1YWHA

Crystal structure of urokinase plasminogen activator receptor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
279
structure length
268
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase receptor
molecule keywords Urokinase plasminogen activator surface receptor
publication title Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 268
sequence length 279
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA02
1FSSB 2MUOA 2H7ZA 1IDHA 2LCRA 1CHVS 2MUPA 1HC9A 1CTXA 1IDIA 2H8UA 6EBXA 1TXAA 1NXBA 1CDRA 2I9BE 5EBXA 1ABTA 2CRTA 1RGJA 1IJCA 2PJYB 1KU6B 1I02A 2PJYC 3EBXA 2H62D 1S4YA 2HLRA 2MJ0A 1CB9A 1NEAA 2UX2A 1KTZB 4UY2C 1ONJA 1G6MA 1FF4A 1TGXA 2H5FA 2BHIA 3FEVA 1CXOA 1LJZA 2QC1A 1HAAA 4BDTB 4HQPF 1QM7A 1RL5A 2HLQA 2MJYA 1ZADA 2NBTA 1MAHF 2MHYA 3NH7A 2CRSA 2CCXA 1CCQA 1DRSA 5IMYC 4EY8B 1ERGA 1F8UB 1MR6A 5DU1A 1JBDA 3BT1U 2CDXA 2QJ9C 1CXNA 1W6BA 1QKEA 2MFAA 3NEQA 3U73U 1CRFA 3U74U 2MJ4A 2L03A 2VLWA 2ABXA 4IYEA 1LSIA 3HH7A 1KL8A 4OM5A 1KC4A 3PLCA 2H7ZB 2J8BA 2X8BB 5IMTD 1TXBA 1QKDA 1XT3A 1IQ9A 1UG4A 1PLOA 1FSCA 2OFSA 1V6PA 1F94A 1COEA 1HC9B 1NTNA 1KBTA 3KFDI 5DZ5A 1BTEA 4FAOE 3BT2U 1NORA 2H62C 3ERAA 3LAQU 1JGKA 1IKCA 1CDQA 3QB4B 1FRAA 1CDTA 1LX5B 1KBAA 2N99A 1ERAA 1KFHA 1M9ZA 3EVSC 1CODA 4DO8A 1L4WA 1KXIA 1NYUA 2K3GA 2L5SA 4FAOC 3VTSA 2QJAC 4QTIU 1YWHA 2GOOB 1BXPA 1REWC 2ERAA 2GOOC 1CDSA 1KS6A 1VB0A 1H0JA 1NTXA 2LA1A 2JQPA 1HOYA 1B41B 4OM4A 1KBSA 4RUDA 4P7UA 1ES7B 2QJBC 4AEAA 1LXGA 2H64B 3NDSA 2H64C 4XJJA 1IDGA 1TFSA 4ZQYA 4BIKB 1JE9A 2CTXA 1FASA 2FD6U 1LXHA 1IK8A 1CREA 1HAJA 2BTXA 1IDLA 2UWRA 1CVOA 1NYSA 4LFTA 3KFDE 5DO6A 1FFJA 2JVEA
chains in the Genus database with same CATH superfamily
