1YWHA

Crystal structure of urokinase plasminogen activator receptor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
279
structure length
268
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase plasminogen activator surface receptor
publication title Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase receptor
total genus 52
structure length 268
sequence length 279
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA02
1F8UB 1KL8A 2LA1A 2GOOC 4OM4A 3U74U 1HC9A 1LSIA 1NEAA 4LFTA 1H0JA 1HAAA 1NTXA 4BDTB 4FAOC 2CTXA 2CCXA 1CVOA 1KS6A 1KU6B 1IQ9A 1BXPA 2L03A 2UWRA 1ERAA 1RGJA 2PJYB 1IKCA 1CCQA 1CRFA 2H64B 1NYUA 1FSCA 1W6BA 1B41B 2CRTA 1YWHA 2BHIA 2N99A 1CHVS 1TXAA 2LCRA 5DZ5A 3VTSA 2QC1A 1IDGA 4FAOE 2H62C 1FASA 1NTNA 1F94A 2FD6U 4AEAA 1FRAA 1ABTA 3LAQU 1KTZB 1V6PA 2GOOB 2MJ4A 1KFHA 2H62D 1G6MA 1HOYA 1XT3A 1QM7A 1UG4A 2X8BB 4P7UA 2J8BA 2H5FA 4DO8A 2BTXA 2JQPA 2ABXA 1FF4A 3BT1U 1JGKA 4XJJA 5DU1A 3EVSC 6EBXA 1COEA 1JBDA 1ZADA 1JE9A 2H7ZB 1NORA 1I02A 1L4WA 1ONJA 3HH7A 1VB0A 4BIKB 2JVEA 2UX2A 1ERGA 1CB9A 1QKEA 1HAJA 2CDXA 1IDHA 3QB4B 1FSSB 2QJ9C 2MUOA 1CREA 1NYSA 4RUDA 1CXOA 3NEQA 1KC4A 5IMYC 1QKDA 4HQPF 1ES7B 1KXIA 1TFSA 1LXGA 4IYEA 2PJYC 2CRSA 1CTXA 2MHYA 2H64C 2I9BE 2HLRA 1CDQA 2ERAA 1MAHF 1KBAA 1S4YA 3BT2U 3ERAA 5DO6A 2L5SA 4ZQYA 1FFJA 1KBTA 5IMTD 2VLWA 1HC9B 3U73U 1TXBA 3KFDE 2MJYA 2OFSA 1MR6A 4UY2C 2H8UA 1M9ZA 1CDTA 1DRSA 4QTIU 1PLOA 1CODA 3FEVA 1CDSA 2HLQA 1KBSA 3PLCA 1TGXA 1CDRA 1NXBA 1IDIA 2MUPA 2NBTA 1LX5B 2MJ0A 2QJAC 3EBXA 1CXNA 1IDLA 1IJCA 3NDSA 1RL5A 1LJZA 3NH7A 2MFAA 2QJBC 1REWC 4EY8B 3KFDI 4OM5A 2H7ZA 2K3GA 1BTEA 1LXHA 5EBXA 1IK8A
chains in the Genus database with same CATH superfamily
