5EBXA

The crystal structure of erabutoxin a at 2.0 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of erabutoxin a at 2.0-A resolution.
pubmed rcsb
source organism Laticauda semifasciata
molecule tags Toxin
molecule keywords ERABUTOXIN A
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1989-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5ebxA00
1IDGA 1XT3A 1IJCA 1CREA 1FASA 1KL8A 1TXAA 2CCXA 2ERAA 1LXGA 1ERAA 1HAAA 1CB9A 1NTNA 2I9BE 4OM4A 1KS6A 1ERGA 2QJAC 1QKEA 1I02A 2FD6U 2H7ZA 2GOOC 1YWHA 4LFTA 1KXIA 5DZ5A 2L5SA 1HC9A 2HLQA 2MFAA 1V6PA 4P7UA 1REWC 1FSSB 4XJJA 1CRFA 1JE9A 1JGKA 3NDSA 1NORA 2K3GA 1F94A 1BXPA 1UG4A 1CDTA 4ZQYA 2LA1A 4FAOE 1CHVS 1QKDA 4DO8A 2MJYA 1MAHF 3EVSC 4EY8B 1IDIA 2OFSA 1F8UB 1CXNA 2PJYC 2GOOB 1RGJA 1NEAA 1S4YA 1KBAA 3LAQU 2PJYB 4FAOC 1ES7B 1FSCA 1CVOA 2MJ4A 1M9ZA 1IK8A 2H64C 2NBTA 2MUPA 4BIKB 2LCRA 1TFSA 1CODA 5IMTD 2UWRA 2MUOA 4HQPF 1KBSA 1FRAA 2CRTA 6EBXA 2H5FA 2N99A 3QB4B 3U74U 3HH7A 1IQ9A 1IDHA 1KFHA 1LXHA 1ZADA 3VTSA 1VB0A 1BTEA 3NH7A 1G6MA 4RUDA 1LJZA 2BTXA 2H64B 1CDQA 4QTIU 2H62D 1NTXA 1LX5B 1PLOA 1RL5A 2VLWA 1NYSA 1CDSA 2H8UA 1ABTA 4BDTB 3KFDI 1CCQA 4AEAA 3BT2U 1H0JA 2CTXA 3BT1U 1L4WA 2H62C 1JBDA 2J8BA 1FFJA 1TGXA 1CDRA 3U73U 1KTZB 2ABXA 1QM7A 3KFDE 2CRSA 5DO6A 1KBTA 2JQPA 1NXBA 3NEQA 1NYUA 2CDXA 2JVEA 1MR6A 5IMYC 2UX2A 4UY2C 1CTXA 2L03A 2QC1A 2H7ZB 2MHYA 2MJ0A 1W6BA 2QJ9C 1CXOA 1B41B 1LSIA 2QJBC 1KU6B 5DU1A 1DRSA 2X8BB 1HC9B 1ONJA 1TXBA 1FF4A 1IKCA 4IYEA 5EBXA 4OM5A 1COEA 1KC4A 3EBXA 3FEVA 3ERAA 2BHIA 3PLCA 1HOYA 1IDLA 2HLRA 1HAJA
chains in the Genus database with same CATH superfamily
1IDGA 1XT3A 1IJCA 1CREA 1FASA 1KL8A 1TXAA 2CCXA 2ERAA 1LXGA 1ERAA 4KSNA 1HAAA 1CB9A 1NTNA 2I9BE 4OM4A 1KS6A 1ERGA 2QJAC 1QKEA 1I02A 2FD6U 2H7ZA 2GOOC 1YWHA 4LFTA 1KXIA 5DZ5A 2L5SA 1HC9A 2HLQA 2MFAA 1V6PA 4P7UA 1REWC 1FSSB 4XJJA 1CRFA 1JE9A 1JGKA 3NDSA 1NORA 2K3GA 1F94A 1BXPA 1UG4A 1CDTA 4ZQYA 