1YWHA

Crystal structure of urokinase plasminogen activator receptor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
279
structure length
268
Chain Sequence
LRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGQSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the human urokinase plasminogen activator receptor bound to an antagonist peptide
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase receptor
molecule keywords Urokinase plasminogen activator surface receptor
total genus 52
structure length 268
sequence length 279
chains with identical sequence C, E, G, I, K, M, O
ec nomenclature
pdb deposition date 2005-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ywhA02
1IK8A 2PJYB 2H7ZA 2H64B 5DO6A 1FRAA 1CHVS 1YWHA 1QM7A 2H8UA 1PLOA 2MFAA 1FSSB 1ZADA 3EVSC 1FF4A 1KBSA 2CRSA 3EBXA 1VB0A 1LSIA 2QJBC 2JQPA 1COEA 3LAQU 4RUDA 1KU6B 1LXGA 1UG4A 2ABXA 2CRTA 3QB4B 1CCQA 1CXOA 1FSCA 1NEAA 1CB9A 1G6MA 1KBAA 2LA1A 3PLCA 4AEAA 4FAOC 1NYSA 3FEVA 2MJ0A 1ERAA 1KL8A 1FASA 4FAOE 1HAJA 1NTXA 4IYEA 2FD6U 4BIKB 6EBXA 2QC1A 3BT1U 4EY8B 1HC9B 1TGXA 5DZ5A 4BDTB 1MR6A 1CDTA 1LJZA 2QJ9C 2ERAA 1IKCA 2L5SA 2UX2A 2GOOB 1RL5A 3HH7A 2HLQA 2H64C 4ZQYA 5EBXA 1CODA 1W6BA 3NDSA 1KS6A 1V6PA 3BT2U 2LCRA 2NBTA 1CTXA 2K3GA 2L03A 1I02A 2CTXA 1KTZB 1NTNA 3U74U 1KC4A 1ONJA 1IDIA 1TXAA 1CDQA 2HLRA 1NYUA 1B41B 4DO8A 2OFSA 1NORA 2GOOC 2MUOA 1IDLA 5DU1A 2VLWA 1CRFA 3ERAA 1ERGA 1XT3A 2H62C 2N99A 1FFJA 1DRSA 2JVEA 1H0JA 2J8BA 1F8UB 4OM5A 2H7ZB 1NXBA 1M9ZA 2I9BE 2MUPA 2UWRA 3KFDI 2CDXA 3KFDE 1CVOA 1RGJA 1IJCA 1TXBA 2H5FA 2MJYA 2BHIA 1HAAA 2MJ4A 1KFHA 1ES7B 4LFTA 1MAHF 5IMTD 4P7UA 1QKDA 1ABTA 1BTEA 1LX5B 2QJAC 1CDRA 4OM4A 1JBDA 1L4WA 1S4YA 1QKEA 2H62D 1CDSA 1IDGA 1KBTA 4HQPF 2PJYC 2BTXA 1REWC 1CREA 4UY2C 3VTSA 3NH7A 1TFSA 1F94A 3U73U 1LXHA 5IMYC 1HOYA 1JGKA 4QTIU 1KXIA 2X8BB 3NEQA 1HC9A 1IDHA 1JE9A 1IQ9A 1CXNA 1BXPA 2MHYA 4XJJA 2CCXA
chains in the Genus database with same CATH superfamily
