1REWC

Structural refinement of the complex of bone morphogenetic protein 2 and its type ia receptor
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
86
structure length
86
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords bone morphogenetic protein 2
publication title Molecular recognition of BMP-2 and BMP receptor IA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor/signaling protein
total genus 15
structure length 86
sequence length 86
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2003-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1rewC00
1JE9A 4XJJA 1NXBA 1YWHA 2H62C 3PLCA 3BT2U 1BXPA 1COEA 4RUDA 2JQPA 2ERAA 1FASA 1FSSB 1JGKA 1CHVS 1PLOA 1VB0A 2PJYB 1IK8A 2MJ0A 1NYUA 1KU6B 1ABTA 4QTIU 2K3GA 2BHIA 3U73U 1ERAA 3QB4B 5EBXA 2H8UA 2LCRA 1KFHA 1KBSA 1KXIA 4BDTB 1IJCA 1B41B 3BT1U 1CDQA 1QM7A 2UWRA 1FSCA 2VLWA 5IMYC 1KS6A 1IKCA 2MFAA 1NORA 3HH7A 1CDTA 1ERGA 2HLQA 2OFSA 1MAHF 3NEQA 1HC9B 4OM4A 1UG4A 1KTZB 2L5SA 2QJBC 2BTXA 3NDSA 4HQPF 1ONJA 1RGJA 2N99A 5DO6A 1KC4A 4FAOC 1JBDA 3EVSC 1FRAA 1NTNA 4UY2C 1CREA 1HC9A 2H62D 2QJAC 1FFJA 1NEAA 1CXNA 1BTEA 2L03A 5DU1A 1CXOA 1CDSA 4AEAA 2H5FA 2NBTA 1KBAA 1CTXA 1S4YA 1M9ZA 1CRFA 2GOOC 2H64C 4EY8B 1CDRA 1TXAA 1IDLA 3NH7A 1QKEA 1CCQA 1G6MA 1I02A 1HAAA 1KL8A 1TGXA 2MUPA 1CVOA 2CDXA 2LA1A 1IQ9A 3ERAA 1NTXA 1F94A 3KFDI 4OM5A 2QC1A 1REWC 3U74U 1HAJA 1IDHA 1XT3A 1LXHA 2QJ9C 2J8BA 6EBXA 1LX5B 1CB9A 1CODA 4LFTA 1TXBA 2PJYC 3KFDE 2CCXA 1RL5A 4BIKB 2MUOA 5IMTD 4ZQYA 2CTXA 4P7UA 2MJ4A 3VTSA 4IYEA 5DZ5A 2MJYA 1ZADA 3FEVA 2UX2A 1FF4A 1MR6A 1LXGA 1ES7B 1LSIA 2X8BB 2MHYA 1NYSA 1IDGA 4DO8A 1F8UB 3EBXA 2H7ZB 2FD6U 2ABXA 1IDIA 2I9BE 2GOOB 1L4WA 2H64B 1LJZA 1HOYA 4FAOE 2CRSA 1QKDA 1V6PA 2H7ZA 2JVEA 3LAQU 1W6BA 1H0JA 1KBTA 1TFSA 2CRTA 2HLRA 1DRSA
chains in the Genus database with same CATH superfamily
