5EBXA

The crystal structure of erabutoxin a at 2.0 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ERABUTOXIN A
publication title The crystal structure of erabutoxin a at 2.0-A resolution.
pubmed rcsb
source organism Laticauda semifasciata
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1989-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5ebxA00
1IKCA 3NH7A 1CODA 1TGXA 1MAHF 1LXHA 2L03A 2ABXA 4OM5A 2PJYC 3BT1U 1CVOA 1LJZA 2UWRA 1CTXA 1S4YA 1ZADA 1NTXA 2HLQA 5IMTD 1CDSA 2H8UA 1TXBA 3ERAA 3FEVA 1I02A 1CRFA 2HLRA 2MHYA 1IQ9A 2LCRA 2CRSA 2MUPA 2QC1A 4EY8B 1FRAA 1COEA 1KS6A 1KBAA 1DRSA 1KXIA 1IDGA 2MFAA 1NYUA 3EVSC 4HQPF 2MJYA 1IDHA 1QKEA 1ERAA 2I9BE 2BHIA 1REWC 2LA1A 1H0JA 2H62D 4BDTB 4FAOC 1CXNA 1LX5B 1TFSA 3NDSA 1NYSA 1CCQA 1NXBA 1IJCA 2PJYB 4UY2C 2H7ZB 1G6MA 3U74U 5DO6A 1CXOA 1IDLA 4IYEA 2JVEA 1KU6B 1HC9B 1PLOA 1XT3A 1MR6A 1KFHA 1FSSB 4OM4A 1JBDA 2CRTA 4DO8A 1NEAA 1NTNA 1B41B 4AEAA 4QTIU 1W6BA 1ONJA 2J8BA 2L5SA 2CCXA 3VTSA 1YWHA 2H7ZA 1FASA 1FSCA 1LXGA 1ES7B 3EBXA 1KBSA 1HC9A 2QJAC 5IMYC 2NBTA 1TXAA 2X8BB 2CTXA 1ABTA 1M9ZA 4FAOE 2GOOC 5DZ5A 2H64C 3U73U 2H64B 3LAQU 3PLCA 4BIKB 1KTZB 2H5FA 3NEQA 2UX2A 1ERGA 2H62C 2K3GA 1NORA 3QB4B 1IDIA 1CREA 1FFJA 1IK8A 4P7UA 1UG4A 1FF4A 4RUDA 1V6PA 1CHVS 6EBXA 1HAJA 1QKDA 1BXPA 2VLWA 2CDXA 1JE9A 2MJ0A 2JQPA 1KC4A 2BTXA 1KBTA 2FD6U 1F8UB 1L4WA 2MJ4A 1CDQA 1BTEA 1QM7A 1RL5A 2OFSA 2GOOB 3KFDE 3KFDI 1HOYA 1CB9A 1HAAA 2ERAA 2QJBC 3BT2U 1LSIA 1CDRA 1JGKA 3HH7A 1F94A 5EBXA 1VB0A 2QJ9C 4XJJA 2MUOA 2N99A 4LFTA 5DU1A 1CDTA 4ZQYA 1KL8A 1RGJA
chains in the Genus database with same CATH superfamily
1IKCA 3NH7A 1CODA 1TGXA 1MAHF 1LXHA 2L03A 2ABXA 4OM5A 2PJYC 3BT1U 1CVOA 1LJZA 2UWRA 1CTXA 1S4YA 1ZADA 1NTXA 2HLQA 5IMTD 1CDSA 4KSNA 2H8UA 1TXBA 3ERAA 3FEVA 1I02A 1CRFA 2HLRA 2MHYA 1IQ9A 2LCRA 2CRSA 2MUPA 2QC1A 4EY8B 1FRAA 1COEA 1KS6A 1KBAA 1DRSA 1KXIA 1IDGA 2MFAA 1NYUA 3EVSC 4HQPF 2MJYA 1IDHA 