5EBXA

The crystal structure of erabutoxin a at 2.0 angstroms resolution
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYNKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ERABUTOXIN A
publication title The crystal structure of erabutoxin a at 2.0-A resolution.
pubmed rcsb
source organism Laticauda semifasciata
molecule tags Toxin
total genus 13
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1989-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5ebxA00
1IDHA 2MUPA 2ABXA 2QJAC 1ERAA 5DU1A 1QM7A 2J8BA 2JVEA 1LSIA 3PLCA 1MAHF 4HQPF 4BDTB 4BIKB 2CDXA 3U74U 2MHYA 1TFSA 2X8BB 1BXPA 2CTXA 1CREA 3HH7A 1CTXA 1NTXA 1FASA 3FEVA 5IMYC 1KL8A 1CODA 1DRSA 1NYUA 1ONJA 4OM5A 1JBDA 1V6PA 3LAQU 2MJYA 2LCRA 1KC4A 2HLQA 4FAOC 1LXHA 1IDIA 2H7ZB 1IKCA 1JGKA 1MR6A 1NEAA 2MJ4A 1VB0A 1HC9A 1FSSB 3EVSC 4AEAA 2H62D 1NYSA 2FD6U 1H0JA 2BHIA 1CB9A 1CDTA 4P7UA 1G6MA 1CHVS 1NTNA 1M9ZA 1B41B 1QKDA 1KBTA 4LFTA 1CXOA 4IYEA 1TXAA 2GOOB 2LA1A 2VLWA 2UWRA 1CXNA 3KFDI 1IDGA 2HLRA 1BTEA 1IJCA 3U73U 1RGJA 1IQ9A 4FAOE 1HAJA 1KTZB 3ERAA 2ERAA 2GOOC 2L03A 2UX2A 1LX5B 1REWC 3KFDE 1L4WA 1CCQA 1KBSA 4ZQYA 1ZADA 1I02A 3EBXA 2H64B 2OFSA 2H62C 1CVOA 1FSCA 1KS6A 2CRSA 3VTSA 2JQPA 2MFAA 5IMTD 1TXBA 1NXBA 3BT2U 1QKEA 2QJBC 2H7ZA 1IDLA 3QB4B 4XJJA 2K3GA 1KU6B 6EBXA 3NH7A 2BTXA 1FFJA 2PJYB 2NBTA 2N99A 1CDRA 1COEA 4UY2C 1KFHA 3NDSA 1YWHA 1S4YA 2MJ0A 4RUDA 1CDQA 2PJYC 1CDSA 1F8UB 1TGXA 1HOYA 4QTIU 1ERGA 2QJ9C 2MUOA 1ABTA 4EY8B 4OM4A 2L5SA 1LJZA 5DZ5A 1F94A 3NEQA 1FF4A 5EBXA 1W6BA 2CRTA 2H8UA 4DO8A 1JE9A 1PLOA 2H5FA 2I9BE 2H64C 1UG4A 2QC1A 2CCXA 1LXGA 1KXIA 1KBAA 1HC9B 1CRFA 1ES7B 1NORA 5DO6A 1RL5A 1FRAA 1HAAA 3BT1U 1XT3A 1IK8A
chains in the Genus database with same CATH superfamily