1F8UB 1KL8A 2LA1A 2GOOC 4OM4A 3U74U 1HC9A 1LSIA 1NEAA 4LFTA 1H0JA 1HAAA 1NTXA 4BDTB 4FAOC 2CTXA 2CCXA 1CVOA 1KS6A 1KU6B 1IQ9A 1BXPA 2L03A 2UWRA 1ERAA 1RGJA 2PJYB 1IKCA 1CCQA 1CRFA 2H64B 1NYUA 1FSCA 1W6BA 1B41B 2CRTA 1YWHA 2BHIA 2N99A 1CHVS 1TXAA 2LCRA 5DZ5A 3VTSA 2QC1A 1IDGA 4FAOE 2H62C 1FASA 1NTNA 1F94A 2FD6U 4AEAA 1FRAA 1ABTA 3LAQU 1KTZB 1V6PA 2GOOB 2MJ4A 1KFHA 2H62D 1G6MA 1HOYA 1XT3A 1QM7A 1UG4A 2X8BB 4P7UA 2J8BA 2H5FA 4DO8A 2BTXA 2JQPA 2ABXA 1FF4A 3BT1U 1JGKA 4XJJA 5DU1A 3EVSC 6EBXA 1COEA 1JBDA 1ZADA 1JE9A 2H7ZB 1NORA 1I02A 1L4WA 1ONJA 3HH7A 1VB0A 4BIKB 2JVEA 2UX2A 1ERGA 1CB9A 1QKEA 1HAJA 2CDXA 1IDHA 3QB4B 1FSSB 2QJ9C 2MUOA 1CREA 1NYSA 4RUDA 1CXOA 3NEQA 1KC4A 5IMYC 1QKDA 4HQPF 1ES7B 1KXIA 1TFSA 1LXGA 4IYEA 2PJYC 2CRSA 1CTXA 2MHYA 2H64C 2I9BE 2HLRA 1CDQA 2ERAA 1MAHF 1KBAA 1S4YA 3BT2U 3ERAA 5DO6A 2L5SA 4ZQYA 1FFJA 1KBTA 5IMTD 2VLWA 1HC9B 3U73U 1TXBA 3KFDE 2MJYA 2OFSA 1MR6A 4UY2C 2H8UA 1M9ZA 1CDTA 1DRSA 4QTIU 1PLOA 4KSNA 1CODA 3FEVA 1CDSA 2HLQA 1KBSA 3PLCA 1TGXA 1CDRA 1NXBA 1IDIA 2MUPA 2NBTA 1LX5B 2MJ0A 2QJAC 3EBXA 1CXNA 1IDLA 1IJCA 3NDSA 1RL5A 1LJZA 3NH7A 2MFAA 2QJBC 1REWC 4EY8B 3KFDI 4OM5A 2H7ZA 2K3GA 1BTEA 1LXHA 5EBXA 1IK8A
chains in the Genus database with same CATH topology
1F8UB 1KL8A 2LA1A 2GOOC 4OM4A 3U74U 1HC9A 1LSIA 1NEAA 4LFTA 1H0JA 1HAAA 1NTXA 4BDTB 4FAOC 2CTXA 2CCXA 1CVOA 1KS6A 1KU6B 1IQ9A 1BXPA 2L03A 2UWRA 1ERAA 1RGJA 2PJYB 1IKCA 1CCQA 1CRFA 2H64B 1NYUA 1FSCA 1W6BA 1B41B 2CRTA 1YWHA 2BHIA 2N99A 1CHVS 1TXAA 2LCRA 5DZ5A 3VTSA 2QC1A 1IDGA 4FAOE 2H62C 1FASA 1NTNA 1F94A 2FD6U 4AEAA 1FRAA 1ABTA 3LAQU 1KTZB 1V6PA 2GOOB 2MJ4A 1KFHA 2H62D 1G6MA 1HOYA 1XT3A 1QM7A 1UG4A 2X8BB 4P7UA 2J8BA 2H5FA 4DO8A 2BTXA 2JQPA 2ABXA 1FF4A 3BT1U 1JGKA 4XJJA 5DU1A 3EVSC 6EBXA 1COEA 1JBDA 1ZADA 1JE9A 2H7ZB 1NORA 1I02A 1L4WA 1ONJA 3HH7A 1VB0A 4BIKB 2JVEA 2UX2A 1ERGA 1CB9A 1QKEA 1HAJA 2CDXA 1IDHA 3QB4B 1FSSB 2QJ9C 2MUOA 1CREA 1NYSA 4RUDA 1CXOA 3NEQA 1KC4A 5IMYC 1QKDA 4HQPF 1ES7B 1KXIA 1TFSA 1LXGA 4IYEA 2PJYC 2CRSA 1CTXA 2MHYA 2H64C 2I9BE 2HLRA 1CDQA 2ERAA 1MAHF 1KBAA 1S4YA 3BT2U 3ERAA 5DO6A 2L5SA 4ZQYA 1FFJA 1KBTA 5IMTD 2VLWA 1HC9B 3U73U 1TXBA 3KFDE 2MJYA 2OFSA 1MR6A 4UY2C 2H8UA 1M9ZA 1CDTA 