1QKEA 1ERAA 2I9BE 2BHIA 1REWC 2LA1A 1H0JA 2H62D 4BDTB 4FAOC 1CXNA 1LX5B 1TFSA 3NDSA 1NYSA 1CCQA 1NXBA 1IJCA 2PJYB 4UY2C 2H7ZB 1G6MA 3U74U 5DO6A 1CXOA 1IDLA 4IYEA 2JVEA 1KU6B 1HC9B 1PLOA 1XT3A 1MR6A 1KFHA 1FSSB 4OM4A 1JBDA 2CRTA 4DO8A 1NEAA 1NTNA 1B41B 4AEAA 4QTIU 1W6BA 1ONJA 2J8BA 2L5SA 2CCXA 3VTSA 1YWHA 2H7ZA 1FASA 1FSCA 1LXGA 1ES7B 3EBXA 1KBSA 1HC9A 2QJAC 5IMYC 2NBTA 1TXAA 2X8BB 2CTXA 1ABTA 1M9ZA 4FAOE 2GOOC 5DZ5A 2H64C 3U73U 2H64B 3LAQU 3PLCA 4BIKB 1KTZB 2H5FA 3NEQA 2UX2A 1ERGA 2H62C 2K3GA 1NORA 3QB4B 1IDIA 1CREA 1FFJA 1IK8A 4P7UA 1UG4A 1FF4A 4RUDA 1V6PA 1CHVS 6EBXA 1HAJA 1QKDA 1BXPA 2VLWA 2CDXA 1JE9A 2MJ0A 2JQPA 1KC4A 2BTXA 1KBTA 2FD6U 1F8UB 1L4WA 2MJ4A 1CDQA 1BTEA 1QM7A 1RL5A 2OFSA 2GOOB 3KFDE 3KFDI 1HOYA 1CB9A 1HAAA 2ERAA 2QJBC 3BT2U 1LSIA 1CDRA 1JGKA 3HH7A 1F94A 5EBXA 1VB0A 2QJ9C 4XJJA 2MUOA 2N99A 4LFTA 5DU1A 1CDTA 4ZQYA 1KL8A 1RGJA
chains in the Genus database with same CATH topology
1IKCA 3NH7A 1CODA 1TGXA 1MAHF 1LXHA 2L03A 2ABXA 4OM5A 2PJYC 3BT1U 1CVOA 1LJZA 2UWRA 1CTXA 1S4YA 1ZADA 1NTXA 2HLQA 5IMTD 1CDSA 4KSNA 2H8UA 1TXBA 3ERAA 3FEVA 1I02A 1CRFA 2HLRA 2MHYA 1IQ9A 2LCRA 2CRSA 2MUPA 2QC1A 4EY8B 1FRAA 1COEA 1KS6A 1KBAA 1DRSA 1KXIA 1IDGA 2MFAA 1NYUA 3EVSC 4HQPF 2MJYA 1IDHA 1QKEA 1ERAA 2I9BE 2BHIA 1REWC 2LA1A 1H0JA 2H62D 4BDTB 4FAOC 1CXNA 1LX5B 1TFSA 3NDSA 1NYSA 1CCQA 1NXBA 1IJCA 2PJYB 4UY2C 2H7ZB 1G6MA 3U74U 5DO6A 1CXOA 1IDLA 4IYEA 2JVEA 1KU6B 1HC9B 1PLOA 1XT3A 1MR6A 1KFHA 1FSSB 4OM4A 1JBDA 2CRTA 4DO8A 1NEAA 1NTNA 1B41B 4AEAA 4QTIU 1W6BA 1ONJA 2J8BA 2L5SA 2CCXA 3VTSA 1YWHA 2H7ZA 1FASA 1FSCA 1LXGA 1ES7B 3EBXA 1KBSA 1HC9A 2QJAC 5IMYC 2NBTA 1TXAA 2X8BB 2CTXA 1ABTA 1M9ZA 4FAOE 2GOOC 5DZ5A 2H64C 3U73U 2H64B 3LAQU 3PLCA 4BIKB 1KTZB 2H5FA 3NEQA 2UX2A 1ERGA 2H62C 2K3GA 1NORA 3QB4B 1IDIA 1CREA 1FFJA 1IK8A 4P7UA 1UG4A 1FF4A 4RUDA 1V6PA 1CHVS 6EBXA 1HAJA 1QKDA 1BXPA 2VLWA 2CDXA 1JE9A 2MJ0A 2JQPA 1KC4A 2BTXA 1KBTA 2FD6U 