1REWC

Structural refinement of the complex of bone morphogenetic protein 2 and its type ia receptor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/growth factor/signaling protein
molecule keywords bone morphogenetic protein 2
publication title Molecular recognition of BMP-2 and BMP receptor IA.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rewC00
4IYEA 4BIKB 2QJ9C 3FEVA 1ERGA 2QJBC 2JQPA 2PJYB 2X8BB 1IDLA 2I9BE 1RGJA 1VB0A 4FAOE 1KU6B 5DZ5A 3EBXA 1DRSA 4EY8B 1JE9A 1KBTA 3KFDI 1V6PA 2GOOC 4UY2C 1CODA 1COEA 1KC4A 1F8UB 1G6MA 1W6BA 1IQ9A 2MJ0A 3BT1U 2CRTA 3EVSC 1B41B 1REWC 3NEQA 1IJCA 5IMTD 2CDXA 2QJAC 1BTEA 3KFDE 4ZQYA 1NORA 2MJYA 1JBDA 3U73U 4BDTB 1ONJA 2MFAA 4FAOC 4XJJA 1HOYA 1QKDA 1IK8A 2ABXA 1LXGA 2MHYA 2H64C 2N99A 3U74U 1JGKA 1HAJA 2NBTA 1CXNA 1NYUA 2MUPA 1NTNA 3BT2U 2L5SA 4DO8A 1LX5B 1NTXA 2JVEA 2LCRA 3VTSA 1TGXA 1KTZB 1LJZA 1HC9A 1KFHA 2FD6U 1IDHA 1KXIA 2BHIA 1FSSB 1CVOA 1UG4A 2PJYC 4HQPF 3QB4B 2K3GA 2UWRA 2H5FA 2L03A 1TXBA 2GOOB 1RL5A 2LA1A 1HAAA 1KBSA 4LFTA 4OM5A 4AEAA 2H7ZA 1S4YA 1KBAA 2CTXA 2MUOA 2UX2A 1MAHF 1IDIA 1KL8A 1F94A 1NYSA 1TXAA 1FRAA 2J8BA 1LXHA 1QM7A 1PLOA 2H62C 1NXBA 1L4WA 2ERAA 4OM4A 1YWHA 1CRFA 4P7UA 6EBXA 5IMYC 1CXOA 3PLCA 1M9ZA 2H64B 2H7ZB 1FSCA 3NDSA 2H62D 1CREA 3LAQU 4QTIU 1CDQA 1CDSA 1TFSA 1ES7B 3HH7A 2QC1A 5DU1A 5DO6A 1BXPA 2VLWA 1CDTA 1I02A 1ZADA 1IKCA 2BTXA 2MJ4A 1HC9B 3ERAA 1KS6A 1IDGA 1FASA 2CRSA 3NH7A 1CDRA 1ABTA 1CTXA 2OFSA 5EBXA 1QKEA 2HLQA 1FF4A 1H0JA 1MR6A 1CB9A 1ERAA 1LSIA 1CCQA 2H8UA 1CHVS 1NEAA 1XT3A 2CCXA 4RUDA 2HLRA 1FFJA
chains in the Genus database with same CATH superfamily
4IYEA 4BIKB 2QJ9C 3FEVA 1ERGA 2QJBC 2JQPA 2PJYB 2X8BB 1IDLA 2I9BE 1RGJA 1VB0A 4FAOE 1KU6B 5DZ5A 3EBXA 1DRSA 4EY8B 1JE9A 1KBTA 3KFDI 1V6PA 2GOOC 4UY2C 1CODA 1COEA 1KC4A 1F8UB 1G6MA 1W6BA 1IQ9A 2MJ0A 3BT1U 2CRTA 3EVSC 1B41B 1REWC 3NEQA 1IJCA 5IMTD 2CDXA 2QJAC 1BTEA 3KFDE 4ZQYA 1NORA 2MJYA 1JBDA 