1JE9A 4XJJA 1NXBA 1YWHA 2H62C 3PLCA 3BT2U 1BXPA 1COEA 4RUDA 2JQPA 2ERAA 1FASA 1FSSB 1JGKA 1CHVS 1PLOA 1VB0A 2PJYB 1IK8A 2MJ0A 1NYUA 1KU6B 1ABTA 4QTIU 2K3GA 2BHIA 3U73U 1ERAA 3QB4B 5EBXA 2H8UA 2LCRA 1KFHA 1KBSA 1KXIA 4BDTB 1IJCA 1B41B 3BT1U 1CDQA 1QM7A 2UWRA 1FSCA 2VLWA 5IMYC 1KS6A 1IKCA 2MFAA 1NORA 3HH7A 1CDTA 1ERGA 2HLQA 2OFSA 1MAHF 3NEQA 1HC9B 4OM4A 1UG4A 1KTZB 2L5SA 2QJBC 2BTXA 3NDSA 4HQPF 1ONJA 1RGJA 2N99A 5DO6A 1KC4A 4FAOC 1JBDA 3EVSC 1FRAA 1NTNA 4UY2C 1CREA 1HC9A 2H62D 2QJAC 1FFJA 1NEAA 1CXNA 1BTEA 2L03A 5DU1A 1CXOA 1CDSA 4AEAA 2H5FA 2NBTA 1KBAA 1CTXA 1S4YA 1M9ZA 1CRFA 2GOOC 2H64C 4EY8B 1CDRA 1TXAA 1IDLA 3NH7A 1QKEA 1CCQA 1G6MA 1I02A 1HAAA 1KL8A 1TGXA 2MUPA 1CVOA 2CDXA 2LA1A 1IQ9A 3ERAA 1NTXA 1F94A 3KFDI 4OM5A 2QC1A 1REWC 3U74U 1HAJA 1IDHA 1XT3A 1LXHA 2QJ9C 2J8BA 6EBXA 1LX5B 1CB9A 1CODA 4LFTA 1TXBA 2PJYC 3KFDE 2CCXA 1RL5A 4BIKB 2MUOA 5IMTD 4ZQYA 2CTXA 4P7UA 2MJ4A 3VTSA 4IYEA 5DZ5A 2MJYA 1ZADA 3FEVA 2UX2A 1FF4A 1MR6A 1LXGA 1ES7B 1LSIA 2X8BB 4KSNA 2MHYA 1NYSA 1IDGA 4DO8A 1F8UB 3EBXA 2H7ZB 2FD6U 2ABXA 1IDIA 2I9BE 2GOOB 1L4WA 2H64B 1LJZA 1HOYA 4FAOE 2CRSA 1QKDA 1V6PA 2H7ZA 2JVEA 3LAQU 1W6BA 1H0JA 1KBTA 1TFSA 2CRTA 2HLRA 1DRSA
chains in the Genus database with same CATH topology
1JE9A 4XJJA 1NXBA 1YWHA 2H62C 3PLCA 3BT2U 1BXPA 1COEA 4RUDA 2JQPA 2ERAA 1FASA 1FSSB 1JGKA 1CHVS 1PLOA 1VB0A 2PJYB 1IK8A 2MJ0A 1NYUA 1KU6B 1ABTA 4QTIU 2K3GA 2BHIA 3U73U 1ERAA 3QB4B 5EBXA 2H8UA 2LCRA 1KFHA 1KBSA 1KXIA 4BDTB 1IJCA 1B41B 3BT1U 1CDQA 1QM7A 2UWRA 1FSCA 2VLWA 5IMYC 1KS6A 1IKCA 2MFAA 1NORA 3HH7A 1CDTA 1ERGA 2HLQA 2OFSA 1MAHF 3NEQA 1HC9B 4OM4A 1UG4A 1KTZB 2L5SA 2QJBC 2BTXA 3NDSA 4HQPF 1ONJA 1RGJA 2N99A 5DO6A 1KC4A 4FAOC 1JBDA 3EVSC 1FRAA 1NTNA 4UY2C 1CREA 1HC9A 2H62D 2QJAC 1FFJA 1NEAA 1CXNA 1BTEA 2L03A 5DU1A 1CXOA 1CDSA 4AEAA 2H5FA 2NBTA 1KBAA 1CTXA 1S4YA 1M9ZA 1CRFA 2GOOC 2H64C 4EY8B 1CDRA 1TXAA 1IDLA 3NH7A 1QKEA 1CCQA 1G6MA 1I02A 1HAAA 1KL8A 1TGXA 2MUPA 1CVOA 2CDXA 2LA1A 1IQ9A 3ERAA 1NTXA 1F94A 3KFDI 4OM5A 2QC1A 1REWC 3U74U 1HAJA 1IDHA 1XT3A 1LXHA 2QJ9C 2J8BA 6EBXA 1LX5B 1CB9A 1CODA 4LFTA 1TXBA 