1FSSB 2MUOA 2H7ZA 1IDHA 2LCRA 1CHVS 2MUPA 1HC9A 1CTXA 1IDIA 2H8UA 6EBXA 1TXAA 1NXBA 1CDRA 2I9BE 5EBXA 1ABTA 2CRTA 1RGJA 1IJCA 2PJYB 1KU6B 1I02A 2PJYC 3EBXA 2H62D 1S4YA 2HLRA 2MJ0A 1CB9A 1NEAA 2UX2A 1KTZB 4UY2C 1ONJA 1G6MA 1FF4A 1TGXA 2H5FA 2BHIA 3FEVA 1CXOA 1LJZA 2QC1A 1HAAA 4BDTB 4HQPF 1QM7A 1RL5A 2HLQA 2MJYA 1ZADA 2NBTA 1MAHF 2MHYA 3NH7A 2CRSA 2CCXA 1CCQA 1DRSA 5IMYC 4EY8B 1ERGA 1F8UB 1MR6A 5DU1A 1JBDA 3BT1U 2CDXA 2QJ9C 1CXNA 1W6BA 1QKEA 2MFAA 3NEQA 3U73U 1CRFA 3U74U 2MJ4A 2L03A 2VLWA 2ABXA 4IYEA 1LSIA 3HH7A 1KL8A 4OM5A 1KC4A 3PLCA 2H7ZB 2J8BA 2X8BB 5IMTD 1TXBA 1QKDA 1XT3A 1IQ9A 1UG4A 1PLOA 1FSCA 2OFSA 1V6PA 1F94A 1COEA 1HC9B 1NTNA 4KSNA 1KBTA 3KFDI 5DZ5A 1BTEA 4FAOE 3BT2U 1NORA 2H62C 3ERAA 3LAQU 1JGKA 1IKCA 1CDQA 3QB4B 1FRAA 1CDTA 1LX5B 1KBAA 2N99A 1ERAA 1KFHA 1M9ZA 3EVSC 1CODA 4DO8A 1L4WA 1KXIA 1NYUA 2K3GA 2L5SA 4FAOC 3VTSA 2QJAC 4QTIU 1YWHA 2GOOB 1BXPA 1REWC 2ERAA 2GOOC 1CDSA 1KS6A 1VB0A 1H0JA 1NTXA 2LA1A 2JQPA 1HOYA 1B41B 4OM4A 1KBSA 4RUDA 4P7UA 1ES7B 2QJBC 4AEAA 1LXGA 2H64B 3NDSA 2H64C 4XJJA 1IDGA 1TFSA 4ZQYA 4BIKB 1JE9A 2CTXA 1FASA 2FD6U 1LXHA 1IK8A 1CREA 1HAJA 2BTXA 1IDLA 2UWRA 1CVOA 1NYSA 4LFTA 3KFDE 5DO6A 1FFJA 2JVEA
chains in the Genus database with same CATH topology
1FSSB 2MUOA 2H7ZA 1IDHA 2LCRA 1CHVS 2MUPA 1HC9A 1CTXA 1IDIA 2H8UA 6EBXA 1TXAA 1NXBA 1CDRA 2I9BE 5EBXA 1ABTA 2CRTA 1RGJA 1IJCA 2PJYB 1KU6B 1I02A 2PJYC 3EBXA 2H62D 1S4YA 2HLRA 2MJ0A 1CB9A 1NEAA 2UX2A 1KTZB 4UY2C 1ONJA 1G6MA 1FF4A 1TGXA 2H5FA 2BHIA 3FEVA 1CXOA 1LJZA 2QC1A 1HAAA 4BDTB 4HQPF 1QM7A 1RL5A 2HLQA 2MJYA 1ZADA 2NBTA 1MAHF 2MHYA 3NH7A 2CRSA 2CCXA 1CCQA 1DRSA 5IMYC 4EY8B 1ERGA 1F8UB 1MR6A 5DU1A 1JBDA 3BT1U 2CDXA 2QJ9C 1CXNA 1W6BA 1QKEA 2MFAA 3NEQA 3U73U 1CRFA 3U74U 2MJ4A 2L03A 2VLWA 2ABXA 4IYEA 1LSIA 3HH7A 1KL8A 4OM5A 1KC4A 3PLCA 2H7ZB 2J8BA 2X8BB 5IMTD 1TXBA 1QKDA 1XT3A 1IQ9A 1UG4A 1PLOA 1FSCA 2OFSA 1V6PA 1F94A 1COEA 1HC9B 1NTNA 4KSNA 1KBTA 3KFDI 5DZ5A 1BTEA 4FAOE 3BT2U 1NORA 2H62C 3ERAA 3LAQU 1JGKA 1IKCA 1CDQA 3QB4B 1FRAA 1CDTA 1LX5B 1KBAA 2N99A 1ERAA 1KFHA 1M9ZA 3EVSC 1CODA 4DO8A 1L4WA 1KXIA 1NYUA 2K3GA 2L5SA 4FAOC 3VTSA 2QJAC 4QTIU 1YWHA 2GOOB 1BXPA 1REWC 2ERAA 2GOOC 1CDSA 1KS6A 1VB0A 