2LA1A 4FAOE 1CHVS 1QKDA 4DO8A 2MJYA 1MAHF 3EVSC 4EY8B 1IDIA 2OFSA 1F8UB 1CXNA 2PJYC 2GOOB 1RGJA 1NEAA 1S4YA 1KBAA 3LAQU 2PJYB 4FAOC 1ES7B 1FSCA 1CVOA 2MJ4A 1M9ZA 1IK8A 2H64C 2NBTA 2MUPA 4BIKB 2LCRA 1TFSA 1CODA 5IMTD 2UWRA 2MUOA 4HQPF 1KBSA 1FRAA 2CRTA 6EBXA 2H5FA 2N99A 3QB4B 3U74U 3HH7A 1IQ9A 1IDHA 1KFHA 1LXHA 1ZADA 3VTSA 1VB0A 1BTEA 3NH7A 1G6MA 4RUDA 1LJZA 2BTXA 2H64B 1CDQA 4QTIU 2H62D 1NTXA 1LX5B 1PLOA 1RL5A 2VLWA 1NYSA 1CDSA 2H8UA 1ABTA 4BDTB 3KFDI 1CCQA 4AEAA 3BT2U 1H0JA 2CTXA 3BT1U 1L4WA 2H62C 1JBDA 2J8BA 1FFJA 1TGXA 1CDRA 3U73U 1KTZB 2ABXA 1QM7A 3KFDE 2CRSA 5DO6A 1KBTA 2JQPA 1NXBA 3NEQA 1NYUA 2CDXA 2JVEA 1MR6A 5IMYC 2UX2A 4UY2C 1CTXA 2L03A 2QC1A 2H7ZB 2MHYA 2MJ0A 1W6BA 2QJ9C 1CXOA 1B41B 1LSIA 2QJBC 1KU6B 5DU1A 1DRSA 2X8BB 1HC9B 1ONJA 1TXBA 1FF4A 1IKCA 4IYEA 5EBXA 4OM5A 1COEA 1KC4A 3EBXA 3FEVA 3ERAA 2BHIA 3PLCA 1HOYA 1IDLA 2HLRA 1HAJA
chains in the Genus database with same CATH topology
1IDGA 1XT3A 1IJCA 1CREA 1FASA 1KL8A 1TXAA 2CCXA 2ERAA 1LXGA 1ERAA 4KSNA 1HAAA 1CB9A 1NTNA 2I9BE 4OM4A 1KS6A 1ERGA 2QJAC 1QKEA 1I02A 2FD6U 2H7ZA 2GOOC 1YWHA 4LFTA 1KXIA 5DZ5A 2L5SA 1HC9A 2HLQA 2MFAA 1V6PA 4P7UA 1REWC 1FSSB 4XJJA 1CRFA 1JE9A 1JGKA 3NDSA 1NORA 2K3GA 1F94A 1BXPA 1UG4A 1CDTA 4ZQYA 2LA1A 4FAOE 1CHVS 1QKDA 4DO8A 2MJYA 1MAHF 3EVSC 4EY8B 1IDIA 2OFSA 1F8UB 1CXNA 2PJYC 2GOOB 1RGJA 1NEAA 1S4YA 1KBAA 3LAQU 2PJYB 4FAOC 1ES7B 1FSCA 1CVOA 2MJ4A 1M9ZA 1IK8A 2H64C 2NBTA 2MUPA 4BIKB 2LCRA 1TFSA 1CODA 5IMTD 2UWRA 2MUOA 4HQPF 1KBSA 1FRAA 2CRTA 6EBXA 2H5FA 2N99A 3QB4B 3U74U 3HH7A 1IQ9A 1IDHA 1KFHA 1LXHA 1ZADA 3VTSA 1VB0A 1BTEA 3NH7A 1G6MA 4RUDA 1LJZA 2BTXA 2H64B 1CDQA 4QTIU 2H62D 1NTXA 1LX5B 1PLOA 1RL5A 2VLWA 1NYSA 1CDSA 2H8UA 1ABTA 4BDTB 3KFDI 1CCQA 4AEAA 3BT2U 1H0JA 2CTXA 3BT1U 1L4WA 2H62C 1JBDA 2J8BA 1FFJA 1TGXA 1CDRA 3U73U 1KTZB 2ABXA 1QM7A 3KFDE 2CRSA 5DO6A 1KBTA 2JQPA 1NXBA 3NEQA 1NYUA 2CDXA 2JVEA 1MR6A 5IMYC 2UX2A 4UY2C 1CTXA 2L03A 