1IK8A 2PJYB 2H7ZA 2H64B 5DO6A 1FRAA 4KSNA 1CHVS 1YWHA 1QM7A 2H8UA 1PLOA 2MFAA 1FSSB 1ZADA 3EVSC 1FF4A 1KBSA 2CRSA 3EBXA 1VB0A 1LSIA 2QJBC 2JQPA 1COEA 3LAQU 4RUDA 1KU6B 1LXGA 1UG4A 2ABXA 2CRTA 3QB4B 1CCQA 1CXOA 1FSCA 1NEAA 1CB9A 1G6MA 1KBAA 2LA1A 3PLCA 4AEAA 4FAOC 1NYSA 3FEVA 2MJ0A 1ERAA 1KL8A 1FASA 4FAOE 1HAJA 1NTXA 4IYEA 2FD6U 4BIKB 6EBXA 2QC1A 3BT1U 4EY8B 1HC9B 1TGXA 5DZ5A 4BDTB 1MR6A 1CDTA 1LJZA 2QJ9C 2ERAA 1IKCA 2L5SA 2UX2A 2GOOB 1RL5A 3HH7A 2HLQA 2H64C 4ZQYA 5EBXA 1CODA 1W6BA 3NDSA 1KS6A 1V6PA 3BT2U 2LCRA 2NBTA 1CTXA 2K3GA 2L03A 1I02A 2CTXA 1KTZB 1NTNA 3U74U 1KC4A 1ONJA 1IDIA 1TXAA 1CDQA 2HLRA 1NYUA 1B41B 4DO8A 2OFSA 1NORA 2GOOC 2MUOA 1IDLA 5DU1A 2VLWA 1CRFA 3ERAA 1ERGA 1XT3A 2H62C 2N99A 1FFJA 1DRSA 2JVEA 1H0JA 2J8BA 1F8UB 4OM5A 2H7ZB 1NXBA 1M9ZA 2I9BE 2MUPA 2UWRA 3KFDI 2CDXA 3KFDE 1CVOA 1RGJA 1IJCA 1TXBA 2H5FA 2MJYA 2BHIA 1HAAA 2MJ4A 1KFHA 1ES7B 4LFTA 1MAHF 5IMTD 4P7UA 1QKDA 1ABTA 1BTEA 1LX5B 2QJAC 1CDRA 4OM4A 1JBDA 1L4WA 1S4YA 1QKEA 2H62D 1CDSA 1IDGA 1KBTA 4HQPF 2PJYC 2BTXA 1REWC 1CREA 4UY2C 3VTSA 3NH7A 1TFSA 1F94A 3U73U 1LXHA 5IMYC 1HOYA 1JGKA 4QTIU 1KXIA 2X8BB 3NEQA 1HC9A 1IDHA 1JE9A 1IQ9A 1CXNA 1BXPA 2MHYA 4XJJA 2CCXA
chains in the Genus database with same CATH topology
1IK8A 2PJYB 2H7ZA 2H64B 5DO6A 1FRAA 4KSNA 1CHVS 1YWHA 1QM7A 2H8UA 1PLOA 2MFAA 1FSSB 1ZADA 3EVSC 1FF4A 1KBSA 2CRSA 3EBXA 1VB0A 1LSIA 2QJBC 2JQPA 1COEA 3LAQU 4RUDA 1KU6B 1LXGA 1UG4A 2ABXA 2CRTA 3QB4B 1CCQA 1CXOA 1FSCA 1NEAA 1CB9A 1G6MA 1KBAA 2LA1A 3PLCA 4AEAA 4FAOC 1NYSA 3FEVA 2MJ0A 1ERAA 1KL8A 1FASA 4FAOE 1HAJA 1NTXA 4IYEA 2FD6U 4BIKB 6EBXA 2QC1A 3BT1U 4EY8B 1HC9B 1TGXA 5DZ5A 4BDTB 1MR6A 1CDTA 1LJZA 2QJ9C 2ERAA 1IKCA 2L5SA 2UX2A 2GOOB 1RL5A 3HH7A 2HLQA 2H64C 4ZQYA 5EBXA 1CODA 1W6BA 3NDSA 1KS6A 1V6PA 3BT2U 2LCRA 2NBTA 1CTXA 2K3GA 2L03A 1I02A 2CTXA 1KTZB 1NTNA 3U74U 1KC4A 1ONJA 1IDIA 1TXAA 1CDQA 2HLRA 1NYUA 1B41B 4DO8A 2OFSA 1NORA 2GOOC 2MUOA 1IDLA 5DU1A 2VLWA 1CRFA 3ERAA 1ERGA 1XT3A 2H62C 2N99A 1FFJA 1DRSA 2JVEA 1H0JA 2J8BA 1F8UB 4OM5A 