1H0JA 1NTXA 2LA1A 2JQPA 1HOYA 1B41B 4OM4A 1KBSA 4RUDA 4P7UA 1ES7B 2QJBC 4AEAA 1LXGA 2H64B 3NDSA 2H64C 4XJJA 1IDGA 1TFSA 4ZQYA 4BIKB 1JE9A 2CTXA 1FASA 2FD6U 1LXHA 1IK8A 1CREA 1HAJA 2BTXA 1IDLA 2UWRA 1CVOA 1NYSA 4LFTA 3KFDE 5DO6A 1FFJA 2JVEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSS B;  2MUO A;  2H7Z A;  1IDH A;  2LCR A;  1CHV S;  2MUP A;  1HC9 A;  1CTX A;  1IDI A;  2H8U A;  6EBX A;  1TXA A;  1NXB A;  1CDR A;  2I9B E;  5EBX A;  1ABT A;  2CRT A;  1RGJ A;  1IJC A;  2PJY B;  1KU6 B;  1I02 A;  2PJY C;  3EBX A;  2H62 D;  1S4Y A;  2HLR A;  2MJ0 A;  1CB9 A;  1NEA A;  2UX2 A;  1KTZ B;  4UY2 C;  1ONJ A;  1G6M A;  1FF4 A;  1TGX A;  2H5F A;  2BHI A;  3FEV A;  1CXO A;  1LJZ A;  2QC1 A;  1HAA A;  4BDT B;  4HQP F;  1QM7 A;  1RL5 A;  2HLQ A;  2MJY A;  1ZAD A;  2NBT A;  1MAH F;  2MHY A;  3NH7 A;  2CRS A;  2CCX A;  1CCQ A;  1DRS A;  5IMY C;  4EY8 B;  1ERG A;  1F8U B;  1MR6 A;  5DU1 A;  1JBD A;  3BT1 U;  2CDX A;  2QJ9 C;  1CXN A;  1W6B A;  1QKE A;  2MFA A;  3NEQ A;  3U73 U;  1CRF A;  3U74 U;  2MJ4 A;  2L03 A;  2VLW A;  2ABX A;  4IYE A;  1LSI A;  3HH7 A;  1KL8 A;  4OM5 A;  1KC4 A;  3PLC A;  2H7Z B;  2J8B A;  2X8B B;  5IMT D;  1TXB A;  1QKD A;  1XT3 A;  1IQ9 A;  1UG4 A;  1PLO A;  1FSC A;  2OFS A;  1V6P A;  1F94 A;  1COE A;  1HC9 B;  1NTN A;  1KBT A;  3KFD I;  5DZ5 A;  1BTE A;  4FAO E;  3BT2 U;  1NOR A;  2H62 C;  3ERA A;  3LAQ U;  1JGK A;  1IKC A;  1CDQ A;  3QB4 B;  1FRA A;  1CDT A;  1LX5 B;  1KBA A;  2N99 A;  1ERA A;  1KFH A;  1M9Z A;  3EVS C;  1COD A;  4DO8 A;  1L4W A;  1KXI A;  1NYU A;  2K3G A;  2L5S A;  4FAO C;  3VTS A;  2QJA C;  4QTI U;  1YWH A;  2GOO B;  1BXP A;  1REW C;  2ERA A;  2GOO C;  1CDS A;  1KS6 A;  1VB0 A;  1H0J A;  1NTX A;  2LA1 A;  2JQP A;  1HOY A;  1B41 B;  4OM4 A;  1KBS A;  4RUD A;  4P7U A;  1ES7 B;  2QJB C;  4AEA A;  1LXG A;  2H64 B;  3NDS A;  2H64 C;  4XJJ A;  1IDG A;  1TFS A;  4ZQY A;  4BIK B;  1JE9 A;  2CTX A;  1FAS A;  2FD6 U;  1LXH A;  1IK8 A;  1CRE A;  1HAJ A;  2BTX A;  1IDL A;  2UWR A;  1CVO A;  1NYS A;  4LFT A;  3KFD E;  5DO6 A;  1FFJ A;  2JVE A; 