2PJYC 3KFDE 2CCXA 1RL5A 4BIKB 2MUOA 5IMTD 4ZQYA 2CTXA 4P7UA 2MJ4A 3VTSA 4IYEA 5DZ5A 2MJYA 1ZADA 3FEVA 2UX2A 1FF4A 1MR6A 1LXGA 1ES7B 1LSIA 2X8BB 4KSNA 2MHYA 1NYSA 1IDGA 4DO8A 1F8UB 3EBXA 2H7ZB 2FD6U 2ABXA 1IDIA 2I9BE 2GOOB 1L4WA 2H64B 1LJZA 1HOYA 4FAOE 2CRSA 1QKDA 1V6PA 2H7ZA 2JVEA 3LAQU 1W6BA 1H0JA 1KBTA 1TFSA 2CRTA 2HLRA 1DRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JE9 A;  4XJJ A;  1NXB A;  1YWH A;  2H62 C;  3PLC A;  3BT2 U;  1BXP A;  1COE A;  4RUD A;  2JQP A;  2ERA A;  1FAS A;  1FSS B;  1JGK A;  1CHV S;  1PLO A;  1VB0 A;  2PJY B;  1IK8 A;  2MJ0 A;  1NYU A;  1KU6 B;  1ABT A;  4QTI U;  2K3G A;  2BHI A;  3U73 U;  1ERA A;  3QB4 B;  5EBX A;  2H8U A;  2LCR A;  1KFH A;  1KBS A;  1KXI A;  4BDT B;  1IJC A;  1B41 B;  3BT1 U;  1CDQ A;  1QM7 A;  2UWR A;  1FSC A;  2VLW A;  5IMY C;  1KS6 A;  1IKC A;  2MFA A;  1NOR A;  3HH7 A;  1CDT A;  1ERG A;  2HLQ A;  2OFS A;  1MAH F;  3NEQ A;  1HC9 B;  4OM4 A;  1UG4 A;  1KTZ B;  2L5S A;  2QJB C;  2BTX A;  3NDS A;  4HQP F;  1ONJ A;  1RGJ A;  2N99 A;  5DO6 A;  1KC4 A;  4FAO C;  1JBD A;  3EVS C;  1FRA A;  1NTN A;  4UY2 C;  1CRE A;  1HC9 A;  2H62 D;  2QJA C;  1FFJ A;  1NEA A;  1CXN A;  1BTE A;  2L03 A;  5DU1 A;  1CXO A;  1CDS A;  4AEA A;  2H5F A;  2NBT A;  1KBA A;  1CTX A;  1S4Y A;  1M9Z A;  1CRF A;  2GOO C;  2H64 C;  4EY8 B;  1CDR A;  1TXA A;  1IDL A;  3NH7 A;  1QKE A;  1CCQ A;  1G6M A;  1I02 A;  1HAA A;  1KL8 A;  1TGX A;  2MUP A;  1CVO A;  2CDX A;  2LA1 A;  1IQ9 A;  3ERA A;  1NTX A;  1F94 A;  3KFD I;  4OM5 A;  2QC1 A;  1REW C;  3U74 U;  1HAJ A;  1IDH A;  1XT3 A;  1LXH A;  2QJ9 C;  2J8B A;  6EBX A;  1LX5 B;  1CB9 A;  1COD A;  4LFT A;  1TXB A;  2PJY C;  3KFD E;  2CCX A;  1RL5 A;  4BIK B;  2MUO A;  5IMT D;  4ZQY A;  2CTX A;  4P7U A;  2MJ4 A;  3VTS A;  4IYE A;  5DZ5 A;  2MJY A;  1ZAD A;  3FEV A;  2UX2 A;  1FF4 A;  1MR6 A;  1LXG A;  1ES7 B;  1LSI A;  2X8B B;  2MHY A;  1NYS A;  1IDG A;  4DO8 A;  1F8U B;  3EBX A;  2H7Z B;  2FD6 U;  2ABX A;  1IDI A;  2I9B E;  2GOO B;  1L4W A;  2H64 B;  1LJZ A;  1HOY A;  4FAO E;  2CRS A;  1QKD A;  1V6P A;  2H7Z A;  2JVE A;  3LAQ U;  1W6B A;  1H0J A;  1KBT A;  1TFS A;  2CRT A;  2HLR A;  1DRS A; 
