1L4WA

Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-Bungarotoxin
publication title The mechanism for acetylcholine receptor inhibition by alpha-neurotoxins and species-specific resistance to alpha-bungarotoxin revealed by NMR.
pubmed doi rcsb
molecule tags Receptor, toxin
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1l4wA00
3VTSA 1ZADA 2ABXA 1RGJA 1ABTA 1KFHA 1VB0A 2CRSA 4OM5A 2H62C 4RUDA 2MFAA 1LXGA 1NYUA 2CRTA 1M9ZA 2MJ0A 2OFSA 4ZQYA 1DRSA 2QJBC 1CDRA 1JE9A 3HH7A 1CCQA 1FF4A 1NTXA 2MUOA 3PLCA 1V6PA 2JVEA 3U73U 2H64B 2MHYA 3NH7A 1IK8A 1KU6B 2CCXA 1ONJA 1HAJA 1NYSA 3QB4B 1NXBA 1CDTA 1UG4A 2H8UA 3KFDI 1CXOA 1FSSB 4P7UA 5DO6A 2VLWA 1KBTA 1JGKA 2ERAA 1G6MA 1S4YA 1CXNA 1CREA 4AEAA 2N99A 4LFTA 1CRFA 2J8BA 2H7ZA 3ERAA 1L4WA 4XJJA 1IKCA 3EVSC 1IDIA 2H64C 1ES7B 4OM4A 4IYEA 1KTZB 1ERGA 1NTNA 1CODA 1KC4A 2H5FA 1YWHA 1CDSA 1LSIA 1QKEA 1TXAA 1MAHF 2BHIA 1CHVS 1FRAA 1HOYA 2H7ZB 1NEAA 1F94A 1JBDA 1HC9A 1HAAA 1CDQA 4BDTB 2QC1A 2PJYC 5DU1A 2FD6U 3LAQU 1LX5B 1FASA 1TGXA 2K3GA 4FAOC 5IMYC 6EBXA 1KXIA 1LXHA 1IDGA 3NDSA 1FSCA 1W6BA 5DZ5A 1ERAA 1H0JA 1IDLA 2MJYA 2PJYB 1KS6A 4QTIU 1BTEA 2L5SA 2HLRA 2I9BE 1MR6A 1KL8A 1QM7A 4BIKB 2JQPA 1RL5A 2GOOC 2MUPA 2NBTA 1CTXA 1F8UB 1BXPA 1KBAA 1IQ9A 1CVOA 1KBSA 3NEQA 2UWRA 2GOOB 1TFSA 1REWC 1XT3A 4FAOE 2QJ9C 1COEA 1IDHA 1IJCA 2LCRA 1NORA 1TXBA 3KFDE 1HC9B 3FEVA 2L03A 2X8BB 2LA1A 2UX2A 1QKDA 1B41B 3BT1U 5EBXA 2MJ4A 3U74U 4EY8B 1LJZA 1PLOA 2HLQA 4DO8A 2QJAC 5IMTD 3BT2U 4HQPF 2H62D 3EBXA 1CB9A 4UY2C 1FFJA 2CDXA 1I02A 2CTXA 2BTXA
chains in the Genus database with same CATH superfamily
3VTSA 1ZADA 2ABXA 1RGJA 1ABTA 1KFHA 1VB0A 2CRSA 4OM5A 2H62C 4RUDA 2MFAA 1LXGA 1NYUA 2CRTA 1M9ZA 2MJ0A 2OFSA 4ZQYA 1DRSA 2QJBC 1CDRA 1JE9A 3HH7A 1CCQA 1FF4A 1NTXA 2MUOA 3PLCA 1V6PA 2JVEA 3U73U 2H64B 2MHYA 3NH7A 1IK8A 1KU6B 2CCXA 1ONJA 1HAJA 1NYSA 3QB4B 1NXBA 1CDTA 1UG4A 2H8UA 3KFDI 1CXOA 1FSSB 4P7UA 5DO6A 