#chains in the Genus database with same CATH topology
 1FSS B;  2MUO A;  2H7Z A;  1IDH A;  2LCR A;  1CHV S;  2MUP A;  1HC9 A;  1CTX A;  1IDI A;  2H8U A;  6EBX A;  1TXA A;  1NXB A;  1CDR A;  2I9B E;  5EBX A;  1ABT A;  2CRT A;  1RGJ A;  1IJC A;  2PJY B;  1KU6 B;  1I02 A;  2PJY C;  3EBX A;  2H62 D;  1S4Y A;  2HLR A;  2MJ0 A;  1CB9 A;  1NEA A;  2UX2 A;  1KTZ B;  4UY2 C;  1ONJ A;  1G6M A;  1FF4 A;  1TGX A;  2H5F A;  2BHI A;  3FEV A;  1CXO A;  1LJZ A;  2QC1 A;  1HAA A;  4BDT B;  4HQP F;  1QM7 A;  1RL5 A;  2HLQ A;  2MJY A;  1ZAD A;  2NBT A;  1MAH F;  2MHY A;  3NH7 A;  2CRS A;  2CCX A;  1CCQ A;  1DRS A;  5IMY C;  4EY8 B;  1ERG A;  1F8U B;  1MR6 A;  5DU1 A;  1JBD A;  3BT1 U;  2CDX A;  2QJ9 C;  1CXN A;  1W6B A;  1QKE A;  2MFA A;  3NEQ A;  3U73 U;  1CRF A;  3U74 U;  2MJ4 A;  2L03 A;  2VLW A;  2ABX A;  4IYE A;  1LSI A;  3HH7 A;  1KL8 A;  4OM5 A;  1KC4 A;  3PLC A;  2H7Z B;  2J8B A;  2X8B B;  5IMT D;  1TXB A;  1QKD A;  1XT3 A;  1IQ9 A;  1UG4 A;  1PLO A;  1FSC A;  2OFS A;  1V6P A;  1F94 A;  1COE A;  1HC9 B;  1NTN A;  4KSN A;  1KBT A;  3KFD I;  5DZ5 A;  1BTE A;  4FAO E;  3BT2 U;  1NOR A;  2H62 C;  3ERA A;  3LAQ U;  1JGK A;  1IKC A;  1CDQ A;  3QB4 B;  1FRA A;  1CDT A;  1LX5 B;  1KBA A;  2N99 A;  1ERA A;  1KFH A;  1M9Z A;  3EVS C;  1COD A;  4DO8 A;  1L4W A;  1KXI A;  1NYU A;  2K3G A;  2L5S A;  4FAO C;  3VTS A;  2QJA C;  4QTI U;  1YWH A;  2GOO B;  1BXP A;  1REW C;  2ERA A;  2GOO C;  1CDS A;  1KS6 A;  1VB0 A;  1H0J A;  1NTX A;  2LA1 A;  2JQP A;  1HOY A;  1B41 B;  4OM4 A;  1KBS A;  4RUD A;  4P7U A;  1ES7 B;  2QJB C;  4AEA A;  1LXG A;  2H64 B;  3NDS A;  2H64 C;  4XJJ A;  1IDG A;  1TFS A;  4ZQY A;  4BIK B;  1JE9 A;  2CTX A;  1FAS A;  2FD6 U;  1LXH A;  1IK8 A;  1CRE A;  1HAJ A;  2BTX A;  1IDL A;  2UWR A;  1CVO A;  1NYS A;  4LFT A;  3KFD E;  5DO6 A;  1FFJ A;  2JVE A; 