#chains in the Genus database with same CATH topology
 1JE9 A;  4XJJ A;  1NXB A;  1YWH A;  2H62 C;  3PLC A;  3BT2 U;  1BXP A;  1COE A;  4RUD A;  2JQP A;  2ERA A;  1FAS A;  1FSS B;  1JGK A;  1CHV S;  1PLO A;  1VB0 A;  2PJY B;  1IK8 A;  2MJ0 A;  1NYU A;  1KU6 B;  1ABT A;  4QTI U;  2K3G A;  2BHI A;  3U73 U;  1ERA A;  3QB4 B;  5EBX A;  2H8U A;  2LCR A;  1KFH A;  1KBS A;  1KXI A;  4BDT B;  1IJC A;  1B41 B;  3BT1 U;  1CDQ A;  1QM7 A;  2UWR A;  1FSC A;  2VLW A;  5IMY C;  1KS6 A;  1IKC A;  2MFA A;  1NOR A;  3HH7 A;  1CDT A;  1ERG A;  2HLQ A;  2OFS A;  1MAH F;  3NEQ A;  1HC9 B;  4OM4 A;  1UG4 A;  1KTZ B;  2L5S A;  2QJB C;  2BTX A;  3NDS A;  4HQP F;  1ONJ A;  1RGJ A;  2N99 A;  5DO6 A;  1KC4 A;  4FAO C;  1JBD A;  3EVS C;  1FRA A;  1NTN A;  4UY2 C;  1CRE A;  1HC9 A;  2H62 D;  2QJA C;  1FFJ A;  1NEA A;  1CXN A;  1BTE A;  2L03 A;  5DU1 A;  1CXO A;  1CDS A;  4AEA A;  2H5F A;  2NBT A;  1KBA A;  1CTX A;  1S4Y A;  1M9Z A;  1CRF A;  2GOO C;  2H64 C;  4EY8 B;  1CDR A;  1TXA A;  1IDL A;  3NH7 A;  1QKE A;  1CCQ A;  1G6M A;  1I02 A;  1HAA A;  1KL8 A;  1TGX A;  2MUP A;  1CVO A;  2CDX A;  2LA1 A;  1IQ9 A;  3ERA A;  1NTX A;  1F94 A;  3KFD I;  4OM5 A;  2QC1 A;  1REW C;  3U74 U;  1HAJ A;  1IDH A;  1XT3 A;  1LXH A;  2QJ9 C;  2J8B A;  6EBX A;  1LX5 B;  1CB9 A;  1COD A;  4LFT A;  1TXB A;  2PJY C;  3KFD E;  2CCX A;  1RL5 A;  4BIK B;  2MUO A;  5IMT D;  4ZQY A;  2CTX A;  4P7U A;  2MJ4 A;  3VTS A;  4IYE A;  5DZ5 A;  2MJY A;  1ZAD A;  3FEV A;  2UX2 A;  1FF4 A;  1MR6 A;  1LXG A;  1ES7 B;  1LSI A;  2X8B B;  4KSN A;  2MHY A;  1NYS A;  1IDG A;  4DO8 A;  1F8U B;  3EBX A;  2H7Z B;  2FD6 U;  2ABX A;  1IDI A;  2I9B E;  2GOO B;  1L4W A;  2H64 B;  1LJZ A;  1HOY A;  4FAO E;  2CRS A;  1QKD A;  1V6P A;  2H7Z A;  2JVE A;  3LAQ U;  1W6B A;  1H0J A;  1KBT A;  1TFS A;  2CRT A;  2HLR A;  1DRS A; 