2VLWA 1KBTA 1JGKA 2ERAA 1G6MA 1S4YA 1CXNA 1CREA 4AEAA 2N99A 4LFTA 1CRFA 2J8BA 2H7ZA 3ERAA 1L4WA 4XJJA 1IKCA 3EVSC 1IDIA 2H64C 1ES7B 4OM4A 4IYEA 1KTZB 1ERGA 1NTNA 1CODA 1KC4A 2H5FA 1YWHA 1CDSA 1LSIA 1QKEA 1TXAA 1MAHF 2BHIA 1CHVS 1FRAA 1HOYA 2H7ZB 1NEAA 1F94A 1JBDA 1HC9A 1HAAA 1CDQA 4BDTB 2QC1A 2PJYC 5DU1A 2FD6U 3LAQU 1LX5B 1FASA 1TGXA 2K3GA 4FAOC 5IMYC 6EBXA 1KXIA 1LXHA 1IDGA 3NDSA 1FSCA 1W6BA 5DZ5A 1ERAA 1H0JA 1IDLA 2MJYA 2PJYB 1KS6A 4QTIU 1BTEA 2L5SA 2HLRA 2I9BE 1MR6A 1KL8A 1QM7A 4BIKB 2JQPA 1RL5A 2GOOC 2MUPA 2NBTA 1CTXA 1F8UB 1BXPA 1KBAA 1IQ9A 1CVOA 1KBSA 3NEQA 2UWRA 2GOOB 1TFSA 1REWC 1XT3A 4FAOE 2QJ9C 1COEA 1IDHA 1IJCA 2LCRA 1NORA 1TXBA 3KFDE 1HC9B 3FEVA 2L03A 2X8BB 2LA1A 2UX2A 1QKDA 1B41B 3BT1U 4KSNA 5EBXA 2MJ4A 3U74U 4EY8B 1LJZA 1PLOA 2HLQA 4DO8A 2QJAC 5IMTD 3BT2U 4HQPF 2H62D 3EBXA 1CB9A 4UY2C 1FFJA 2CDXA 1I02A 2CTXA 2BTXA
chains in the Genus database with same CATH topology
3VTSA 1ZADA 2ABXA 1RGJA 1ABTA 1KFHA 1VB0A 2CRSA 4OM5A 2H62C 4RUDA 2MFAA 1LXGA 1NYUA 2CRTA 1M9ZA 2MJ0A 2OFSA 4ZQYA 1DRSA 2QJBC 1CDRA 1JE9A 3HH7A 1CCQA 1FF4A 1NTXA 2MUOA 3PLCA 1V6PA 2JVEA 3U73U 2H64B 2MHYA 3NH7A 1IK8A 1KU6B 2CCXA 1ONJA 1HAJA 1NYSA 3QB4B 1NXBA 1CDTA 1UG4A 2H8UA 3KFDI 1CXOA 1FSSB 4P7UA 5DO6A 2VLWA 1KBTA 1JGKA 2ERAA 1G6MA 1S4YA 1CXNA 1CREA 4AEAA 2N99A 4LFTA 1CRFA 2J8BA 2H7ZA 3ERAA 1L4WA 4XJJA 1IKCA 3EVSC 1IDIA 2H64C 1ES7B 4OM4A 4IYEA 1KTZB 1ERGA 1NTNA 1CODA 1KC4A 2H5FA 1YWHA 1CDSA 1LSIA 1QKEA 1TXAA 1MAHF 2BHIA 1CHVS 1FRAA 1HOYA 2H7ZB 1NEAA 1F94A 1JBDA 1HC9A 1HAAA 1CDQA 4BDTB 2QC1A 2PJYC 5DU1A 2FD6U 3LAQU 1LX5B 1FASA 1TGXA 2K3GA 4FAOC 5IMYC 6EBXA 1KXIA 1LXHA 1IDGA 3NDSA 1FSCA 1W6BA 5DZ5A 1ERAA 1H0JA 1IDLA 2MJYA 2PJYB 1KS6A 4QTIU 1BTEA 2L5SA 2HLRA 2I9BE 1MR6A 1KL8A 1QM7A 4BIKB 2JQPA 1RL5A 2GOOC 2MUPA 2NBTA 1CTXA 1F8UB 1BXPA 1KBAA 1IQ9A 1CVOA 1KBSA 3NEQA 2UWRA 2GOOB 1TFSA 1REWC 1XT3A 4FAOE 2QJ9C 1COEA 1IDHA 1IJCA 2LCRA 1NORA 1TXBA 3KFDE 