1IDHA 2MUPA 2ABXA 2QJAC 1ERAA 5DU1A 1QM7A 2J8BA 2JVEA 1LSIA 3PLCA 1MAHF 4HQPF 4BDTB 4BIKB 2CDXA 3U74U 2MHYA 1TFSA 2X8BB 1BXPA 2CTXA 1CREA 3HH7A 1CTXA 1NTXA 1FASA 3FEVA 5IMYC 1KL8A 1CODA 1DRSA 1NYUA 1ONJA 4OM5A 1JBDA 1V6PA 3LAQU 2MJYA 2LCRA 1KC4A 2HLQA 4FAOC 1LXHA 1IDIA 2H7ZB 1IKCA 1JGKA 1MR6A 1NEAA 2MJ4A 1VB0A 1HC9A 1FSSB 3EVSC 4AEAA 2H62D 1NYSA 2FD6U 1H0JA 2BHIA 1CB9A 1CDTA 4P7UA 1G6MA 1CHVS 1NTNA 1M9ZA 1B41B 1QKDA 1KBTA 4LFTA 1CXOA 4IYEA 1TXAA 2GOOB 2LA1A 2VLWA 2UWRA 1CXNA 3KFDI 1IDGA 2HLRA 1BTEA 1IJCA 3U73U 1RGJA 1IQ9A 4FAOE 1HAJA 1KTZB 3ERAA 2ERAA 2GOOC 2L03A 2UX2A 1LX5B 1REWC 3KFDE 1L4WA 1CCQA 1KBSA 4ZQYA 1ZADA 1I02A 3EBXA 2H64B 2OFSA 2H62C 1CVOA 1FSCA 1KS6A 2CRSA 3VTSA 2JQPA 2MFAA 5IMTD 1TXBA 1NXBA 3BT2U 1QKEA 2QJBC 2H7ZA 1IDLA 3QB4B 4XJJA 2K3GA 1KU6B 6EBXA 3NH7A 2BTXA 1FFJA 2PJYB 2NBTA 2N99A 1CDRA 1COEA 4UY2C 1KFHA 3NDSA 1YWHA 1S4YA 2MJ0A 4RUDA 1CDQA 2PJYC 1CDSA 4KSNA 1F8UB 1TGXA 1HOYA 4QTIU 1ERGA 2QJ9C 2MUOA 1ABTA 4EY8B 4OM4A 2L5SA 1LJZA 5DZ5A 1F94A 3NEQA 1FF4A 5EBXA 1W6BA 2CRTA 2H8UA 4DO8A 1JE9A 1PLOA 2H5FA 2I9BE 2H64C 1UG4A 2QC1A 2CCXA 1LXGA 1KXIA 1KBAA 1HC9B 1CRFA 1ES7B 1NORA 5DO6A 1RL5A 1FRAA 1HAAA 3BT1U 1XT3A 1IK8A
chains in the Genus database with same CATH topology
1IDHA 2MUPA 2ABXA 2QJAC 1ERAA 5DU1A 1QM7A 2J8BA 2JVEA 1LSIA 3PLCA 1MAHF 4HQPF 4BDTB 4BIKB 2CDXA 3U74U 2MHYA 1TFSA 2X8BB 1BXPA 2CTXA 1CREA 3HH7A 1CTXA 1NTXA 1FASA 3FEVA 5IMYC 1KL8A 1CODA 1DRSA 1NYUA 1ONJA 4OM5A 1JBDA 1V6PA 3LAQU 2MJYA 2LCRA 1KC4A 2HLQA 4FAOC 1LXHA 1IDIA 2H7ZB 1IKCA 1JGKA 1MR6A 1NEAA 2MJ4A 1VB0A 1HC9A 1FSSB 3EVSC 4AEAA 2H62D 1NYSA 2FD6U 1H0JA 2BHIA 1CB9A 1CDTA 4P7UA 1G6MA 1CHVS 1NTNA 1M9ZA 1B41B 1QKDA 1KBTA 4LFTA 1CXOA 4IYEA 1TXAA 2GOOB 2LA1A 2VLWA 2UWRA 1CXNA 3KFDI 1IDGA 2HLRA 1BTEA 1IJCA 3U73U 1RGJA 1IQ9A 4FAOE 1HAJA 1KTZB 3ERAA 2ERAA 2GOOC 2L03A 2UX2A 1LX5B 1REWC 3KFDE 1L4WA 1CCQA 1KBSA 4ZQYA 1ZADA 1I02A 3EBXA 2H64B 2OFSA 2H62C 1CVOA 1FSCA 1KS6A 2CRSA 3VTSA 2JQPA 2MFAA 5IMTD 1TXBA 1NXBA 3BT2U 1QKEA 2QJBC 2H7ZA 1IDLA 3QB4B 4XJJA 2K3GA 1KU6B 6EBXA 3NH7A 2BTXA 1FFJA 2PJYB 2NBTA 2N99A 1CDRA 1COEA 4UY2C 1KFHA 3NDSA 1YWHA 1S4YA 2MJ0A 4RUDA 1CDQA 2PJYC 