2QC1A 2H7ZB 2MHYA 2MJ0A 1W6BA 2QJ9C 1CXOA 1B41B 1LSIA 2QJBC 1KU6B 5DU1A 1DRSA 2X8BB 1HC9B 1ONJA 1TXBA 1FF4A 1IKCA 4IYEA 5EBXA 4OM5A 1COEA 1KC4A 3EBXA 3FEVA 3ERAA 2BHIA 3PLCA 1HOYA 1IDLA 2HLRA 1HAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDG A;  1XT3 A;  1IJC A;  1CRE A;  1FAS A;  1KL8 A;  1TXA A;  2CCX A;  2ERA A;  1LXG A;  1ERA A;  1HAA A;  1CB9 A;  1NTN A;  2I9B E;  4OM4 A;  1KS6 A;  1ERG A;  2QJA C;  1QKE A;  1I02 A;  2FD6 U;  2H7Z A;  2GOO C;  1YWH A;  4LFT A;  1KXI A;  5DZ5 A;  2L5S A;  1HC9 A;  2HLQ A;  2MFA A;  1V6P A;  4P7U A;  1REW C;  1FSS B;  4XJJ A;  1CRF A;  1JE9 A;  1JGK A;  3NDS A;  1NOR A;  2K3G A;  1F94 A;  1BXP A;  1UG4 A;  1CDT A;  4ZQY A;  2LA1 A;  4FAO E;  1CHV S;  1QKD A;  4DO8 A;  2MJY A;  1MAH F;  3EVS C;  4EY8 B;  1IDI A;  2OFS A;  1F8U B;  1CXN A;  2PJY C;  2GOO B;  1RGJ A;  1NEA A;  1S4Y A;  1KBA A;  3LAQ U;  2PJY B;  4FAO C;  1ES7 B;  1FSC A;  1CVO A;  2MJ4 A;  1M9Z A;  1IK8 A;  2H64 C;  2NBT A;  2MUP A;  4BIK B;  2LCR A;  1TFS A;  1COD A;  5IMT D;  2UWR A;  2MUO A;  4HQP F;  1KBS A;  1FRA A;  2CRT A;  6EBX A;  2H5F A;  2N99 A;  3QB4 B;  3U74 U;  3HH7 A;  1IQ9 A;  1IDH A;  1KFH A;  1LXH A;  1ZAD A;  3VTS A;  1VB0 A;  1BTE A;  3NH7 A;  1G6M A;  4RUD A;  1LJZ A;  2BTX A;  2H64 B;  1CDQ A;  4QTI U;  2H62 D;  1NTX A;  1LX5 B;  1PLO A;  1RL5 A;  2VLW A;  1NYS A;  1CDS A;  2H8U A;  1ABT A;  4BDT B;  3KFD I;  1CCQ A;  4AEA A;  3BT2 U;  1H0J A;  2CTX A;  3BT1 U;  1L4W A;  2H62 C;  1JBD A;  2J8B A;  1FFJ A;  1TGX A;  1CDR A;  3U73 U;  1KTZ B;  2ABX A;  1QM7 A;  3KFD E;  2CRS A;  5DO6 A;  1KBT A;  2JQP A;  1NXB A;  3NEQ A;  1NYU A;  2CDX A;  2JVE A;  1MR6 A;  5IMY C;  2UX2 A;  4UY2 C;  1CTX A;  2L03 A;  2QC1 A;  2H7Z B;  2MHY A;  2MJ0 A;  1W6B A;  2QJ9 C;  1CXO A;  1B41 B;  1LSI A;  2QJB C;  1KU6 B;  5DU1 A;  1DRS A;  2X8B B;  1HC9 B;  1ONJ A;  1TXB A;  1FF4 A;  1IKC A;  4IYE A;  5EBX A;  4OM5 A;  1COE A;  1KC4 A;  3EBX A;  3FEV A;  3ERA A;  2BHI A;  3PLC A;  1HOY A;  1IDL A;  2HLR A;  1HAJ A; 
