex with urokinase receptor and an anti-upar antibody at 1.9 a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
276
structure length
249
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQLGDAFSMNHIDVSCCTKSGCNHPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of human urokinase plasminogen activator in complex with its receptor
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system, hydrolase
molecule keywords Urokinase-type plasminogen activator
total genus 57
structure length 249
sequence length 276
ec nomenclature
pdb deposition date 2005-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2fd6U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2fd6U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2fd6U02
2MJ0A 4OM5A 4P7UA 4IYEA 1KU6B 2H5FA 1QKEA 2FD6U 2X8BB 1YWHA 2I9BE 1KL8A 1HC9B 2CRSA 1CREA 1S4YA 1JGKA 1KBTA 2HLRA 3QB4B 1IKCA 6EBXA 4ZQYA 3U74U 1IDGA 5EBXA 1G6MA 1MAHF 1F94A 1LSIA 1CDSA 1HC9A 2J8BA 1CODA 4HQPF 4XJJA 2CRTA 2H62D 1NYSA 2PJYB 1L4WA 1FASA 2JVEA 4QTIU 4EY8B 3BT2U 1RL5A 3NDSA 1LXGA 1I02A 5DU1A 2LCRA 1HOYA 2PJYC 1HAJA 4FAOE 1PLOA 1CVOA 1ES7B 2H62C 1TXBA 1QKDA 2H64B 3BT1U 3VTSA 2CCXA 1QM7A 1F8UB 2MFAA 1KC4A 2H8UA 4FAOC 2QC1A 1CHVS 2JQPA 1IDLA 1H0JA 2GOOC 1UG4A 2VLWA 1KFHA 2L5SA 2N99A 1NEAA 3NEQA 1FF4A 1TGXA 2L03A 1KXIA 2UX2A 4LFTA 1LXHA 2K3GA 1CTXA 1JBDA 2UWRA 1COEA 1CCQA 1IJCA 4UY2C 1IDHA 1KBSA 1ABTA 1NYUA 1ZADA 2HLQA 1CXNA 1LJZA 3EVSC 1IQ9A 1KTZB 1VB0A 1B41B 1FSSB 1FSCA 2OFSA 1CB9A 1NTNA 2MJ4A 1CDRA 2H7ZB 1KS6A 1FFJA 1MR6A 1NXBA 1IDIA 4OM4A 2ABXA 1ONJA 3PLCA 3U73U 2QJBC 1XT3A 3KFDI 1CRFA 1JE9A 1FRAA 2H7ZA 1KBAA 5DO6A 1M9ZA 4BDTB 2QJAC 3EBXA 2GOOB 1W6BA 1CXOA 2BTXA 2NBTA 1CDQA 5IMYC 2LA1A 1BXPA 2QJ9C 2CDXA 5DZ5A 2MHYA 4DO8A 1NTXA 3KFDE 5IMTD 4AEAA 4RUDA 2MUOA 2BHIA 1BTEA 1IK8A 1V6PA 2MJYA 3ERAA 1DRSA 2ERAA 3HH7A 3NH7A 1NORA 1TXAA 4BIKB 1REWC 2H64C 3FEVA 1RGJA 3LAQU 2MUPA 1CDTA 1ERAA 1ERGA 1TFSA 2CTXA 1HAAA 1LX5B
chains in the Genus database with same CATH superfamily