1CDSA 4KSNA 1F8UB 1TGXA 1HOYA 4QTIU 1ERGA 2QJ9C 2MUOA 1ABTA 4EY8B 4OM4A 2L5SA 1LJZA 5DZ5A 1F94A 3NEQA 1FF4A 5EBXA 1W6BA 2CRTA 2H8UA 4DO8A 1JE9A 1PLOA 2H5FA 2I9BE 2H64C 1UG4A 2QC1A 2CCXA 1LXGA 1KXIA 1KBAA 1HC9B 1CRFA 1ES7B 1NORA 5DO6A 1RL5A 1FRAA 1HAAA 3BT1U 1XT3A 1IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDH A;  2MUP A;  2ABX A;  2QJA C;  1ERA A;  5DU1 A;  1QM7 A;  2J8B A;  2JVE A;  1LSI A;  3PLC A;  1MAH F;  4HQP F;  4BDT B;  4BIK B;  2CDX A;  3U74 U;  2MHY A;  1TFS A;  2X8B B;  1BXP A;  2CTX A;  1CRE A;  3HH7 A;  1CTX A;  1NTX A;  1FAS A;  3FEV A;  5IMY C;  1KL8 A;  1COD A;  1DRS A;  1NYU A;  1ONJ A;  4OM5 A;  1JBD A;  1V6P A;  3LAQ U;  2MJY A;  2LCR A;  1KC4 A;  2HLQ A;  4FAO C;  1LXH A;  1IDI A;  2H7Z B;  1IKC A;  1JGK A;  1MR6 A;  1NEA A;  2MJ4 A;  1VB0 A;  1HC9 A;  1FSS B;  3EVS C;  4AEA A;  2H62 D;  1NYS A;  2FD6 U;  1H0J A;  2BHI A;  1CB9 A;  1CDT A;  4P7U A;  1G6M A;  1CHV S;  1NTN A;  1M9Z A;  1B41 B;  1QKD A;  1KBT A;  4LFT A;  1CXO A;  4IYE A;  1TXA A;  2GOO B;  2LA1 A;  2VLW A;  2UWR A;  1CXN A;  3KFD I;  1IDG A;  2HLR A;  1BTE A;  1IJC A;  3U73 U;  1RGJ A;  1IQ9 A;  4FAO E;  1HAJ A;  1KTZ B;  3ERA A;  2ERA A;  2GOO C;  2L03 A;  2UX2 A;  1LX5 B;  1REW C;  3KFD E;  1L4W A;  1CCQ A;  1KBS A;  4ZQY A;  1ZAD A;  1I02 A;  3EBX A;  2H64 B;  2OFS A;  2H62 C;  1CVO A;  1FSC A;  1KS6 A;  2CRS A;  3VTS A;  2JQP A;  2MFA A;  5IMT D;  1TXB A;  1NXB A;  3BT2 U;  1QKE A;  2QJB C;  2H7Z A;  1IDL A;  3QB4 B;  4XJJ A;  2K3G A;  1KU6 B;  6EBX A;  3NH7 A;  2BTX A;  1FFJ A;  2PJY B;  2NBT A;  2N99 A;  1CDR A;  1COE A;  4UY2 C;  1KFH A;  3NDS A;  1YWH A;  1S4Y A;  2MJ0 A;  4RUD A;  1CDQ A;  2PJY C;  1CDS A;  1F8U B;  1TGX A;  1HOY A;  4QTI U;  1ERG A;  2QJ9 C;  2MUO A;  1ABT A;  4EY8 B;  4OM4 A;  2L5S A;  1LJZ A;  5DZ5 A;  1F94 A;  3NEQ A;  1FF4 A;  5EBX A;  1W6B A;  2CRT A;  2H8U A;  4DO8 A;  1JE9 A;  1PLO A;  2H5F A;  2I9B E;  2H64 C;  1UG4 A;  2QC1 A;  2CCX A;  1LXG A;  1KXI A;  1KBA A;  1HC9 B;  1CRF A;  1ES7 B;  1NOR A;  5DO6 A;  1RL5 A;  1FRA A;  1HAA A;  3BT1 U;  1XT3 A;  1IK8 A; 
