1L4WA

Nmr structure of an achr-peptide (torpedo californica, alpha-subunit residues 182-202) in complex with alpha-bungarotoxin
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The mechanism for acetylcholine receptor inhibition by alpha-neurotoxins and species-specific resistance to alpha-bungarotoxin revealed by NMR.
pubmed doi rcsb
molecule tags Receptor, toxin
molecule keywords alpha-Bungarotoxin
total genus 10
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1l4wA00
1LSIA 1CREA 1IQ9A 3KFDE 1IKCA 1KBAA 1FRAA 3LAQU 3NEQA 1IDIA 1ZADA 1CXOA 2MUOA 2J8BA 1RL5A 2H7ZB 1CDTA 2CRSA 1LXHA 1KXIA 4HQPF 2H8UA 2QJAC 1JBDA 1IDLA 1IJCA 2H64B 3EBXA 3BT1U 2H5FA 1CCQA 1IDGA 1CDRA 1H0JA 2CDXA 2K3GA 6EBXA 2MJ0A 1HC9B 2BHIA 3EVSC 1DRSA 2CRTA 4OM5A 4AEAA 1IK8A 1S4YA 1ONJA 2MFAA 1QKDA 4EY8B 1NXBA 1BXPA 3FEVA 1ERAA 1LJZA 2ERAA 2LCRA 4QTIU 1NTXA 3HH7A 1KBTA 2NBTA 2ABXA 2JVEA 2UWRA 4FAOC 3PLCA 2MJYA 1RGJA 1I02A 1FSCA 3VTSA 2N99A 1TXBA 1TGXA 1TXAA 1ERGA 2MUPA 1PLOA 1L4WA 1NTNA 2CTXA 1B41B 4BDTB 2MHYA 1NORA 1NYSA 2JQPA 2PJYB 3ERAA 5IMTD 1CTXA 4FAOE 1LX5B 2HLRA 1TFSA 3NDSA 2GOOC 1M9ZA 1IDHA 3KFDI 1KC4A 1ES7B 2H62C 5DZ5A 1BTEA 2QJBC 1FSSB 1COEA 1KL8A 1NYUA 5DU1A 4ZQYA 1QM7A 4RUDA 2LA1A 4DO8A 2L5SA 1JE9A 5IMYC 1MR6A 1CHVS 2BTXA 1REWC 2FD6U 4IYEA 1CB9A 3BT2U 1VB0A 2OFSA 5DO6A 1KU6B 2H62D 5EBXA 1JGKA 1FASA 3U73U 4P7UA 1MAHF 1HC9A 1G6MA 2QC1A 1HAJA 1LXGA 1CDSA 2H64C 1W6BA 1F94A 4LFTA 1ABTA 1V6PA 4OM4A 1FFJA 2HLQA 1CXNA 4BIKB 2I9BE 1CDQA 1NEAA 2GOOB 2X8BB 4XJJA 1F8UB 1YWHA 1CODA 1KBSA 2L03A 2MJ4A 3U74U 2PJYC 4UY2C 2UX2A 2H7ZA 1KTZB 3NH7A 3QB4B 1CVOA 1QKEA 1FF4A 1UG4A 1XT3A 1HOYA 1CRFA 1HAAA 1KFHA 2VLWA 2QJ9C 2CCXA 1KS6A
chains in the Genus database with same CATH superfamily