#chains in the Genus database with same CATH homology
 1FSS B;  2MUO A;  2H7Z A;  1IDH A;  2LCR A;  1CHV S;  2MUP A;  1HC9 A;  1CTX A;  1IDI A;  2H8U A;  6EBX A;  1TXA A;  1NXB A;  1CDR A;  2I9B E;  5EBX A;  1ABT A;  2CRT A;  1RGJ A;  1IJC A;  2PJY B;  1KU6 B;  1I02 A;  2PJY C;  3EBX A;  2H62 D;  1S4Y A;  2HLR A;  2MJ0 A;  1CB9 A;  1NEA A;  2UX2 A;  1KTZ B;  4UY2 C;  1ONJ A;  1G6M A;  1FF4 A;  1TGX A;  2H5F A;  2BHI A;  3FEV A;  1CXO A;  1LJZ A;  2QC1 A;  1HAA A;  4BDT B;  4HQP F;  1QM7 A;  1RL5 A;  2HLQ A;  2MJY A;  1ZAD A;  2NBT A;  1MAH F;  2MHY A;  3NH7 A;  2CRS A;  2CCX A;  1CCQ A;  1DRS A;  5IMY C;  4EY8 B;  1ERG A;  1F8U B;  1MR6 A;  5DU1 A;  1JBD A;  3BT1 U;  2CDX A;  2QJ9 C;  1CXN A;  1W6B A;  1QKE A;  2MFA A;  3NEQ A;  3U73 U;  1CRF A;  3U74 U;  2MJ4 A;  2L03 A;  2VLW A;  2ABX A;  4IYE A;  1LSI A;  3HH7 A;  1KL8 A;  4OM5 A;  1KC4 A;  3PLC A;  2H7Z B;  2J8B A;  2X8B B;  5IMT D;  1TXB A;  1QKD A;  1XT3 A;  1IQ9 A;  1UG4 A;  1PLO A;  1FSC A;  2OFS A;  1V6P A;  1F94 A;  1COE A;  1HC9 B;  1NTN A;  4KSN A;  1KBT A;  3KFD I;  5DZ5 A;  1BTE A;  4FAO E;  3BT2 U;  1NOR A;  2H62 C;  3ERA A;  3LAQ U;  1JGK A;  1IKC A;  1CDQ A;  3QB4 B;  1FRA A;  1CDT A;  1LX5 B;  1KBA A;  2N99 A;  1ERA A;  1KFH A;  1M9Z A;  3EVS C;  1COD A;  4DO8 A;  1L4W A;  1KXI A;  1NYU A;  2K3G A;  2L5S A;  4FAO C;  3VTS A;  2QJA C;  4QTI U;  1YWH A;  2GOO B;  1BXP A;  1REW C;  2ERA A;  2GOO C;  1CDS A;  1KS6 A;  1VB0 A;  1H0J A;  1NTX A;  2LA1 A;  2JQP A;  1HOY A;  1B41 B;  4OM4 A;  1KBS A;  4RUD A;  4P7U A;  1ES7 B;  2QJB C;  4AEA A;  1LXG A;  2H64 B;  3NDS A;  2H64 C;  4XJJ A;  1IDG A;  1TFS A;  4ZQY A;  4BIK B;  1JE9 A;  2CTX A;  1FAS A;  2FD6 U;  1LXH A;  1IK8 A;  1CRE A;  1HAJ A;  2BTX A;  1IDL A;  2UWR A;  1CVO A;  1NYS A;  4LFT A;  3KFD E;  5DO6 A;  1FFJ A;  2JVE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...