#chains in the Genus database with same CATH topology
 1IDH A;  2MUP A;  2ABX A;  2QJA C;  1ERA A;  5DU1 A;  1QM7 A;  2J8B A;  2JVE A;  1LSI A;  3PLC A;  1MAH F;  4HQP F;  4BDT B;  4BIK B;  2CDX A;  3U74 U;  2MHY A;  1TFS A;  2X8B B;  1BXP A;  2CTX A;  1CRE A;  3HH7 A;  1CTX A;  1NTX A;  1FAS A;  3FEV A;  5IMY C;  1KL8 A;  1COD A;  1DRS A;  1NYU A;  1ONJ A;  4OM5 A;  1JBD A;  1V6P A;  3LAQ U;  2MJY A;  2LCR A;  1KC4 A;  2HLQ A;  4FAO C;  1LXH A;  1IDI A;  2H7Z B;  1IKC A;  1JGK A;  1MR6 A;  1NEA A;  2MJ4 A;  1VB0 A;  1HC9 A;  1FSS B;  3EVS C;  4AEA A;  2H62 D;  1NYS A;  2FD6 U;  1H0J A;  2BHI A;  1CB9 A;  1CDT A;  4P7U A;  1G6M A;  1CHV S;  1NTN A;  1M9Z A;  1B41 B;  1QKD A;  1KBT A;  4LFT A;  1CXO A;  4IYE A;  1TXA A;  2GOO B;  2LA1 A;  2VLW A;  2UWR A;  1CXN A;  3KFD I;  1IDG A;  2HLR A;  1BTE A;  1IJC A;  3U73 U;  1RGJ A;  1IQ9 A;  4FAO E;  1HAJ A;  1KTZ B;  3ERA A;  2ERA A;  2GOO C;  2L03 A;  2UX2 A;  1LX5 B;  1REW C;  3KFD E;  1L4W A;  1CCQ A;  1KBS A;  4ZQY A;  1ZAD A;  1I02 A;  3EBX A;  2H64 B;  2OFS A;  2H62 C;  1CVO A;  1FSC A;  1KS6 A;  2CRS A;  3VTS A;  2JQP A;  2MFA A;  5IMT D;  1TXB A;  1NXB A;  3BT2 U;  1QKE A;  2QJB C;  2H7Z A;  1IDL A;  3QB4 B;  4XJJ A;  2K3G A;  1KU6 B;  6EBX A;  3NH7 A;  2BTX A;  1FFJ A;  2PJY B;  2NBT A;  2N99 A;  1CDR A;  1COE A;  4UY2 C;  1KFH A;  3NDS A;  1YWH A;  1S4Y A;  2MJ0 A;  4RUD A;  1CDQ A;  2PJY C;  1CDS A;  4KSN A;  1F8U B;  1TGX A;  1HOY A;  4QTI U;  1ERG A;  2QJ9 C;  2MUO A;  1ABT A;  4EY8 B;  4OM4 A;  2L5S A;  1LJZ A;  5DZ5 A;  1F94 A;  3NEQ A;  1FF4 A;  5EBX A;  1W6B A;  2CRT A;  2H8U A;  4DO8 A;  1JE9 A;  1PLO A;  2H5F A;  2I9B E;  2H64 C;  1UG4 A;  2QC1 A;  2CCX A;  1LXG A;  1KXI A;  1KBA A;  1HC9 B;  1CRF A;  1ES7 B;  1NOR A;  5DO6 A;  1RL5 A;  1FRA A;  1HAA A;  3BT1 U;  1XT3 A;  1IK8 A; 