1LSIA 1CREA 1IQ9A 3KFDE 4KSNA 1IKCA 1KBAA 1FRAA 3LAQU 3NEQA 1IDIA 1ZADA 1CXOA 2MUOA 2J8BA 1RL5A 2H7ZB 1CDTA 2CRSA 1LXHA 1KXIA 4HQPF 2H8UA 2QJAC 1JBDA 1IDLA 1IJCA 2H64B 3EBXA 3BT1U 2H5FA 1CCQA 1IDGA 1CDRA 1H0JA 2CDXA 2K3GA 6EBXA 2MJ0A 1HC9B 2BHIA 3EVSC 1DRSA 2CRTA 4OM5A 4AEAA 1IK8A 1S4YA 1ONJA 2MFAA 1QKDA 4EY8B 1NXBA 1BXPA 3FEVA 1ERAA 1LJZA 2ERAA 2LCRA 4QTIU 1NTXA 3HH7A 1KBTA 2NBTA 2ABXA 2JVEA 2UWRA 4FAOC 3PLCA 2MJYA 1RGJA 1I02A 1FSCA 3VTSA 2N99A 1TXBA 1TGXA 1TXAA 1ERGA 2MUPA 1PLOA 1L4WA 1NTNA 2CTXA 1B41B 4BDTB 2MHYA 1NORA 1NYSA 2JQPA 2PJYB 3ERAA 5IMTD 1CTXA 4FAOE 1LX5B 2HLRA 1TFSA 3NDSA 2GOOC 1M9ZA 1IDHA 3KFDI 1KC4A 1ES7B 2H62C 5DZ5A 1BTEA 2QJBC 1FSSB 1COEA 1KL8A 1NYUA 5DU1A 4ZQYA 1QM7A 4RUDA 2LA1A 4DO8A 2L5SA 1JE9A 5IMYC 1MR6A 1CHVS 2BTXA 1REWC 2FD6U 4IYEA 1CB9A 3BT2U 1VB0A 2OFSA 5DO6A 1KU6B 2H62D 5EBXA 1JGKA 1FASA 3U73U 4P7UA 1MAHF 1HC9A 1G6MA 2QC1A 1HAJA 1LXGA 1CDSA 2H64C 1W6BA 1F94A 4LFTA 1ABTA 1V6PA 4OM4A 1FFJA 2HLQA 1CXNA 4BIKB 2I9BE 1CDQA 1NEAA 2GOOB 2X8BB 4XJJA 1F8UB 1YWHA 1CODA 1KBSA 2L03A 2MJ4A 3U74U 2PJYC 4UY2C 2UX2A 2H7ZA 1KTZB 3NH7A 3QB4B 1CVOA 1QKEA 1FF4A 1UG4A 1XT3A 1HOYA 1CRFA 1HAAA 1KFHA 2VLWA 2QJ9C 2CCXA 1KS6A
chains in the Genus database with same CATH topology
1LSIA 1CREA 1IQ9A 3KFDE 4KSNA 1IKCA 1KBAA 1FRAA 3LAQU 3NEQA 1IDIA 1ZADA 1CXOA 2MUOA 2J8BA 1RL5A 2H7ZB 1CDTA 2CRSA 1LXHA 1KXIA 4HQPF 2H8UA 2QJAC 1JBDA 1IDLA 1IJCA 2H64B 3EBXA 3BT1U 2H5FA 1CCQA 1IDGA 1CDRA 1H0JA 2CDXA 2K3GA 6EBXA 2MJ0A 1HC9B 2BHIA 3EVSC 1DRSA 2CRTA 4OM5A 4AEAA 1IK8A 1S4YA 1ONJA 2MFAA 1QKDA 4EY8B 1NXBA 1BXPA 3FEVA 1ERAA 1LJZA 2ERAA 2LCRA 4QTIU 1NTXA 3HH7A 1KBTA 2NBTA 2ABXA 2JVEA 2UWRA 4FAOC 3PLCA 2MJYA 1RGJA 1I02A 1FSCA 3VTSA 2N99A 1TXBA 1TGXA 1TXAA 1ERGA 2MUPA 1PLOA 1L4WA 1NTNA 2CTXA 1B41B 4BDTB 2MHYA 1NORA 1NYSA 2JQPA 2PJYB 3ERAA 5IMTD 1CTXA 4FAOE 1LX5B 2HLRA 1TFSA 3NDSA 2GOOC 1M9ZA 1IDHA 3KFDI 1KC4A 1ES7B 2H62C 5DZ5A 1BTEA 2QJBC 1FSSB 1COEA 1KL8A 1NYUA 5DU1A 4ZQYA 1QM7A 4RUDA 2LA1A 4DO8A 2L5SA 1JE9A 5IMYC 1MR6A 1CHVS 2BTXA 1REWC 2FD6U 4IYEA 1CB9A 3BT2U 1VB0A 2OFSA 5DO6A 1KU6B 2H62D 5EBXA 1JGKA 1FASA 3U73U 4P7UA 1MAHF 1HC9A 1G6MA 2QC1A 1HAJA 1LXGA 