1HC9B 3FEVA 2L03A 2X8BB 2LA1A 2UX2A 1QKDA 1B41B 3BT1U 4KSNA 5EBXA 2MJ4A 3U74U 4EY8B 1LJZA 1PLOA 2HLQA 4DO8A 2QJAC 5IMTD 3BT2U 4HQPF 2H62D 3EBXA 1CB9A 4UY2C 1FFJA 2CDXA 1I02A 2CTXA 2BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTS A;  1ZAD A;  2ABX A;  1RGJ A;  1ABT A;  1KFH A;  1VB0 A;  2CRS A;  4OM5 A;  2H62 C;  4RUD A;  2MFA A;  1LXG A;  1NYU A;  2CRT A;  1M9Z A;  2MJ0 A;  2OFS A;  4ZQY A;  1DRS A;  2QJB C;  1CDR A;  1JE9 A;  3HH7 A;  1CCQ A;  1FF4 A;  1NTX A;  2MUO A;  3PLC A;  1V6P A;  2JVE A;  3U73 U;  2H64 B;  2MHY A;  3NH7 A;  1IK8 A;  1KU6 B;  2CCX A;  1ONJ A;  1HAJ A;  1NYS A;  3QB4 B;  1NXB A;  1CDT A;  1UG4 A;  2H8U A;  3KFD I;  1CXO A;  1FSS B;  4P7U A;  5DO6 A;  2VLW A;  1KBT A;  1JGK A;  2ERA A;  1G6M A;  1S4Y A;  1CXN A;  1CRE A;  4AEA A;  2N99 A;  4LFT A;  1CRF A;  2J8B A;  2H7Z A;  3ERA A;  1L4W A;  4XJJ A;  1IKC A;  3EVS C;  1IDI A;  2H64 C;  1ES7 B;  4OM4 A;  4IYE A;  1KTZ B;  1ERG A;  1NTN A;  1COD A;  1KC4 A;  2H5F A;  1YWH A;  1CDS A;  1LSI A;  1QKE A;  1TXA A;  1MAH F;  2BHI A;  1CHV S;  1FRA A;  1HOY A;  2H7Z B;  1NEA A;  1F94 A;  1JBD A;  1HC9 A;  1HAA A;  1CDQ A;  4BDT B;  2QC1 A;  2PJY C;  5DU1 A;  2FD6 U;  3LAQ U;  1LX5 B;  1FAS A;  1TGX A;  2K3G A;  4FAO C;  5IMY C;  6EBX A;  1KXI A;  1LXH A;  1IDG A;  3NDS A;  1FSC A;  1W6B A;  5DZ5 A;  1ERA A;  1H0J A;  1IDL A;  2MJY A;  2PJY B;  1KS6 A;  4QTI U;  1BTE A;  2L5S A;  2HLR A;  2I9B E;  1MR6 A;  1KL8 A;  1QM7 A;  4BIK B;  2JQP A;  1RL5 A;  2GOO C;  2MUP A;  2NBT A;  1CTX A;  1F8U B;  1BXP A;  1KBA A;  1IQ9 A;  1CVO A;  1KBS A;  3NEQ A;  2UWR A;  2GOO B;  1TFS A;  1REW C;  1XT3 A;  4FAO E;  2QJ9 C;  1COE A;  1IDH A;  1IJC A;  2LCR A;  1NOR A;  1TXB A;  3KFD E;  1HC9 B;  3FEV A;  2L03 A;  2X8B B;  2LA1 A;  2UX2 A;  1QKD A;  1B41 B;  3BT1 U;  5EBX A;  2MJ4 A;  3U74 U;  4EY8 B;  1LJZ A;  1PLO A;  2HLQ A;  4DO8 A;  2QJA C;  5IMT D;  3BT2 U;  4HQP F;  2H62 D;  3EBX A;  1CB9 A;  4UY2 C;  1FFJ A;  2CDX A;  1I02 A;  2CTX A;  2BTX A; 