2H7ZB 1NXBA 1M9ZA 2I9BE 2MUPA 2UWRA 3KFDI 2CDXA 3KFDE 1CVOA 1RGJA 1IJCA 1TXBA 2H5FA 2MJYA 2BHIA 1HAAA 2MJ4A 1KFHA 1ES7B 4LFTA 1MAHF 5IMTD 4P7UA 1QKDA 1ABTA 1BTEA 1LX5B 2QJAC 1CDRA 4OM4A 1JBDA 1L4WA 1S4YA 1QKEA 2H62D 1CDSA 1IDGA 1KBTA 4HQPF 2PJYC 2BTXA 1REWC 1CREA 4UY2C 3VTSA 3NH7A 1TFSA 1F94A 3U73U 1LXHA 5IMYC 1HOYA 1JGKA 4QTIU 1KXIA 2X8BB 3NEQA 1HC9A 1IDHA 1JE9A 1IQ9A 1CXNA 1BXPA 2MHYA 4XJJA 2CCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IK8 A;  2PJY B;  2H7Z A;  2H64 B;  5DO6 A;  1FRA A;  1CHV S;  1YWH A;  1QM7 A;  2H8U A;  1PLO A;  2MFA A;  1FSS B;  1ZAD A;  3EVS C;  1FF4 A;  1KBS A;  2CRS A;  3EBX A;  1VB0 A;  1LSI A;  2QJB C;  2JQP A;  1COE A;  3LAQ U;  4RUD A;  1KU6 B;  1LXG A;  1UG4 A;  2ABX A;  2CRT A;  3QB4 B;  1CCQ A;  1CXO A;  1FSC A;  1NEA A;  1CB9 A;  1G6M A;  1KBA A;  2LA1 A;  3PLC A;  4AEA A;  4FAO C;  1NYS A;  3FEV A;  2MJ0 A;  1ERA A;  1KL8 A;  1FAS A;  4FAO E;  1HAJ A;  1NTX A;  4IYE A;  2FD6 U;  4BIK B;  6EBX A;  2QC1 A;  3BT1 U;  4EY8 B;  1HC9 B;  1TGX A;  5DZ5 A;  4BDT B;  1MR6 A;  1CDT A;  1LJZ A;  2QJ9 C;  2ERA A;  1IKC A;  2L5S A;  2UX2 A;  2GOO B;  1RL5 A;  3HH7 A;  2HLQ A;  2H64 C;  4ZQY A;  5EBX A;  1COD A;  1W6B A;  3NDS A;  1KS6 A;  1V6P A;  3BT2 U;  2LCR A;  2NBT A;  1CTX A;  2K3G A;  2L03 A;  1I02 A;  2CTX A;  1KTZ B;  1NTN A;  3U74 U;  1KC4 A;  1ONJ A;  1IDI A;  1TXA A;  1CDQ A;  2HLR A;  1NYU A;  1B41 B;  4DO8 A;  2OFS A;  1NOR A;  2GOO C;  2MUO A;  1IDL A;  5DU1 A;  2VLW A;  1CRF A;  3ERA A;  1ERG A;  1XT3 A;  2H62 C;  2N99 A;  1FFJ A;  1DRS A;  2JVE A;  1H0J A;  2J8B A;  1F8U B;  4OM5 A;  2H7Z B;  1NXB A;  1M9Z A;  2I9B E;  2MUP A;  2UWR A;  3KFD I;  2CDX A;  3KFD E;  1CVO A;  1RGJ A;  1IJC A;  1TXB A;  2H5F A;  2MJY A;  2BHI A;  1HAA A;  2MJ4 A;  1KFH A;  1ES7 B;  4LFT A;  1MAH F;  5IMT D;  4P7U A;  1QKD A;  1ABT A;  1BTE A;  1LX5 B;  2QJA C;  1CDR A;  4OM4 A;  1JBD A;  1L4W A;  1S4Y A;  1QKE A;  2H62 D;  1CDS A;  1IDG A;  1KBT A;  4HQP F;  2PJY C;  2BTX A;  1REW C;  1CRE A;  4UY2 C;  3VTS A;  3NH7 A;  1TFS A;  1F94 A;  3U73 U;  1LXH A;  5IMY C;  1HOY A;  1JGK A;  4QTI U;  1KXI A;  2X8B B;  3NEQ A;  1HC9 A;  1IDH A;  1JE9 A;  1IQ9 A;  1CXN A;  1BXP A;  2MHY A;  4XJJ A;  2CCX A; 