2MJ0A 4OM5A 4P7UA 4IYEA 1KU6B 2H5FA 1QKEA 2FD6U 2X8BB 1YWHA 2I9BE 1KL8A 1HC9B 2CRSA 1CREA 1S4YA 1JGKA 1KBTA 2HLRA 3QB4B 1IKCA 6EBXA 4ZQYA 3U74U 1IDGA 5EBXA 1G6MA 1MAHF 1F94A 1LSIA 1CDSA 1HC9A 2J8BA 1CODA 4HQPF 4XJJA 2CRTA 2H62D 1NYSA 2PJYB 1L4WA 1FASA 2JVEA 4QTIU 4EY8B 3BT2U 1RL5A 3NDSA 1LXGA 1I02A 5DU1A 2LCRA 1HOYA 2PJYC 1HAJA 4FAOE 1PLOA 1CVOA 1ES7B 2H62C 1TXBA 1QKDA 4KSNA 2H64B 3BT1U 3VTSA 2CCXA 1QM7A 1F8UB 2MFAA 1KC4A 2H8UA 4FAOC 2QC1A 1CHVS 2JQPA 1IDLA 1H0JA 2GOOC 1UG4A 2VLWA 1KFHA 2L5SA 2N99A 1NEAA 3NEQA 1FF4A 1TGXA 2L03A 1KXIA 2UX2A 4LFTA 1LXHA 2K3GA 1CTXA 1JBDA 2UWRA 1COEA 1CCQA 1IJCA 4UY2C 1IDHA 1KBSA 1ABTA 1NYUA 1ZADA 2HLQA 1CXNA 1LJZA 3EVSC 1IQ9A 1KTZB 1VB0A 1B41B 1FSSB 1FSCA 2OFSA 1CB9A 1NTNA 2MJ4A 1CDRA 2H7ZB 1KS6A 1FFJA 1MR6A 1NXBA 1IDIA 4OM4A 2ABXA 1ONJA 3PLCA 3U73U 2QJBC 1XT3A 3KFDI 1CRFA 1JE9A 1FRAA 2H7ZA 1KBAA 5DO6A 1M9ZA 4BDTB 2QJAC 3EBXA 2GOOB 1W6BA 1CXOA 2BTXA 2NBTA 1CDQA 5IMYC 2LA1A 1BXPA 2QJ9C 2CDXA 5DZ5A 2MHYA 4DO8A 1NTXA 3KFDE 5IMTD 4AEAA 4RUDA 2MUOA 2BHIA 1BTEA 1IK8A 1V6PA 2MJYA 3ERAA 1DRSA 2ERAA 3HH7A 3NH7A 1NORA 1TXAA 4BIKB 1REWC 2H64C 3FEVA 1RGJA 3LAQU 2MUPA 1CDTA 1ERAA 1ERGA 1TFSA 2CTXA 1HAAA 1LX5B
chains in the Genus database with same CATH topology
2MJ0A 4OM5A 4P7UA 4IYEA 1KU6B 2H5FA 1QKEA 2FD6U 2X8BB 1YWHA 2I9BE 1KL8A 1HC9B 2CRSA 1CREA 1S4YA 1JGKA 1KBTA 2HLRA 3QB4B 1IKCA 6EBXA 4ZQYA 3U74U 1IDGA 5EBXA 1G6MA 1MAHF 1F94A 1LSIA 1CDSA 1HC9A 2J8BA 1CODA 4HQPF 4XJJA 2CRTA 2H62D 1NYSA 2PJYB 1L4WA 1FASA 2JVEA 4QTIU 4EY8B 3BT2U 1RL5A 3NDSA 1LXGA 1I02A 5DU1A 2LCRA 1HOYA 2PJYC 1HAJA 4FAOE 1PLOA 1CVOA 1ES7B 2H62C 1TXBA 1QKDA 4KSNA 2H64B 3BT1U 3VTSA 2CCXA 1QM7A 1F8UB 2MFAA 1KC4A 2H8UA 4FAOC 2QC1A 1CHVS 2JQPA 1IDLA 1H0JA 2GOOC 1UG4A 2VLWA 1KFHA 2L5SA 2N99A 1NEAA 3NEQA 1FF4A 1TGXA 2L03A 1KXIA 2UX2A 4LFTA 1LXHA 2K3GA 1CTXA 1JBDA 2UWRA 1COEA 1CCQA 1IJCA 4UY2C 1IDHA 1KBSA 1ABTA 1NYUA 1ZADA 2HLQA 1CXNA 1LJZA 3EVSC 1IQ9A 1KTZB 1VB0A 1B41B 1FSSB 1FSCA 2OFSA 1CB9A 1NTNA 2MJ4A 