1DRSA 4QTIU 1PLOA 4KSNA 1CODA 3FEVA 1CDSA 2HLQA 1KBSA 3PLCA 1TGXA 1CDRA 1NXBA 1IDIA 2MUPA 2NBTA 1LX5B 2MJ0A 2QJAC 3EBXA 1CXNA 1IDLA 1IJCA 3NDSA 1RL5A 1LJZA 3NH7A 2MFAA 2QJBC 1REWC 4EY8B 3KFDI 4OM5A 2H7ZA 2K3GA 1BTEA 1LXHA 5EBXA 1IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8U B;  1KL8 A;  2LA1 A;  2GOO C;  4OM4 A;  3U74 U;  1HC9 A;  1LSI A;  1NEA A;  4LFT A;  1H0J A;  1HAA A;  1NTX A;  4BDT B;  4FAO C;  2CTX A;  2CCX A;  1CVO A;  1KS6 A;  1KU6 B;  1IQ9 A;  1BXP A;  2L03 A;  2UWR A;  1ERA A;  1RGJ A;  2PJY B;  1IKC A;  1CCQ A;  1CRF A;  2H64 B;  1NYU A;  1FSC A;  1W6B A;  1B41 B;  2CRT A;  1YWH A;  2BHI A;  2N99 A;  1CHV S;  1TXA A;  2LCR A;  5DZ5 A;  3VTS A;  2QC1 A;  1IDG A;  4FAO E;  2H62 C;  1FAS A;  1NTN A;  1F94 A;  2FD6 U;  4AEA A;  1FRA A;  1ABT A;  3LAQ U;  1KTZ B;  1V6P A;  2GOO B;  2MJ4 A;  1KFH A;  2H62 D;  1G6M A;  1HOY A;  1XT3 A;  1QM7 A;  1UG4 A;  2X8B B;  4P7U A;  2J8B A;  2H5F A;  4DO8 A;  2BTX A;  2JQP A;  2ABX A;  1FF4 A;  3BT1 U;  1JGK A;  4XJJ A;  5DU1 A;  3EVS C;  6EBX A;  1COE A;  1JBD A;  1ZAD A;  1JE9 A;  2H7Z B;  1NOR A;  1I02 A;  1L4W A;  1ONJ A;  3HH7 A;  1VB0 A;  4BIK B;  2JVE A;  2UX2 A;  1ERG A;  1CB9 A;  1QKE A;  1HAJ A;  2CDX A;  1IDH A;  3QB4 B;  1FSS B;  2QJ9 C;  2MUO A;  1CRE A;  1NYS A;  4RUD A;  1CXO A;  3NEQ A;  1KC4 A;  5IMY C;  1QKD A;  4HQP F;  1ES7 B;  1KXI A;  1TFS A;  1LXG A;  4IYE A;  2PJY C;  2CRS A;  1CTX A;  2MHY A;  2H64 C;  2I9B E;  2HLR A;  1CDQ A;  2ERA A;  1MAH F;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A;  5DO6 A;  2L5S A;  4ZQY A;  1FFJ A;  1KBT A;  5IMT D;  2VLW A;  1HC9 B;  3U73 U;  1TXB A;  3KFD E;  2MJY A;  2OFS A;  1MR6 A;  4UY2 C;  2H8U A;  1M9Z A;  1CDT A;  1DRS A;  4QTI U;  1PLO A;  1COD A;  3FEV A;  1CDS A;  2HLQ A;  1KBS A;  3PLC A;  1TGX A;  1CDR A;  1NXB A;  1IDI A;  2MUP A;  2NBT A;  1LX5 B;  2MJ0 A;  2QJA C;  3EBX A;  1CXN A;  1IDL A;  1IJC A;  3NDS A;  1RL5 A;  1LJZ A;  3NH7 A;  2MFA A;  2QJB C;  1REW C;  4EY8 B;  3KFD I;  4OM5 A;  2H7Z A;  2K3G A;  1BTE A;  1LXH A;  5EBX A;  1IK8 A; 