3U73U 4BDTB 1ONJA 2MFAA 4FAOC 4XJJA 1HOYA 1QKDA 1IK8A 2ABXA 1LXGA 2MHYA 2H64C 2N99A 3U74U 1JGKA 1HAJA 2NBTA 1CXNA 1NYUA 2MUPA 1NTNA 3BT2U 2L5SA 4DO8A 1LX5B 1NTXA 2JVEA 2LCRA 3VTSA 1TGXA 1KTZB 1LJZA 1HC9A 1KFHA 2FD6U 1IDHA 1KXIA 2BHIA 1FSSB 1CVOA 1UG4A 2PJYC 4HQPF 3QB4B 2K3GA 2UWRA 2H5FA 2L03A 1TXBA 2GOOB 1RL5A 2LA1A 1HAAA 1KBSA 4LFTA 4OM5A 4AEAA 2H7ZA 1S4YA 1KBAA 2CTXA 2MUOA 2UX2A 1MAHF 1IDIA 1KL8A 1F94A 1NYSA 1TXAA 1FRAA 2J8BA 1LXHA 1QM7A 1PLOA 2H62C 1NXBA 1L4WA 2ERAA 4OM4A 1YWHA 1CRFA 4P7UA 6EBXA 5IMYC 1CXOA 3PLCA 1M9ZA 2H64B 2H7ZB 1FSCA 3NDSA 2H62D 1CREA 3LAQU 4QTIU 1CDQA 1CDSA 1TFSA 1ES7B 3HH7A 2QC1A 5DU1A 5DO6A 1BXPA 2VLWA 1CDTA 1I02A 1ZADA 4KSNA 1IKCA 2BTXA 2MJ4A 1HC9B 3ERAA 1KS6A 1IDGA 1FASA 2CRSA 3NH7A 1CDRA 1ABTA 1CTXA 2OFSA 5EBXA 1QKEA 2HLQA 1FF4A 1H0JA 1MR6A 1CB9A 1ERAA 1LSIA 1CCQA 2H8UA 1CHVS 1NEAA 1XT3A 2CCXA 4RUDA 2HLRA 1FFJA
chains in the Genus database with same CATH topology
4IYEA 4BIKB 2QJ9C 3FEVA 1ERGA 2QJBC 2JQPA 2PJYB 2X8BB 1IDLA 2I9BE 1RGJA 1VB0A 4FAOE 1KU6B 5DZ5A 3EBXA 1DRSA 4EY8B 1JE9A 1KBTA 3KFDI 1V6PA 2GOOC 4UY2C 1CODA 1COEA 1KC4A 1F8UB 1G6MA 1W6BA 1IQ9A 2MJ0A 3BT1U 2CRTA 3EVSC 1B41B 1REWC 3NEQA 1IJCA 5IMTD 2CDXA 2QJAC 1BTEA 3KFDE 4ZQYA 1NORA 2MJYA 1JBDA 3U73U 4BDTB 1ONJA 2MFAA 4FAOC 4XJJA 1HOYA 1QKDA 1IK8A 2ABXA 1LXGA 2MHYA 2H64C 2N99A 3U74U 1JGKA 1HAJA 2NBTA 1CXNA 1NYUA 2MUPA 1NTNA 3BT2U 2L5SA 4DO8A 1LX5B 1NTXA 2JVEA 2LCRA 3VTSA 1TGXA 1KTZB 1LJZA 1HC9A 1KFHA 2FD6U 1IDHA 1KXIA 2BHIA 1FSSB 1CVOA 1UG4A 2PJYC 4HQPF 3QB4B 2K3GA 2UWRA 2H5FA 2L03A 1TXBA 2GOOB 1RL5A 2LA1A 1HAAA 1KBSA 4LFTA 4OM5A 4AEAA 2H7ZA 1S4YA 1KBAA 2CTXA 2MUOA 2UX2A 1MAHF 1IDIA 1KL8A 1F94A 1NYSA 1TXAA 1FRAA 2J8BA 1LXHA 1QM7A 1PLOA 2H62C 1NXBA 1L4WA 2ERAA 4OM4A 1YWHA 1CRFA 4P7UA 6EBXA 5IMYC 1CXOA 3PLCA 1M9ZA 2H64B 2H7ZB 1FSCA 3NDSA 2H62D 1CREA 3LAQU 4QTIU 1CDQA 1CDSA 1TFSA 1ES7B 3HH7A 2QC1A 5DU1A 5DO6A 1BXPA 2VLWA 1CDTA 1I02A 1ZADA 