1CDSA 2H64C 1W6BA 1F94A 4LFTA 1ABTA 1V6PA 4OM4A 1FFJA 2HLQA 1CXNA 4BIKB 2I9BE 1CDQA 1NEAA 2GOOB 2X8BB 4XJJA 1F8UB 1YWHA 1CODA 1KBSA 2L03A 2MJ4A 3U74U 2PJYC 4UY2C 2UX2A 2H7ZA 1KTZB 3NH7A 3QB4B 1CVOA 1QKEA 1FF4A 1UG4A 1XT3A 1HOYA 1CRFA 1HAAA 1KFHA 2VLWA 2QJ9C 2CCXA 1KS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LSI A;  1CRE A;  1IQ9 A;  3KFD E;  1IKC A;  1KBA A;  1FRA A;  3LAQ U;  3NEQ A;  1IDI A;  1ZAD A;  1CXO A;  2MUO A;  2J8B A;  1RL5 A;  2H7Z B;  1CDT A;  2CRS A;  1LXH A;  1KXI A;  4HQP F;  2H8U A;  2QJA C;  1JBD A;  1IDL A;  1IJC A;  2H64 B;  3EBX A;  3BT1 U;  2H5F A;  1CCQ A;  1IDG A;  1CDR A;  1H0J A;  2CDX A;  2K3G A;  6EBX A;  2MJ0 A;  1HC9 B;  2BHI A;  3EVS C;  1DRS A;  2CRT A;  4OM5 A;  4AEA A;  1IK8 A;  1S4Y A;  1ONJ A;  2MFA A;  1QKD A;  4EY8 B;  1NXB A;  1BXP A;  3FEV A;  1ERA A;  1LJZ A;  2ERA A;  2LCR A;  4QTI U;  1NTX A;  3HH7 A;  1KBT A;  2NBT A;  2ABX A;  2JVE A;  2UWR A;  4FAO C;  3PLC A;  2MJY A;  1RGJ A;  1I02 A;  1FSC A;  3VTS A;  2N99 A;  1TXB A;  1TGX A;  1TXA A;  1ERG A;  2MUP A;  1PLO A;  1L4W A;  1NTN A;  2CTX A;  1B41 B;  4BDT B;  2MHY A;  1NOR A;  1NYS A;  2JQP A;  2PJY B;  3ERA A;  5IMT D;  1CTX A;  4FAO E;  1LX5 B;  2HLR A;  1TFS A;  3NDS A;  2GOO C;  1M9Z A;  1IDH A;  3KFD I;  1KC4 A;  1ES7 B;  2H62 C;  5DZ5 A;  1BTE A;  2QJB C;  1FSS B;  1COE A;  1KL8 A;  1NYU A;  5DU1 A;  4ZQY A;  1QM7 A;  4RUD A;  2LA1 A;  4DO8 A;  2L5S A;  1JE9 A;  5IMY C;  1MR6 A;  1CHV S;  2BTX A;  1REW C;  2FD6 U;  4IYE A;  1CB9 A;  3BT2 U;  1VB0 A;  2OFS A;  5DO6 A;  1KU6 B;  2H62 D;  5EBX A;  1JGK A;  1FAS A;  3U73 U;  4P7U A;  1MAH F;  1HC9 A;  1G6M A;  2QC1 A;  1HAJ A;  1LXG A;  1CDS A;  2H64 C;  1W6B A;  1F94 A;  4LFT A;  1ABT A;  1V6P A;  4OM4 A;  1FFJ A;  2HLQ A;  1CXN A;  4BIK B;  2I9B E;  1CDQ A;  1NEA A;  2GOO B;  2X8B B;  4XJJ A;  1F8U B;  1YWH A;  1COD A;  1KBS A;  2L03 A;  2MJ4 A;  3U74 U;  2PJY C;  4UY2 C;  2UX2 A;  2H7Z A;  1KTZ B;  3NH7 A;  3QB4 B;  1CVO A;  1QKE A;  1FF4 A;  1UG4 A;  1XT3 A;  1HOY A;  1CRF A;  1HAA A;  1KFH A;  2VLW A;  2QJ9 C;  2CCX A;  1KS6 A; 