1F8UB 1L4WA 2MJ4A 1CDQA 1BTEA 1QM7A 1RL5A 2OFSA 2GOOB 3KFDE 3KFDI 1HOYA 1CB9A 1HAAA 2ERAA 2QJBC 3BT2U 1LSIA 1CDRA 1JGKA 3HH7A 1F94A 5EBXA 1VB0A 2QJ9C 4XJJA 2MUOA 2N99A 4LFTA 5DU1A 1CDTA 4ZQYA 1KL8A 1RGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKC A;  3NH7 A;  1COD A;  1TGX A;  1MAH F;  1LXH A;  2L03 A;  2ABX A;  4OM5 A;  2PJY C;  3BT1 U;  1CVO A;  1LJZ A;  2UWR A;  1CTX A;  1S4Y A;  1ZAD A;  1NTX A;  2HLQ A;  5IMT D;  1CDS A;  2H8U A;  1TXB A;  3ERA A;  3FEV A;  1I02 A;  1CRF A;  2HLR A;  2MHY A;  1IQ9 A;  2LCR A;  2CRS A;  2MUP A;  2QC1 A;  4EY8 B;  1FRA A;  1COE A;  1KS6 A;  1KBA A;  1DRS A;  1KXI A;  1IDG A;  2MFA A;  1NYU A;  3EVS C;  4HQP F;  2MJY A;  1IDH A;  1QKE A;  1ERA A;  2I9B E;  2BHI A;  1REW C;  2LA1 A;  1H0J A;  2H62 D;  4BDT B;  4FAO C;  1CXN A;  1LX5 B;  1TFS A;  3NDS A;  1NYS A;  1CCQ A;  1NXB A;  1IJC A;  2PJY B;  4UY2 C;  2H7Z B;  1G6M A;  3U74 U;  5DO6 A;  1CXO A;  1IDL A;  4IYE A;  2JVE A;  1KU6 B;  1HC9 B;  1PLO A;  1XT3 A;  1MR6 A;  1KFH A;  1FSS B;  4OM4 A;  1JBD A;  2CRT A;  4DO8 A;  1NEA A;  1NTN A;  1B41 B;  4AEA A;  4QTI U;  1W6B A;  1ONJ A;  2J8B A;  2L5S A;  2CCX A;  3VTS A;  1YWH A;  2H7Z A;  1FAS A;  1FSC A;  1LXG A;  1ES7 B;  3EBX A;  1KBS A;  1HC9 A;  2QJA C;  5IMY C;  2NBT A;  1TXA A;  2X8B B;  2CTX A;  1ABT A;  1M9Z A;  4FAO E;  2GOO C;  5DZ5 A;  2H64 C;  3U73 U;  2H64 B;  3LAQ U;  3PLC A;  4BIK B;  1KTZ B;  2H5F A;  3NEQ A;  2UX2 A;  1ERG A;  2H62 C;  2K3G A;  1NOR A;  3QB4 B;  1IDI A;  1CRE A;  1FFJ A;  1IK8 A;  4P7U A;  1UG4 A;  1FF4 A;  4RUD A;  1V6P A;  1CHV S;  6EBX A;  1HAJ A;  1QKD A;  1BXP A;  2VLW A;  2CDX A;  1JE9 A;  2MJ0 A;  2JQP A;  1KC4 A;  2BTX A;  1KBT A;  2FD6 U;  1F8U B;  1L4W A;  2MJ4 A;  1CDQ A;  1BTE A;  1QM7 A;  1RL5 A;  2OFS A;  2GOO B;  3KFD E;  3KFD I;  1HOY A;  1CB9 A;  1HAA A;  2ERA A;  2QJB C;  3BT2 U;  1LSI A;  1CDR A;  1JGK A;  3HH7 A;  1F94 A;  5EBX A;  1VB0 A;  2QJ9 C;  4XJJ A;  2MUO A;  2N99 A;  4LFT A;  5DU1 A;  1CDT A;  4ZQY A;  1KL8 A;  1RGJ A; 