4KSNA 1IKCA 2BTXA 2MJ4A 1HC9B 3ERAA 1KS6A 1IDGA 1FASA 2CRSA 3NH7A 1CDRA 1ABTA 1CTXA 2OFSA 5EBXA 1QKEA 2HLQA 1FF4A 1H0JA 1MR6A 1CB9A 1ERAA 1LSIA 1CCQA 2H8UA 1CHVS 1NEAA 1XT3A 2CCXA 4RUDA 2HLRA 1FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IYE A;  4BIK B;  2QJ9 C;  3FEV A;  1ERG A;  2QJB C;  2JQP A;  2PJY B;  2X8B B;  1IDL A;  2I9B E;  1RGJ A;  1VB0 A;  4FAO E;  1KU6 B;  5DZ5 A;  3EBX A;  1DRS A;  4EY8 B;  1JE9 A;  1KBT A;  3KFD I;  1V6P A;  2GOO C;  4UY2 C;  1COD A;  1COE A;  1KC4 A;  1F8U B;  1G6M A;  1W6B A;  1IQ9 A;  2MJ0 A;  3BT1 U;  2CRT A;  3EVS C;  1B41 B;  1REW C;  3NEQ A;  1IJC A;  5IMT D;  2CDX A;  2QJA C;  1BTE A;  3KFD E;  4ZQY A;  1NOR A;  2MJY A;  1JBD A;  3U73 U;  4BDT B;  1ONJ A;  2MFA A;  4FAO C;  4XJJ A;  1HOY A;  1QKD A;  1IK8 A;  2ABX A;  1LXG A;  2MHY A;  2H64 C;  2N99 A;  3U74 U;  1JGK A;  1HAJ A;  2NBT A;  1CXN A;  1NYU A;  2MUP A;  1NTN A;  3BT2 U;  2L5S A;  4DO8 A;  1LX5 B;  1NTX A;  2JVE A;  2LCR A;  3VTS A;  1TGX A;  1KTZ B;  1LJZ A;  1HC9 A;  1KFH A;  2FD6 U;  1IDH A;  1KXI A;  2BHI A;  1FSS B;  1CVO A;  1UG4 A;  2PJY C;  4HQP F;  3QB4 B;  2K3G A;  2UWR A;  2H5F A;  2L03 A;  1TXB A;  2GOO B;  1RL5 A;  2LA1 A;  1HAA A;  1KBS A;  4LFT A;  4OM5 A;  4AEA A;  2H7Z A;  1S4Y A;  1KBA A;  2CTX A;  2MUO A;  2UX2 A;  1MAH F;  1IDI A;  1KL8 A;  1F94 A;  1NYS A;  1TXA A;  1FRA A;  2J8B A;  1LXH A;  1QM7 A;  1PLO A;  2H62 C;  1NXB A;  1L4W A;  2ERA A;  4OM4 A;  1YWH A;  1CRF A;  4P7U A;  6EBX A;  5IMY C;  1CXO A;  3PLC A;  1M9Z A;  2H64 B;  2H7Z B;  1FSC A;  3NDS A;  2H62 D;  1CRE A;  3LAQ U;  4QTI U;  1CDQ A;  1CDS A;  1TFS A;  1ES7 B;  3HH7 A;  2QC1 A;  5DU1 A;  5DO6 A;  1BXP A;  2VLW A;  1CDT A;  1I02 A;  1ZAD A;  1IKC A;  2BTX A;  2MJ4 A;  1HC9 B;  3ERA A;  1KS6 A;  1IDG A;  1FAS A;  2CRS A;  3NH7 A;  1CDR A;  1ABT A;  1CTX A;  2OFS A;  5EBX A;  1QKE A;  2HLQ A;  1FF4 A;  1H0J A;  1MR6 A;  1CB9 A;  1ERA A;  1LSI A;  1CCQ A;  2H8U A;  1CHV S;  1NEA A;  1XT3 A;  2CCX A;  4RUD A;  2HLR A;  1FFJ A; 