#chains in the Genus database with same CATH topology
 3VTS A;  1ZAD A;  2ABX A;  1RGJ A;  1ABT A;  1KFH A;  1VB0 A;  2CRS A;  4OM5 A;  2H62 C;  4RUD A;  2MFA A;  1LXG A;  1NYU A;  2CRT A;  1M9Z A;  2MJ0 A;  2OFS A;  4ZQY A;  1DRS A;  2QJB C;  1CDR A;  1JE9 A;  3HH7 A;  1CCQ A;  1FF4 A;  1NTX A;  2MUO A;  3PLC A;  1V6P A;  2JVE A;  3U73 U;  2H64 B;  2MHY A;  3NH7 A;  1IK8 A;  1KU6 B;  2CCX A;  1ONJ A;  1HAJ A;  1NYS A;  3QB4 B;  1NXB A;  1CDT A;  1UG4 A;  2H8U A;  3KFD I;  1CXO A;  1FSS B;  4P7U A;  5DO6 A;  2VLW A;  1KBT A;  1JGK A;  2ERA A;  1G6M A;  1S4Y A;  1CXN A;  1CRE A;  4AEA A;  2N99 A;  4LFT A;  1CRF A;  2J8B A;  2H7Z A;  3ERA A;  1L4W A;  4XJJ A;  1IKC A;  3EVS C;  1IDI A;  2H64 C;  1ES7 B;  4OM4 A;  4IYE A;  1KTZ B;  1ERG A;  1NTN A;  1COD A;  1KC4 A;  2H5F A;  1YWH A;  1CDS A;  1LSI A;  1QKE A;  1TXA A;  1MAH F;  2BHI A;  1CHV S;  1FRA A;  1HOY A;  2H7Z B;  1NEA A;  1F94 A;  1JBD A;  1HC9 A;  1HAA A;  1CDQ A;  4BDT B;  2QC1 A;  2PJY C;  5DU1 A;  2FD6 U;  3LAQ U;  1LX5 B;  1FAS A;  1TGX A;  2K3G A;  4FAO C;  5IMY C;  6EBX A;  1KXI A;  1LXH A;  1IDG A;  3NDS A;  1FSC A;  1W6B A;  5DZ5 A;  1ERA A;  1H0J A;  1IDL A;  2MJY A;  2PJY B;  1KS6 A;  4QTI U;  1BTE A;  2L5S A;  2HLR A;  2I9B E;  1MR6 A;  1KL8 A;  1QM7 A;  4BIK B;  2JQP A;  1RL5 A;  2GOO C;  2MUP A;  2NBT A;  1CTX A;  1F8U B;  1BXP A;  1KBA A;  1IQ9 A;  1CVO A;  1KBS A;  3NEQ A;  2UWR A;  2GOO B;  1TFS A;  1REW C;  1XT3 A;  4FAO E;  2QJ9 C;  1COE A;  1IDH A;  1IJC A;  2LCR A;  1NOR A;  1TXB A;  3KFD E;  1HC9 B;  3FEV A;  2L03 A;  2X8B B;  2LA1 A;  2UX2 A;  1QKD A;  1B41 B;  3BT1 U;  4KSN A;  5EBX A;  2MJ4 A;  3U74 U;  4EY8 B;  1LJZ A;  1PLO A;  2HLQ A;  4DO8 A;  2QJA C;  5IMT D;  3BT2 U;  4HQP F;  2H62 D;  3EBX A;  1CB9 A;  4UY2 C;  1FFJ A;  2CDX A;  1I02 A;  2CTX A;  2BTX A; 