1CDRA 2H7ZB 1KS6A 1FFJA 1MR6A 1NXBA 1IDIA 4OM4A 2ABXA 1ONJA 3PLCA 3U73U 2QJBC 1XT3A 3KFDI 1CRFA 1JE9A 1FRAA 2H7ZA 1KBAA 5DO6A 1M9ZA 4BDTB 2QJAC 3EBXA 2GOOB 1W6BA 1CXOA 2BTXA 2NBTA 1CDQA 5IMYC 2LA1A 1BXPA 2QJ9C 2CDXA 5DZ5A 2MHYA 4DO8A 1NTXA 3KFDE 5IMTD 4AEAA 4RUDA 2MUOA 2BHIA 1BTEA 1IK8A 1V6PA 2MJYA 3ERAA 1DRSA 2ERAA 3HH7A 3NH7A 1NORA 1TXAA 4BIKB 1REWC 2H64C 3FEVA 1RGJA 3LAQU 2MUPA 1CDTA 1ERAA 1ERGA 1TFSA 2CTXA 1HAAA 1LX5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ0 A;  4OM5 A;  4P7U A;  4IYE A;  1KU6 B;  2H5F A;  1QKE A;  2FD6 U;  2X8B B;  1YWH A;  2I9B E;  1KL8 A;  1HC9 B;  2CRS A;  1CRE A;  1S4Y A;  1JGK A;  1KBT A;  2HLR A;  3QB4 B;  1IKC A;  6EBX A;  4ZQY A;  3U74 U;  1IDG A;  5EBX A;  1G6M A;  1MAH F;  1F94 A;  1LSI A;  1CDS A;  1HC9 A;  2J8B A;  1COD A;  4HQP F;  4XJJ A;  2CRT A;  2H62 D;  1NYS A;  2PJY B;  1L4W A;  1FAS A;  2JVE A;  4QTI U;  4EY8 B;  3BT2 U;  1RL5 A;  3NDS A;  1LXG A;  1I02 A;  5DU1 A;  2LCR A;  1HOY A;  2PJY C;  1HAJ A;  4FAO E;  1PLO A;  1CVO A;  1ES7 B;  2H62 C;  1TXB A;  1QKD A;  2H64 B;  3BT1 U;  3VTS A;  2CCX A;  1QM7 A;  1F8U B;  2MFA A;  1KC4 A;  2H8U A;  4FAO C;  2QC1 A;  1CHV S;  2JQP A;  1IDL A;  1H0J A;  2GOO C;  1UG4 A;  2VLW A;  1KFH A;  2L5S A;  2N99 A;  1NEA A;  3NEQ A;  1FF4 A;  1TGX A;  2L03 A;  1KXI A;  2UX2 A;  4LFT A;  1LXH A;  2K3G A;  1CTX A;  1JBD A;  2UWR A;  1COE A;  1CCQ A;  1IJC A;  4UY2 C;  1IDH A;  1KBS A;  1ABT A;  1NYU A;  1ZAD A;  2HLQ A;  1CXN A;  1LJZ A;  3EVS C;  1IQ9 A;  1KTZ B;  1VB0 A;  1B41 B;  1FSS B;  1FSC A;  2OFS A;  1CB9 A;  1NTN A;  2MJ4 A;  1CDR A;  2H7Z B;  1KS6 A;  1FFJ A;  1MR6 A;  1NXB A;  1IDI A;  4OM4 A;  2ABX A;  1ONJ A;  3PLC A;  3U73 U;  2QJB C;  1XT3 A;  3KFD I;  1CRF A;  1JE9 A;  1FRA A;  2H7Z A;  1KBA A;  5DO6 A;  1M9Z A;  4BDT B;  2QJA C;  3EBX A;  2GOO B;  1W6B A;  1CXO A;  2BTX A;  2NBT A;  1CDQ A;  5IMY C;  2LA1 A;  1BXP A;  2QJ9 C;  2CDX A;  5DZ5 A;  2MHY A;  4DO8 A;  1NTX A;  3KFD E;  5IMT D;  4AEA A;  4RUD A;  2MUO A;  2BHI A;  1BTE A;  1IK8 A;  1V6P A;  2MJY A;  3ERA A;  1DRS A;  2ERA A;  3HH7 A;  3NH7 A;  1NOR A;  1TXA A;  4BIK B;  1REW C;  2H64 C;  3FEV A;  1RGJ A;  3LAQ U;  2MUP A;  1CDT A;  1ERA A;  1ERG A;  1TFS A;  2CTX A;  1HAA A;  1LX5 B; 