#chains in the Genus database with same CATH topology
 1LSI A;  1CRE A;  1IQ9 A;  3KFD E;  4KSN A;  1IKC A;  1KBA A;  1FRA A;  3LAQ U;  3NEQ A;  1IDI A;  1ZAD A;  1CXO A;  2MUO A;  2J8B A;  1RL5 A;  2H7Z B;  1CDT A;  2CRS A;  1LXH A;  1KXI A;  4HQP F;  2H8U A;  2QJA C;  1JBD A;  1IDL A;  1IJC A;  2H64 B;  3EBX A;  3BT1 U;  2H5F A;  1CCQ A;  1IDG A;  1CDR A;  1H0J A;  2CDX A;  2K3G A;  6EBX A;  2MJ0 A;  1HC9 B;  2BHI A;  3EVS C;  1DRS A;  2CRT A;  4OM5 A;  4AEA A;  1IK8 A;  1S4Y A;  1ONJ A;  2MFA A;  1QKD A;  4EY8 B;  1NXB A;  1BXP A;  3FEV A;  1ERA A;  1LJZ A;  2ERA A;  2LCR A;  4QTI U;  1NTX A;  3HH7 A;  1KBT A;  2NBT A;  2ABX A;  2JVE A;  2UWR A;  4FAO C;  3PLC A;  2MJY A;  1RGJ A;  1I02 A;  1FSC A;  3VTS A;  2N99 A;  1TXB A;  1TGX A;  1TXA A;  1ERG A;  2MUP A;  1PLO A;  1L4W A;  1NTN A;  2CTX A;  1B41 B;  4BDT B;  2MHY A;  1NOR A;  1NYS A;  2JQP A;  2PJY B;  3ERA A;  5IMT D;  1CTX A;  4FAO E;  1LX5 B;  2HLR A;  1TFS A;  3NDS A;  2GOO C;  1M9Z A;  1IDH A;  3KFD I;  1KC4 A;  1ES7 B;  2H62 C;  5DZ5 A;  1BTE A;  2QJB C;  1FSS B;  1COE A;  1KL8 A;  1NYU A;  5DU1 A;  4ZQY A;  1QM7 A;  4RUD A;  2LA1 A;  4DO8 A;  2L5S A;  1JE9 A;  5IMY C;  1MR6 A;  1CHV S;  2BTX A;  1REW C;  2FD6 U;  4IYE A;  1CB9 A;  3BT2 U;  1VB0 A;  2OFS A;  5DO6 A;  1KU6 B;  2H62 D;  5EBX A;  1JGK A;  1FAS A;  3U73 U;  4P7U A;  1MAH F;  1HC9 A;  1G6M A;  2QC1 A;  1HAJ A;  1LXG A;  1CDS A;  2H64 C;  1W6B A;  1F94 A;  4LFT A;  1ABT A;  1V6P A;  4OM4 A;  1FFJ A;  2HLQ A;  1CXN A;  4BIK B;  2I9B E;  1CDQ A;  1NEA A;  2GOO B;  2X8B B;  4XJJ A;  1F8U B;  1YWH A;  1COD A;  1KBS A;  2L03 A;  2MJ4 A;  3U74 U;  2PJY C;  4UY2 C;  2UX2 A;  2H7Z A;  1KTZ B;  3NH7 A;  3QB4 B;  1CVO A;  1QKE A;  1FF4 A;  1UG4 A;  1XT3 A;  1HOY A;  1CRF A;  1HAA A;  1KFH A;  2VLW A;  2QJ9 C;  2CCX A;  1KS6 A; 