#chains in the Genus database with same CATH homology
 1IDH A;  2MUP A;  2ABX A;  2QJA C;  1ERA A;  5DU1 A;  1QM7 A;  2J8B A;  2JVE A;  1LSI A;  3PLC A;  1MAH F;  4HQP F;  4BDT B;  4BIK B;  2CDX A;  3U74 U;  2MHY A;  1TFS A;  2X8B B;  1BXP A;  2CTX A;  1CRE A;  3HH7 A;  1CTX A;  1NTX A;  1FAS A;  3FEV A;  5IMY C;  1KL8 A;  1COD A;  1DRS A;  1NYU A;  1ONJ A;  4OM5 A;  1JBD A;  1V6P A;  3LAQ U;  2MJY A;  2LCR A;  1KC4 A;  2HLQ A;  4FAO C;  1LXH A;  1IDI A;  2H7Z B;  1IKC A;  1JGK A;  1MR6 A;  1NEA A;  2MJ4 A;  1VB0 A;  1HC9 A;  1FSS B;  3EVS C;  4AEA A;  2H62 D;  1NYS A;  2FD6 U;  1H0J A;  2BHI A;  1CB9 A;  1CDT A;  4P7U A;  1G6M A;  1CHV S;  1NTN A;  1M9Z A;  1B41 B;  1QKD A;  1KBT A;  4LFT A;  1CXO A;  4IYE A;  1TXA A;  2GOO B;  2LA1 A;  2VLW A;  2UWR A;  1CXN A;  3KFD I;  1IDG A;  2HLR A;  1BTE A;  1IJC A;  3U73 U;  1RGJ A;  1IQ9 A;  4FAO E;  1HAJ A;  1KTZ B;  3ERA A;  2ERA A;  2GOO C;  2L03 A;  2UX2 A;  1LX5 B;  1REW C;  3KFD E;  1L4W A;  1CCQ A;  1KBS A;  4ZQY A;  1ZAD A;  1I02 A;  3EBX A;  2H64 B;  2OFS A;  2H62 C;  1CVO A;  1FSC A;  1KS6 A;  2CRS A;  3VTS A;  2JQP A;  2MFA A;  5IMT D;  1TXB A;  1NXB A;  3BT2 U;  1QKE A;  2QJB C;  2H7Z A;  1IDL A;  3QB4 B;  4XJJ A;  2K3G A;  1KU6 B;  6EBX A;  3NH7 A;  2BTX A;  1FFJ A;  2PJY B;  2NBT A;  2N99 A;  1CDR A;  1COE A;  4UY2 C;  1KFH A;  3NDS A;  1YWH A;  1S4Y A;  2MJ0 A;  4RUD A;  1CDQ A;  2PJY C;  1CDS A;  4KSN A;  1F8U B;  1TGX A;  1HOY A;  4QTI U;  1ERG A;  2QJ9 C;  2MUO A;  1ABT A;  4EY8 B;  4OM4 A;  2L5S A;  1LJZ A;  5DZ5 A;  1F94 A;  3NEQ A;  1FF4 A;  5EBX A;  1W6B A;  2CRT A;  2H8U A;  4DO8 A;  1JE9 A;  1PLO A;  2H5F A;  2I9B E;  2H64 C;  1UG4 A;  2QC1 A;  2CCX A;  1LXG A;  1KXI A;  1KBA A;  1HC9 B;  1CRF A;  1ES7 B;  1NOR A;  5DO6 A;  1RL5 A;  1FRA A;  1HAA A;  3BT1 U;  1XT3 A;  1IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...