#chains in the Genus database with same CATH topology
 1F8U B;  1KL8 A;  2LA1 A;  2GOO C;  4OM4 A;  3U74 U;  1HC9 A;  1LSI A;  1NEA A;  4LFT A;  1H0J A;  1HAA A;  1NTX A;  4BDT B;  4FAO C;  2CTX A;  2CCX A;  1CVO A;  1KS6 A;  1KU6 B;  1IQ9 A;  1BXP A;  2L03 A;  2UWR A;  1ERA A;  1RGJ A;  2PJY B;  1IKC A;  1CCQ A;  1CRF A;  2H64 B;  1NYU A;  1FSC A;  1W6B A;  1B41 B;  2CRT A;  1YWH A;  2BHI A;  2N99 A;  1CHV S;  1TXA A;  2LCR A;  5DZ5 A;  3VTS A;  2QC1 A;  1IDG A;  4FAO E;  2H62 C;  1FAS A;  1NTN A;  1F94 A;  2FD6 U;  4AEA A;  1FRA A;  1ABT A;  3LAQ U;  1KTZ B;  1V6P A;  2GOO B;  2MJ4 A;  1KFH A;  2H62 D;  1G6M A;  1HOY A;  1XT3 A;  1QM7 A;  1UG4 A;  2X8B B;  4P7U A;  2J8B A;  2H5F A;  4DO8 A;  2BTX A;  2JQP A;  2ABX A;  1FF4 A;  3BT1 U;  1JGK A;  4XJJ A;  5DU1 A;  3EVS C;  6EBX A;  1COE A;  1JBD A;  1ZAD A;  1JE9 A;  2H7Z B;  1NOR A;  1I02 A;  1L4W A;  1ONJ A;  3HH7 A;  1VB0 A;  4BIK B;  2JVE A;  2UX2 A;  1ERG A;  1CB9 A;  1QKE A;  1HAJ A;  2CDX A;  1IDH A;  3QB4 B;  1FSS B;  2QJ9 C;  2MUO A;  1CRE A;  1NYS A;  4RUD A;  1CXO A;  3NEQ A;  1KC4 A;  5IMY C;  1QKD A;  4HQP F;  1ES7 B;  1KXI A;  1TFS A;  1LXG A;  4IYE A;  2PJY C;  2CRS A;  1CTX A;  2MHY A;  2H64 C;  2I9B E;  2HLR A;  1CDQ A;  2ERA A;  1MAH F;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A;  5DO6 A;  2L5S A;  4ZQY A;  1FFJ A;  1KBT A;  5IMT D;  2VLW A;  1HC9 B;  3U73 U;  1TXB A;  3KFD E;  2MJY A;  2OFS A;  1MR6 A;  4UY2 C;  2H8U A;  1M9Z A;  1CDT A;  1DRS A;  4QTI U;  1PLO A;  4KSN A;  1COD A;  3FEV A;  1CDS A;  2HLQ A;  1KBS A;  3PLC A;  1TGX A;  1CDR A;  1NXB A;  1IDI A;  2MUP A;  2NBT A;  1LX5 B;  2MJ0 A;  2QJA C;  3EBX A;  1CXN A;  1IDL A;  1IJC A;  3NDS A;  1RL5 A;  1LJZ A;  3NH7 A;  2MFA A;  2QJB C;  1REW C;  4EY8 B;  3KFD I;  4OM5 A;  2H7Z A;  2K3G A;  1BTE A;  1LXH A;  5EBX A;  1IK8 A; 