#chains in the Genus database with same CATH homology
 1LSI A;  1CRE A;  1IQ9 A;  3KFD E;  4KSN A;  1IKC A;  1KBA A;  1FRA A;  3LAQ U;  3NEQ A;  1IDI A;  1ZAD A;  1CXO A;  2MUO A;  2J8B A;  1RL5 A;  2H7Z B;  1CDT A;  2CRS A;  1LXH A;  1KXI A;  4HQP F;  2H8U A;  2QJA C;  1JBD A;  1IDL A;  1IJC A;  2H64 B;  3EBX A;  3BT1 U;  2H5F A;  1CCQ A;  1IDG A;  1CDR A;  1H0J A;  2CDX A;  2K3G A;  6EBX A;  2MJ0 A;  1HC9 B;  2BHI A;  3EVS C;  1DRS A;  2CRT A;  4OM5 A;  4AEA A;  1IK8 A;  1S4Y A;  1ONJ A;  2MFA A;  1QKD A;  4EY8 B;  1NXB A;  1BXP A;  3FEV A;  1ERA A;  1LJZ A;  2ERA A;  2LCR A;  4QTI U;  1NTX A;  3HH7 A;  1KBT A;  2NBT A;  2ABX A;  2JVE A;  2UWR A;  4FAO C;  3PLC A;  2MJY A;  1RGJ A;  1I02 A;  1FSC A;  3VTS A;  2N99 A;  1TXB A;  1TGX A;  1TXA A;  1ERG A;  2MUP A;  1PLO A;  1L4W A;  1NTN A;  2CTX A;  1B41 B;  4BDT B;  2MHY A;  1NOR A;  1NYS A;  2JQP A;  2PJY B;  3ERA A;  5IMT D;  1CTX A;  4FAO E;  1LX5 B;  2HLR A;  1TFS A;  3NDS A;  2GOO C;  1M9Z A;  1IDH A;  3KFD I;  1KC4 A;  1ES7 B;  2H62 C;  5DZ5 A;  1BTE A;  2QJB C;  1FSS B;  1COE A;  1KL8 A;  1NYU A;  5DU1 A;  4ZQY A;  1QM7 A;  4RUD A;  2LA1 A;  4DO8 A;  2L5S A;  1JE9 A;  5IMY C;  1MR6 A;  1CHV S;  2BTX A;  1REW C;  2FD6 U;  4IYE A;  1CB9 A;  3BT2 U;  1VB0 A;  2OFS A;  5DO6 A;  1KU6 B;  2H62 D;  5EBX A;  1JGK A;  1FAS A;  3U73 U;  4P7U A;  1MAH F;  1HC9 A;  1G6M A;  2QC1 A;  1HAJ A;  1LXG A;  1CDS A;  2H64 C;  1W6B A;  1F94 A;  4LFT A;  1ABT A;  1V6P A;  4OM4 A;  1FFJ A;  2HLQ A;  1CXN A;  4BIK B;  2I9B E;  1CDQ A;  1NEA A;  2GOO B;  2X8B B;  4XJJ A;  1F8U B;  1YWH A;  1COD A;  1KBS A;  2L03 A;  2MJ4 A;  3U74 U;  2PJY C;  4UY2 C;  2UX2 A;  2H7Z A;  1KTZ B;  3NH7 A;  3QB4 B;  1CVO A;  1QKE A;  1FF4 A;  1UG4 A;  1XT3 A;  1HOY A;  1CRF A;  1HAA A;  1KFH A;  2VLW A;  2QJ9 C;  2CCX A;  1KS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...