#chains in the Genus database with same CATH topology
 4IYE A;  4BIK B;  2QJ9 C;  3FEV A;  1ERG A;  2QJB C;  2JQP A;  2PJY B;  2X8B B;  1IDL A;  2I9B E;  1RGJ A;  1VB0 A;  4FAO E;  1KU6 B;  5DZ5 A;  3EBX A;  1DRS A;  4EY8 B;  1JE9 A;  1KBT A;  3KFD I;  1V6P A;  2GOO C;  4UY2 C;  1COD A;  1COE A;  1KC4 A;  1F8U B;  1G6M A;  1W6B A;  1IQ9 A;  2MJ0 A;  3BT1 U;  2CRT A;  3EVS C;  1B41 B;  1REW C;  3NEQ A;  1IJC A;  5IMT D;  2CDX A;  2QJA C;  1BTE A;  3KFD E;  4ZQY A;  1NOR A;  2MJY A;  1JBD A;  3U73 U;  4BDT B;  1ONJ A;  2MFA A;  4FAO C;  4XJJ A;  1HOY A;  1QKD A;  1IK8 A;  2ABX A;  1LXG A;  2MHY A;  2H64 C;  2N99 A;  3U74 U;  1JGK A;  1HAJ A;  2NBT A;  1CXN A;  1NYU A;  2MUP A;  1NTN A;  3BT2 U;  2L5S A;  4DO8 A;  1LX5 B;  1NTX A;  2JVE A;  2LCR A;  3VTS A;  1TGX A;  1KTZ B;  1LJZ A;  1HC9 A;  1KFH A;  2FD6 U;  1IDH A;  1KXI A;  2BHI A;  1FSS B;  1CVO A;  1UG4 A;  2PJY C;  4HQP F;  3QB4 B;  2K3G A;  2UWR A;  2H5F A;  2L03 A;  1TXB A;  2GOO B;  1RL5 A;  2LA1 A;  1HAA A;  1KBS A;  4LFT A;  4OM5 A;  4AEA A;  2H7Z A;  1S4Y A;  1KBA A;  2CTX A;  2MUO A;  2UX2 A;  1MAH F;  1IDI A;  1KL8 A;  1F94 A;  1NYS A;  1TXA A;  1FRA A;  2J8B A;  1LXH A;  1QM7 A;  1PLO A;  2H62 C;  1NXB A;  1L4W A;  2ERA A;  4OM4 A;  1YWH A;  1CRF A;  4P7U A;  6EBX A;  5IMY C;  1CXO A;  3PLC A;  1M9Z A;  2H64 B;  2H7Z B;  1FSC A;  3NDS A;  2H62 D;  1CRE A;  3LAQ U;  4QTI U;  1CDQ A;  1CDS A;  1TFS A;  1ES7 B;  3HH7 A;  2QC1 A;  5DU1 A;  5DO6 A;  1BXP A;  2VLW A;  1CDT A;  1I02 A;  1ZAD A;  4KSN A;  1IKC A;  2BTX A;  2MJ4 A;  1HC9 B;  3ERA A;  1KS6 A;  1IDG A;  1FAS A;  2CRS A;  3NH7 A;  1CDR A;  1ABT A;  1CTX A;  2OFS A;  5EBX A;  1QKE A;  2HLQ A;  1FF4 A;  1H0J A;  1MR6 A;  1CB9 A;  1ERA A;  1LSI A;  1CCQ A;  2H8U A;  1CHV S;  1NEA A;  1XT3 A;  2CCX A;  4RUD A;  2HLR A;  1FFJ A; 