#chains in the Genus database with same CATH homology
 1F8U B;  1KL8 A;  2LA1 A;  2GOO C;  4OM4 A;  3U74 U;  1HC9 A;  1LSI A;  1NEA A;  4LFT A;  1H0J A;  1HAA A;  1NTX A;  4BDT B;  4FAO C;  2CTX A;  2CCX A;  1CVO A;  1KS6 A;  1KU6 B;  1IQ9 A;  1BXP A;  2L03 A;  2UWR A;  1ERA A;  1RGJ A;  2PJY B;  1IKC A;  1CCQ A;  1CRF A;  2H64 B;  1NYU A;  1FSC A;  1W6B A;  1B41 B;  2CRT A;  1YWH A;  2BHI A;  2N99 A;  1CHV S;  1TXA A;  2LCR A;  5DZ5 A;  3VTS A;  2QC1 A;  1IDG A;  4FAO E;  2H62 C;  1FAS A;  1NTN A;  1F94 A;  2FD6 U;  4AEA A;  1FRA A;  1ABT A;  3LAQ U;  1KTZ B;  1V6P A;  2GOO B;  2MJ4 A;  1KFH A;  2H62 D;  1G6M A;  1HOY A;  1XT3 A;  1QM7 A;  1UG4 A;  2X8B B;  4P7U A;  2J8B A;  2H5F A;  4DO8 A;  2BTX A;  2JQP A;  2ABX A;  1FF4 A;  3BT1 U;  1JGK A;  4XJJ A;  5DU1 A;  3EVS C;  6EBX A;  1COE A;  1JBD A;  1ZAD A;  1JE9 A;  2H7Z B;  1NOR A;  1I02 A;  1L4W A;  1ONJ A;  3HH7 A;  1VB0 A;  4BIK B;  2JVE A;  2UX2 A;  1ERG A;  1CB9 A;  1QKE A;  1HAJ A;  2CDX A;  1IDH A;  3QB4 B;  1FSS B;  2QJ9 C;  2MUO A;  1CRE A;  1NYS A;  4RUD A;  1CXO A;  3NEQ A;  1KC4 A;  5IMY C;  1QKD A;  4HQP F;  1ES7 B;  1KXI A;  1TFS A;  1LXG A;  4IYE A;  2PJY C;  2CRS A;  1CTX A;  2MHY A;  2H64 C;  2I9B E;  2HLR A;  1CDQ A;  2ERA A;  1MAH F;  1KBA A;  1S4Y A;  3BT2 U;  3ERA A;  5DO6 A;  2L5S A;  4ZQY A;  1FFJ A;  1KBT A;  5IMT D;  2VLW A;  1HC9 B;  3U73 U;  1TXB A;  3KFD E;  2MJY A;  2OFS A;  1MR6 A;  4UY2 C;  2H8U A;  1M9Z A;  1CDT A;  1DRS A;  4QTI U;  1PLO A;  4KSN A;  1COD A;  3FEV A;  1CDS A;  2HLQ A;  1KBS A;  3PLC A;  1TGX A;  1CDR A;  1NXB A;  1IDI A;  2MUP A;  2NBT A;  1LX5 B;  2MJ0 A;  2QJA C;  3EBX A;  1CXN A;  1IDL A;  1IJC A;  3NDS A;  1RL5 A;  1LJZ A;  3NH7 A;  2MFA A;  2QJB C;  1REW C;  4EY8 B;  3KFD I;  4OM5 A;  2H7Z A;  2K3G A;  1BTE A;  1LXH A;  5EBX A;  1IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...