#chains in the Genus database with same CATH homology
 3VTS A;  1ZAD A;  2ABX A;  1RGJ A;  1ABT A;  1KFH A;  1VB0 A;  2CRS A;  4OM5 A;  2H62 C;  4RUD A;  2MFA A;  1LXG A;  1NYU A;  2CRT A;  1M9Z A;  2MJ0 A;  2OFS A;  4ZQY A;  1DRS A;  2QJB C;  1CDR A;  1JE9 A;  3HH7 A;  1CCQ A;  1FF4 A;  1NTX A;  2MUO A;  3PLC A;  1V6P A;  2JVE A;  3U73 U;  2H64 B;  2MHY A;  3NH7 A;  1IK8 A;  1KU6 B;  2CCX A;  1ONJ A;  1HAJ A;  1NYS A;  3QB4 B;  1NXB A;  1CDT A;  1UG4 A;  2H8U A;  3KFD I;  1CXO A;  1FSS B;  4P7U A;  5DO6 A;  2VLW A;  1KBT A;  1JGK A;  2ERA A;  1G6M A;  1S4Y A;  1CXN A;  1CRE A;  4AEA A;  2N99 A;  4LFT A;  1CRF A;  2J8B A;  2H7Z A;  3ERA A;  1L4W A;  4XJJ A;  1IKC A;  3EVS C;  1IDI A;  2H64 C;  1ES7 B;  4OM4 A;  4IYE A;  1KTZ B;  1ERG A;  1NTN A;  1COD A;  1KC4 A;  2H5F A;  1YWH A;  1CDS A;  1LSI A;  1QKE A;  1TXA A;  1MAH F;  2BHI A;  1CHV S;  1FRA A;  1HOY A;  2H7Z B;  1NEA A;  1F94 A;  1JBD A;  1HC9 A;  1HAA A;  1CDQ A;  4BDT B;  2QC1 A;  2PJY C;  5DU1 A;  2FD6 U;  3LAQ U;  1LX5 B;  1FAS A;  1TGX A;  2K3G A;  4FAO C;  5IMY C;  6EBX A;  1KXI A;  1LXH A;  1IDG A;  3NDS A;  1FSC A;  1W6B A;  5DZ5 A;  1ERA A;  1H0J A;  1IDL A;  2MJY A;  2PJY B;  1KS6 A;  4QTI U;  1BTE A;  2L5S A;  2HLR A;  2I9B E;  1MR6 A;  1KL8 A;  1QM7 A;  4BIK B;  2JQP A;  1RL5 A;  2GOO C;  2MUP A;  2NBT A;  1CTX A;  1F8U B;  1BXP A;  1KBA A;  1IQ9 A;  1CVO A;  1KBS A;  3NEQ A;  2UWR A;  2GOO B;  1TFS A;  1REW C;  1XT3 A;  4FAO E;  2QJ9 C;  1COE A;  1IDH A;  1IJC A;  2LCR A;  1NOR A;  1TXB A;  3KFD E;  1HC9 B;  3FEV A;  2L03 A;  2X8B B;  2LA1 A;  2UX2 A;  1QKD A;  1B41 B;  3BT1 U;  4KSN A;  5EBX A;  2MJ4 A;  3U74 U;  4EY8 B;  1LJZ A;  1PLO A;  2HLQ A;  4DO8 A;  2QJA C;  5IMT D;  3BT2 U;  4HQP F;  2H62 D;  3EBX A;  1CB9 A;  4UY2 C;  1FFJ A;  2CDX A;  1I02 A;  2CTX A;  2BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...