#chains in the Genus database with same CATH topology
 2MJ0 A;  4OM5 A;  4P7U A;  4IYE A;  1KU6 B;  2H5F A;  1QKE A;  2FD6 U;  2X8B B;  1YWH A;  2I9B E;  1KL8 A;  1HC9 B;  2CRS A;  1CRE A;  1S4Y A;  1JGK A;  1KBT A;  2HLR A;  3QB4 B;  1IKC A;  6EBX A;  4ZQY A;  3U74 U;  1IDG A;  5EBX A;  1G6M A;  1MAH F;  1F94 A;  1LSI A;  1CDS A;  1HC9 A;  2J8B A;  1COD A;  4HQP F;  4XJJ A;  2CRT A;  2H62 D;  1NYS A;  2PJY B;  1L4W A;  1FAS A;  2JVE A;  4QTI U;  4EY8 B;  3BT2 U;  1RL5 A;  3NDS A;  1LXG A;  1I02 A;  5DU1 A;  2LCR A;  1HOY A;  2PJY C;  1HAJ A;  4FAO E;  1PLO A;  1CVO A;  1ES7 B;  2H62 C;  1TXB A;  1QKD A;  4KSN A;  2H64 B;  3BT1 U;  3VTS A;  2CCX A;  1QM7 A;  1F8U B;  2MFA A;  1KC4 A;  2H8U A;  4FAO C;  2QC1 A;  1CHV S;  2JQP A;  1IDL A;  1H0J A;  2GOO C;  1UG4 A;  2VLW A;  1KFH A;  2L5S A;  2N99 A;  1NEA A;  3NEQ A;  1FF4 A;  1TGX A;  2L03 A;  1KXI A;  2UX2 A;  4LFT A;  1LXH A;  2K3G A;  1CTX A;  1JBD A;  2UWR A;  1COE A;  1CCQ A;  1IJC A;  4UY2 C;  1IDH A;  1KBS A;  1ABT A;  1NYU A;  1ZAD A;  2HLQ A;  1CXN A;  1LJZ A;  3EVS C;  1IQ9 A;  1KTZ B;  1VB0 A;  1B41 B;  1FSS B;  1FSC A;  2OFS A;  1CB9 A;  1NTN A;  2MJ4 A;  1CDR A;  2H7Z B;  1KS6 A;  1FFJ A;  1MR6 A;  1NXB A;  1IDI A;  4OM4 A;  2ABX A;  1ONJ A;  3PLC A;  3U73 U;  2QJB C;  1XT3 A;  3KFD I;  1CRF A;  1JE9 A;  1FRA A;  2H7Z A;  1KBA A;  5DO6 A;  1M9Z A;  4BDT B;  2QJA C;  3EBX A;  2GOO B;  1W6B A;  1CXO A;  2BTX A;  2NBT A;  1CDQ A;  5IMY C;  2LA1 A;  1BXP A;  2QJ9 C;  2CDX A;  5DZ5 A;  2MHY A;  4DO8 A;  1NTX A;  3KFD E;  5IMT D;  4AEA A;  4RUD A;  2MUO A;  2BHI A;  1BTE A;  1IK8 A;  1V6P A;  2MJY A;  3ERA A;  1DRS A;  2ERA A;  3HH7 A;  3NH7 A;  1NOR A;  1TXA A;  4BIK B;  1REW C;  2H64 C;  3FEV A;  1RGJ A;  3LAQ U;  2MUP A;  1CDT A;  1ERA A;  1ERG A;  1TFS A;  2CTX A;  1HAA A;  1LX5 B; 