#chains in the Genus database with same CATH topology
 1IKC A;  3NH7 A;  1COD A;  1TGX A;  1MAH F;  1LXH A;  2L03 A;  2ABX A;  4OM5 A;  2PJY C;  3BT1 U;  1CVO A;  1LJZ A;  2UWR A;  1CTX A;  1S4Y A;  1ZAD A;  1NTX A;  2HLQ A;  5IMT D;  1CDS A;  4KSN A;  2H8U A;  1TXB A;  3ERA A;  3FEV A;  1I02 A;  1CRF A;  2HLR A;  2MHY A;  1IQ9 A;  2LCR A;  2CRS A;  2MUP A;  2QC1 A;  4EY8 B;  1FRA A;  1COE A;  1KS6 A;  1KBA A;  1DRS A;  1KXI A;  1IDG A;  2MFA A;  1NYU A;  3EVS C;  4HQP F;  2MJY A;  1IDH A;  1QKE A;  1ERA A;  2I9B E;  2BHI A;  1REW C;  2LA1 A;  1H0J A;  2H62 D;  4BDT B;  4FAO C;  1CXN A;  1LX5 B;  1TFS A;  3NDS A;  1NYS A;  1CCQ A;  1NXB A;  1IJC A;  2PJY B;  4UY2 C;  2H7Z B;  1G6M A;  3U74 U;  5DO6 A;  1CXO A;  1IDL A;  4IYE A;  2JVE A;  1KU6 B;  1HC9 B;  1PLO A;  1XT3 A;  1MR6 A;  1KFH A;  1FSS B;  4OM4 A;  1JBD A;  2CRT A;  4DO8 A;  1NEA A;  1NTN A;  1B41 B;  4AEA A;  4QTI U;  1W6B A;  1ONJ A;  2J8B A;  2L5S A;  2CCX A;  3VTS A;  1YWH A;  2H7Z A;  1FAS A;  1FSC A;  1LXG A;  1ES7 B;  3EBX A;  1KBS A;  1HC9 A;  2QJA C;  5IMY C;  2NBT A;  1TXA A;  2X8B B;  2CTX A;  1ABT A;  1M9Z A;  4FAO E;  2GOO C;  5DZ5 A;  2H64 C;  3U73 U;  2H64 B;  3LAQ U;  3PLC A;  4BIK B;  1KTZ B;  2H5F A;  3NEQ A;  2UX2 A;  1ERG A;  2H62 C;  2K3G A;  1NOR A;  3QB4 B;  1IDI A;  1CRE A;  1FFJ A;  1IK8 A;  4P7U A;  1UG4 A;  1FF4 A;  4RUD A;  1V6P A;  1CHV S;  6EBX A;  1HAJ A;  1QKD A;  1BXP A;  2VLW A;  2CDX A;  1JE9 A;  2MJ0 A;  2JQP A;  1KC4 A;  2BTX A;  1KBT A;  2FD6 U;  1F8U B;  1L4W A;  2MJ4 A;  1CDQ A;  1BTE A;  1QM7 A;  1RL5 A;  2OFS A;  2GOO B;  3KFD E;  3KFD I;  1HOY A;  1CB9 A;  1HAA A;  2ERA A;  2QJB C;  3BT2 U;  1LSI A;  1CDR A;  1JGK A;  3HH7 A;  1F94 A;  5EBX A;  1VB0 A;  2QJ9 C;  4XJJ A;  2MUO A;  2N99 A;  4LFT A;  5DU1 A;  1CDT A;  4ZQY A;  1KL8 A;  1RGJ A; 