#chains in the Genus database with same CATH topology
 1IK8 A;  2PJY B;  2H7Z A;  2H64 B;  5DO6 A;  1FRA A;  4KSN A;  1CHV S;  1YWH A;  1QM7 A;  2H8U A;  1PLO A;  2MFA A;  1FSS B;  1ZAD A;  3EVS C;  1FF4 A;  1KBS A;  2CRS A;  3EBX A;  1VB0 A;  1LSI A;  2QJB C;  2JQP A;  1COE A;  3LAQ U;  4RUD A;  1KU6 B;  1LXG A;  1UG4 A;  2ABX A;  2CRT A;  3QB4 B;  1CCQ A;  1CXO A;  1FSC A;  1NEA A;  1CB9 A;  1G6M A;  1KBA A;  2LA1 A;  3PLC A;  4AEA A;  4FAO C;  1NYS A;  3FEV A;  2MJ0 A;  1ERA A;  1KL8 A;  1FAS A;  4FAO E;  1HAJ A;  1NTX A;  4IYE A;  2FD6 U;  4BIK B;  6EBX A;  2QC1 A;  3BT1 U;  4EY8 B;  1HC9 B;  1TGX A;  5DZ5 A;  4BDT B;  1MR6 A;  1CDT A;  1LJZ A;  2QJ9 C;  2ERA A;  1IKC A;  2L5S A;  2UX2 A;  2GOO B;  1RL5 A;  3HH7 A;  2HLQ A;  2H64 C;  4ZQY A;  5EBX A;  1COD A;  1W6B A;  3NDS A;  1KS6 A;  1V6P A;  3BT2 U;  2LCR A;  2NBT A;  1CTX A;  2K3G A;  2L03 A;  1I02 A;  2CTX A;  1KTZ B;  1NTN A;  3U74 U;  1KC4 A;  1ONJ A;  1IDI A;  1TXA A;  1CDQ A;  2HLR A;  1NYU A;  1B41 B;  4DO8 A;  2OFS A;  1NOR A;  2GOO C;  2MUO A;  1IDL A;  5DU1 A;  2VLW A;  1CRF A;  3ERA A;  1ERG A;  1XT3 A;  2H62 C;  2N99 A;  1FFJ A;  1DRS A;  2JVE A;  1H0J A;  2J8B A;  1F8U B;  4OM5 A;  2H7Z B;  1NXB A;  1M9Z A;  2I9B E;  2MUP A;  2UWR A;  3KFD I;  2CDX A;  3KFD E;  1CVO A;  1RGJ A;  1IJC A;  1TXB A;  2H5F A;  2MJY A;  2BHI A;  1HAA A;  2MJ4 A;  1KFH A;  1ES7 B;  4LFT A;  1MAH F;  5IMT D;  4P7U A;  1QKD A;  1ABT A;  1BTE A;  1LX5 B;  2QJA C;  1CDR A;  4OM4 A;  1JBD A;  1L4W A;  1S4Y A;  1QKE A;  2H62 D;  1CDS A;  1IDG A;  1KBT A;  4HQP F;  2PJY C;  2BTX A;  1REW C;  1CRE A;  4UY2 C;  3VTS A;  3NH7 A;  1TFS A;  1F94 A;  3U73 U;  1LXH A;  5IMY C;  1HOY A;  1JGK A;  4QTI U;  1KXI A;  2X8B B;  3NEQ A;  1HC9 A;  1IDH A;  1JE9 A;  1IQ9 A;  1CXN A;  1BXP A;  2MHY A;  4XJJ A;  2CCX A; 