#chains in the Genus database with same CATH topology
 1IDG A;  1XT3 A;  1IJC A;  1CRE A;  1FAS A;  1KL8 A;  1TXA A;  2CCX A;  2ERA A;  1LXG A;  1ERA A;  4KSN A;  1HAA A;  1CB9 A;  1NTN A;  2I9B E;  4OM4 A;  1KS6 A;  1ERG A;  2QJA C;  1QKE A;  1I02 A;  2FD6 U;  2H7Z A;  2GOO C;  1YWH A;  4LFT A;  1KXI A;  5DZ5 A;  2L5S A;  1HC9 A;  2HLQ A;  2MFA A;  1V6P A;  4P7U A;  1REW C;  1FSS B;  4XJJ A;  1CRF A;  1JE9 A;  1JGK A;  3NDS A;  1NOR A;  2K3G A;  1F94 A;  1BXP A;  1UG4 A;  1CDT A;  4ZQY A;  2LA1 A;  4FAO E;  1CHV S;  1QKD A;  4DO8 A;  2MJY A;  1MAH F;  3EVS C;  4EY8 B;  1IDI A;  2OFS A;  1F8U B;  1CXN A;  2PJY C;  2GOO B;  1RGJ A;  1NEA A;  1S4Y A;  1KBA A;  3LAQ U;  2PJY B;  4FAO C;  1ES7 B;  1FSC A;  1CVO A;  2MJ4 A;  1M9Z A;  1IK8 A;  2H64 C;  2NBT A;  2MUP A;  4BIK B;  2LCR A;  1TFS A;  1COD A;  5IMT D;  2UWR A;  2MUO A;  4HQP F;  1KBS A;  1FRA A;  2CRT A;  6EBX A;  2H5F A;  2N99 A;  3QB4 B;  3U74 U;  3HH7 A;  1IQ9 A;  1IDH A;  1KFH A;  1LXH A;  1ZAD A;  3VTS A;  1VB0 A;  1BTE A;  3NH7 A;  1G6M A;  4RUD A;  1LJZ A;  2BTX A;  2H64 B;  1CDQ A;  4QTI U;  2H62 D;  1NTX A;  1LX5 B;  1PLO A;  1RL5 A;  2VLW A;  1NYS A;  1CDS A;  2H8U A;  1ABT A;  4BDT B;  3KFD I;  1CCQ A;  4AEA A;  3BT2 U;  1H0J A;  2CTX A;  3BT1 U;  1L4W A;  2H62 C;  1JBD A;  2J8B A;  1FFJ A;  1TGX A;  1CDR A;  3U73 U;  1KTZ B;  2ABX A;  1QM7 A;  3KFD E;  2CRS A;  5DO6 A;  1KBT A;  2JQP A;  1NXB A;  3NEQ A;  1NYU A;  2CDX A;  2JVE A;  1MR6 A;  5IMY C;  2UX2 A;  4UY2 C;  1CTX A;  2L03 A;  2QC1 A;  2H7Z B;  2MHY A;  2MJ0 A;  1W6B A;  2QJ9 C;  1CXO A;  1B41 B;  1LSI A;  2QJB C;  1KU6 B;  5DU1 A;  1DRS A;  2X8B B;  1HC9 B;  1ONJ A;  1TXB A;  1FF4 A;  1IKC A;  4IYE A;  5EBX A;  4OM5 A;  1COE A;  1KC4 A;  3EBX A;  3FEV A;  3ERA A;  2BHI A;  3PLC A;  1HOY A;  1IDL A;  2HLR A;  1HAJ A; 