#chains in the Genus database with same CATH homology
 4IYE A;  4BIK B;  2QJ9 C;  3FEV A;  1ERG A;  2QJB C;  2JQP A;  2PJY B;  2X8B B;  1IDL A;  2I9B E;  1RGJ A;  1VB0 A;  4FAO E;  1KU6 B;  5DZ5 A;  3EBX A;  1DRS A;  4EY8 B;  1JE9 A;  1KBT A;  3KFD I;  1V6P A;  2GOO C;  4UY2 C;  1COD A;  1COE A;  1KC4 A;  1F8U B;  1G6M A;  1W6B A;  1IQ9 A;  2MJ0 A;  3BT1 U;  2CRT A;  3EVS C;  1B41 B;  1REW C;  3NEQ A;  1IJC A;  5IMT D;  2CDX A;  2QJA C;  1BTE A;  3KFD E;  4ZQY A;  1NOR A;  2MJY A;  1JBD A;  3U73 U;  4BDT B;  1ONJ A;  2MFA A;  4FAO C;  4XJJ A;  1HOY A;  1QKD A;  1IK8 A;  2ABX A;  1LXG A;  2MHY A;  2H64 C;  2N99 A;  3U74 U;  1JGK A;  1HAJ A;  2NBT A;  1CXN A;  1NYU A;  2MUP A;  1NTN A;  3BT2 U;  2L5S A;  4DO8 A;  1LX5 B;  1NTX A;  2JVE A;  2LCR A;  3VTS A;  1TGX A;  1KTZ B;  1LJZ A;  1HC9 A;  1KFH A;  2FD6 U;  1IDH A;  1KXI A;  2BHI A;  1FSS B;  1CVO A;  1UG4 A;  2PJY C;  4HQP F;  3QB4 B;  2K3G A;  2UWR A;  2H5F A;  2L03 A;  1TXB A;  2GOO B;  1RL5 A;  2LA1 A;  1HAA A;  1KBS A;  4LFT A;  4OM5 A;  4AEA A;  2H7Z A;  1S4Y A;  1KBA A;  2CTX A;  2MUO A;  2UX2 A;  1MAH F;  1IDI A;  1KL8 A;  1F94 A;  1NYS A;  1TXA A;  1FRA A;  2J8B A;  1LXH A;  1QM7 A;  1PLO A;  2H62 C;  1NXB A;  1L4W A;  2ERA A;  4OM4 A;  1YWH A;  1CRF A;  4P7U A;  6EBX A;  5IMY C;  1CXO A;  3PLC A;  1M9Z A;  2H64 B;  2H7Z B;  1FSC A;  3NDS A;  2H62 D;  1CRE A;  3LAQ U;  4QTI U;  1CDQ A;  1CDS A;  1TFS A;  1ES7 B;  3HH7 A;  2QC1 A;  5DU1 A;  5DO6 A;  1BXP A;  2VLW A;  1CDT A;  1I02 A;  1ZAD A;  4KSN A;  1IKC A;  2BTX A;  2MJ4 A;  1HC9 B;  3ERA A;  1KS6 A;  1IDG A;  1FAS A;  2CRS A;  3NH7 A;  1CDR A;  1ABT A;  1CTX A;  2OFS A;  5EBX A;  1QKE A;  2HLQ A;  1FF4 A;  1H0J A;  1MR6 A;  1CB9 A;  1ERA A;  1LSI A;  1CCQ A;  2H8U A;  1CHV S;  1NEA A;  1XT3 A;  2CCX A;  4RUD A;  2HLR A;  1FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...