#chains in the Genus database with same CATH homology
 1IKC A;  3NH7 A;  1COD A;  1TGX A;  1MAH F;  1LXH A;  2L03 A;  2ABX A;  4OM5 A;  2PJY C;  3BT1 U;  1CVO A;  1LJZ A;  2UWR A;  1CTX A;  1S4Y A;  1ZAD A;  1NTX A;  2HLQ A;  5IMT D;  1CDS A;  4KSN A;  2H8U A;  1TXB A;  3ERA A;  3FEV A;  1I02 A;  1CRF A;  2HLR A;  2MHY A;  1IQ9 A;  2LCR A;  2CRS A;  2MUP A;  2QC1 A;  4EY8 B;  1FRA A;  1COE A;  1KS6 A;  1KBA A;  1DRS A;  1KXI A;  1IDG A;  2MFA A;  1NYU A;  3EVS C;  4HQP F;  2MJY A;  1IDH A;  1QKE A;  1ERA A;  2I9B E;  2BHI A;  1REW C;  2LA1 A;  1H0J A;  2H62 D;  4BDT B;  4FAO C;  1CXN A;  1LX5 B;  1TFS A;  3NDS A;  1NYS A;  1CCQ A;  1NXB A;  1IJC A;  2PJY B;  4UY2 C;  2H7Z B;  1G6M A;  3U74 U;  5DO6 A;  1CXO A;  1IDL A;  4IYE A;  2JVE A;  1KU6 B;  1HC9 B;  1PLO A;  1XT3 A;  1MR6 A;  1KFH A;  1FSS B;  4OM4 A;  1JBD A;  2CRT A;  4DO8 A;  1NEA A;  1NTN A;  1B41 B;  4AEA A;  4QTI U;  1W6B A;  1ONJ A;  2J8B A;  2L5S A;  2CCX A;  3VTS A;  1YWH A;  2H7Z A;  1FAS A;  1FSC A;  1LXG A;  1ES7 B;  3EBX A;  1KBS A;  1HC9 A;  2QJA C;  5IMY C;  2NBT A;  1TXA A;  2X8B B;  2CTX A;  1ABT A;  1M9Z A;  4FAO E;  2GOO C;  5DZ5 A;  2H64 C;  3U73 U;  2H64 B;  3LAQ U;  3PLC A;  4BIK B;  1KTZ B;  2H5F A;  3NEQ A;  2UX2 A;  1ERG A;  2H62 C;  2K3G A;  1NOR A;  3QB4 B;  1IDI A;  1CRE A;  1FFJ A;  1IK8 A;  4P7U A;  1UG4 A;  1FF4 A;  4RUD A;  1V6P A;  1CHV S;  6EBX A;  1HAJ A;  1QKD A;  1BXP A;  2VLW A;  2CDX A;  1JE9 A;  2MJ0 A;  2JQP A;  1KC4 A;  2BTX A;  1KBT A;  2FD6 U;  1F8U B;  1L4W A;  2MJ4 A;  1CDQ A;  1BTE A;  1QM7 A;  1RL5 A;  2OFS A;  2GOO B;  3KFD E;  3KFD I;  1HOY A;  1CB9 A;  1HAA A;  2ERA A;  2QJB C;  3BT2 U;  1LSI A;  1CDR A;  1JGK A;  3HH7 A;  1F94 A;  5EBX A;  1VB0 A;  2QJ9 C;  4XJJ A;  2MUO A;  2N99 A;  4LFT A;  5DU1 A;  1CDT A;  4ZQY A;  1KL8 A;  1RGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...