#chains in the Genus database with same CATH homology
 1IDG A;  1XT3 A;  1IJC A;  1CRE A;  1FAS A;  1KL8 A;  1TXA A;  2CCX A;  2ERA A;  1LXG A;  1ERA A;  4KSN A;  1HAA A;  1CB9 A;  1NTN A;  2I9B E;  4OM4 A;  1KS6 A;  1ERG A;  2QJA C;  1QKE A;  1I02 A;  2FD6 U;  2H7Z A;  2GOO C;  1YWH A;  4LFT A;  1KXI A;  5DZ5 A;  2L5S A;  1HC9 A;  2HLQ A;  2MFA A;  1V6P A;  4P7U A;  1REW C;  1FSS B;  4XJJ A;  1CRF A;  1JE9 A;  1JGK A;  3NDS A;  1NOR A;  2K3G A;  1F94 A;  1BXP A;  1UG4 A;  1CDT A;  4ZQY A;  2LA1 A;  4FAO E;  1CHV S;  1QKD A;  4DO8 A;  2MJY A;  1MAH F;  3EVS C;  4EY8 B;  1IDI A;  2OFS A;  1F8U B;  1CXN A;  2PJY C;  2GOO B;  1RGJ A;  1NEA A;  1S4Y A;  1KBA A;  3LAQ U;  2PJY B;  4FAO C;  1ES7 B;  1FSC A;  1CVO A;  2MJ4 A;  1M9Z A;  1IK8 A;  2H64 C;  2NBT A;  2MUP A;  4BIK B;  2LCR A;  1TFS A;  1COD A;  5IMT D;  2UWR A;  2MUO A;  4HQP F;  1KBS A;  1FRA A;  2CRT A;  6EBX A;  2H5F A;  2N99 A;  3QB4 B;  3U74 U;  3HH7 A;  1IQ9 A;  1IDH A;  1KFH A;  1LXH A;  1ZAD A;  3VTS A;  1VB0 A;  1BTE A;  3NH7 A;  1G6M A;  4RUD A;  1LJZ A;  2BTX A;  2H64 B;  1CDQ A;  4QTI U;  2H62 D;  1NTX A;  1LX5 B;  1PLO A;  1RL5 A;  2VLW A;  1NYS A;  1CDS A;  2H8U A;  1ABT A;  4BDT B;  3KFD I;  1CCQ A;  4AEA A;  3BT2 U;  1H0J A;  2CTX A;  3BT1 U;  1L4W A;  2H62 C;  1JBD A;  2J8B A;  1FFJ A;  1TGX A;  1CDR A;  3U73 U;  1KTZ B;  2ABX A;  1QM7 A;  3KFD E;  2CRS A;  5DO6 A;  1KBT A;  2JQP A;  1NXB A;  3NEQ A;  1NYU A;  2CDX A;  2JVE A;  1MR6 A;  5IMY C;  2UX2 A;  4UY2 C;  1CTX A;  2L03 A;  2QC1 A;  2H7Z B;  2MHY A;  2MJ0 A;  1W6B A;  2QJ9 C;  1CXO A;  1B41 B;  1LSI A;  2QJB C;  1KU6 B;  5DU1 A;  1DRS A;  2X8B B;  1HC9 B;  1ONJ A;  1TXB A;  1FF4 A;  1IKC A;  4IYE A;  5EBX A;  4OM5 A;  1COE A;  1KC4 A;  3EBX A;  3FEV A;  3ERA A;  2BHI A;  3PLC A;  1HOY A;  1IDL A;  2HLR A;  1HAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...