#chains in the Genus database with same CATH homology
 2MJ0 A;  4OM5 A;  4P7U A;  4IYE A;  1KU6 B;  2H5F A;  1QKE A;  2FD6 U;  2X8B B;  1YWH A;  2I9B E;  1KL8 A;  1HC9 B;  2CRS A;  1CRE A;  1S4Y A;  1JGK A;  1KBT A;  2HLR A;  3QB4 B;  1IKC A;  6EBX A;  4ZQY A;  3U74 U;  1IDG A;  5EBX A;  1G6M A;  1MAH F;  1F94 A;  1LSI A;  1CDS A;  1HC9 A;  2J8B A;  1COD A;  4HQP F;  4XJJ A;  2CRT A;  2H62 D;  1NYS A;  2PJY B;  1L4W A;  1FAS A;  2JVE A;  4QTI U;  4EY8 B;  3BT2 U;  1RL5 A;  3NDS A;  1LXG A;  1I02 A;  5DU1 A;  2LCR A;  1HOY A;  2PJY C;  1HAJ A;  4FAO E;  1PLO A;  1CVO A;  1ES7 B;  2H62 C;  1TXB A;  1QKD A;  4KSN A;  2H64 B;  3BT1 U;  3VTS A;  2CCX A;  1QM7 A;  1F8U B;  2MFA A;  1KC4 A;  2H8U A;  4FAO C;  2QC1 A;  1CHV S;  2JQP A;  1IDL A;  1H0J A;  2GOO C;  1UG4 A;  2VLW A;  1KFH A;  2L5S A;  2N99 A;  1NEA A;  3NEQ A;  1FF4 A;  1TGX A;  2L03 A;  1KXI A;  2UX2 A;  4LFT A;  1LXH A;  2K3G A;  1CTX A;  1JBD A;  2UWR A;  1COE A;  1CCQ A;  1IJC A;  4UY2 C;  1IDH A;  1KBS A;  1ABT A;  1NYU A;  1ZAD A;  2HLQ A;  1CXN A;  1LJZ A;  3EVS C;  1IQ9 A;  1KTZ B;  1VB0 A;  1B41 B;  1FSS B;  1FSC A;  2OFS A;  1CB9 A;  1NTN A;  2MJ4 A;  1CDR A;  2H7Z B;  1KS6 A;  1FFJ A;  1MR6 A;  1NXB A;  1IDI A;  4OM4 A;  2ABX A;  1ONJ A;  3PLC A;  3U73 U;  2QJB C;  1XT3 A;  3KFD I;  1CRF A;  1JE9 A;  1FRA A;  2H7Z A;  1KBA A;  5DO6 A;  1M9Z A;  4BDT B;  2QJA C;  3EBX A;  2GOO B;  1W6B A;  1CXO A;  2BTX A;  2NBT A;  1CDQ A;  5IMY C;  2LA1 A;  1BXP A;  2QJ9 C;  2CDX A;  5DZ5 A;  2MHY A;  4DO8 A;  1NTX A;  3KFD E;  5IMT D;  4AEA A;  4RUD A;  2MUO A;  2BHI A;  1BTE A;  1IK8 A;  1V6P A;  2MJY A;  3ERA A;  1DRS A;  2ERA A;  3HH7 A;  3NH7 A;  1NOR A;  1TXA A;  4BIK B;  1REW C;  2H64 C;  3FEV A;  1RGJ A;  3LAQ U;  2MUP A;  1CDT A;  1ERA A;  1ERG A;  1TFS A;  2CTX A;  1HAA A;  1LX5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...