#chains in the Genus database with same CATH homology
 1IK8 A;  2PJY B;  2H7Z A;  2H64 B;  5DO6 A;  1FRA A;  4KSN A;  1CHV S;  1YWH A;  1QM7 A;  2H8U A;  1PLO A;  2MFA A;  1FSS B;  1ZAD A;  3EVS C;  1FF4 A;  1KBS A;  2CRS A;  3EBX A;  1VB0 A;  1LSI A;  2QJB C;  2JQP A;  1COE A;  3LAQ U;  4RUD A;  1KU6 B;  1LXG A;  1UG4 A;  2ABX A;  2CRT A;  3QB4 B;  1CCQ A;  1CXO A;  1FSC A;  1NEA A;  1CB9 A;  1G6M A;  1KBA A;  2LA1 A;  3PLC A;  4AEA A;  4FAO C;  1NYS A;  3FEV A;  2MJ0 A;  1ERA A;  1KL8 A;  1FAS A;  4FAO E;  1HAJ A;  1NTX A;  4IYE A;  2FD6 U;  4BIK B;  6EBX A;  2QC1 A;  3BT1 U;  4EY8 B;  1HC9 B;  1TGX A;  5DZ5 A;  4BDT B;  1MR6 A;  1CDT A;  1LJZ A;  2QJ9 C;  2ERA A;  1IKC A;  2L5S A;  2UX2 A;  2GOO B;  1RL5 A;  3HH7 A;  2HLQ A;  2H64 C;  4ZQY A;  5EBX A;  1COD A;  1W6B A;  3NDS A;  1KS6 A;  1V6P A;  3BT2 U;  2LCR A;  2NBT A;  1CTX A;  2K3G A;  2L03 A;  1I02 A;  2CTX A;  1KTZ B;  1NTN A;  3U74 U;  1KC4 A;  1ONJ A;  1IDI A;  1TXA A;  1CDQ A;  2HLR A;  1NYU A;  1B41 B;  4DO8 A;  2OFS A;  1NOR A;  2GOO C;  2MUO A;  1IDL A;  5DU1 A;  2VLW A;  1CRF A;  3ERA A;  1ERG A;  1XT3 A;  2H62 C;  2N99 A;  1FFJ A;  1DRS A;  2JVE A;  1H0J A;  2J8B A;  1F8U B;  4OM5 A;  2H7Z B;  1NXB A;  1M9Z A;  2I9B E;  2MUP A;  2UWR A;  3KFD I;  2CDX A;  3KFD E;  1CVO A;  1RGJ A;  1IJC A;  1TXB A;  2H5F A;  2MJY A;  2BHI A;  1HAA A;  2MJ4 A;  1KFH A;  1ES7 B;  4LFT A;  1MAH F;  5IMT D;  4P7U A;  1QKD A;  1ABT A;  1BTE A;  1LX5 B;  2QJA C;  1CDR A;  4OM4 A;  1JBD A;  1L4W A;  1S4Y A;  1QKE A;  2H62 D;  1CDS A;  1IDG A;  1KBT A;  4HQP F;  2PJY C;  2BTX A;  1REW C;  1CRE A;  4UY2 C;  3VTS A;  3NH7 A;  1TFS A;  1F94 A;  3U73 U;  1LXH A;  5IMY C;  1HOY A;  1JGK A;  4QTI U;  1KXI A;  2X8B B;  3NEQ A;  1HC9 A;  1IDH A;  1JE9 A;  1IQ9 A;  1CXN A;  1BXP A;  2MHY A;  4XJJ A;  2CCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...