#chains in the Genus database with same CATH homology
 1JE9 A;  4XJJ A;  1NXB A;  1YWH A;  2H62 C;  3PLC A;  3BT2 U;  1BXP A;  1COE A;  4RUD A;  2JQP A;  2ERA A;  1FAS A;  1FSS B;  1JGK A;  1CHV S;  1PLO A;  1VB0 A;  2PJY B;  1IK8 A;  2MJ0 A;  1NYU A;  1KU6 B;  1ABT A;  4QTI U;  2K3G A;  2BHI A;  3U73 U;  1ERA A;  3QB4 B;  5EBX A;  2H8U A;  2LCR A;  1KFH A;  1KBS A;  1KXI A;  4BDT B;  1IJC A;  1B41 B;  3BT1 U;  1CDQ A;  1QM7 A;  2UWR A;  1FSC A;  2VLW A;  5IMY C;  1KS6 A;  1IKC A;  2MFA A;  1NOR A;  3HH7 A;  1CDT A;  1ERG A;  2HLQ A;  2OFS A;  1MAH F;  3NEQ A;  1HC9 B;  4OM4 A;  1UG4 A;  1KTZ B;  2L5S A;  2QJB C;  2BTX A;  3NDS A;  4HQP F;  1ONJ A;  1RGJ A;  2N99 A;  5DO6 A;  1KC4 A;  4FAO C;  1JBD A;  3EVS C;  1FRA A;  1NTN A;  4UY2 C;  1CRE A;  1HC9 A;  2H62 D;  2QJA C;  1FFJ A;  1NEA A;  1CXN A;  1BTE A;  2L03 A;  5DU1 A;  1CXO A;  1CDS A;  4AEA A;  2H5F A;  2NBT A;  1KBA A;  1CTX A;  1S4Y A;  1M9Z A;  1CRF A;  2GOO C;  2H64 C;  4EY8 B;  1CDR A;  1TXA A;  1IDL A;  3NH7 A;  1QKE A;  1CCQ A;  1G6M A;  1I02 A;  1HAA A;  1KL8 A;  1TGX A;  2MUP A;  1CVO A;  2CDX A;  2LA1 A;  1IQ9 A;  3ERA A;  1NTX A;  1F94 A;  3KFD I;  4OM5 A;  2QC1 A;  1REW C;  3U74 U;  1HAJ A;  1IDH A;  1XT3 A;  1LXH A;  2QJ9 C;  2J8B A;  6EBX A;  1LX5 B;  1CB9 A;  1COD A;  4LFT A;  1TXB A;  2PJY C;  3KFD E;  2CCX A;  1RL5 A;  4BIK B;  2MUO A;  5IMT D;  4ZQY A;  2CTX A;  4P7U A;  2MJ4 A;  3VTS A;  4IYE A;  5DZ5 A;  2MJY A;  1ZAD A;  3FEV A;  2UX2 A;  1FF4 A;  1MR6 A;  1LXG A;  1ES7 B;  1LSI A;  2X8B B;  4KSN A;  2MHY A;  1NYS A;  1IDG A;  4DO8 A;  1F8U B;  3EBX A;  2H7Z B;  2FD6 U;  2ABX A;  1IDI A;  2I9B E;  2GOO B;  1L4W A;  2H64 B;  1LJZ A;  1HOY A;  4FAO E;  2CRS A;  1QKD A;  1V6P A;  2H7Z A;  2JVE A;  3LAQ U;  1W6B A;  1H0J A;  1KBT A;  1TFS A;  2CRT A;  2HLR A;  1DRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...