2L5SA

Solution structure of the extracellular domain of the tgf-beta type i receptor
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
87
structure length
87
Chain Sequence
GSATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TGF-beta receptor type-1
publication title The TbetaR-I Pre-Helix Extension Is Structurally Ordered in the Unbound Form and Its Flanking Prolines Are Essential for Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 87
sequence length 87
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2010-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2l5sA00
3U73U 1CODA 1CDSA 2MJYA 2BHIA 1KBAA 4EY8B 2K3GA 1IDIA 2QJ9C 4BIKB 2JVEA 2H7ZA 2PJYB 2MUOA 1UG4A 3KFDI 2OFSA 1IKCA 2CRSA 4FAOC 1TXAA 4QTIU 1ABTA 5IMTD 3NDSA 2H62D 1LSIA 3LAQU 4UY2C 1HC9B 1CDQA 1KBTA 1KS6A 4IYEA 1IQ9A 3QB4B 4FAOE 1FASA 1CRFA 1RGJA 1LJZA 1NXBA 1MAHF 1NTXA 1ZADA 2QJAC 1F8UB 3BT2U 1REWC 1NTNA 1CTXA 4BDTB 1JE9A 1F94A 1KBSA 2H8UA 5DU1A 1HOYA 1TXBA 1L4WA 1KXIA 1MR6A 2JQPA 4AEAA 2BTXA 1FSCA 1HAAA 1S4YA 1IDHA 1CREA 1COEA 1JBDA 1W6BA 4DO8A 1ES7B 5IMYC 1H0JA 1FRAA 2MFAA 3EBXA 2J8BA 2CTXA 2H7ZB 1TFSA 2GOOC 1KC4A 2H64B 3ERAA 1ERGA 4P7UA 2LA1A 1QM7A 1NORA 1CB9A 1CXOA 1IK8A 1IDLA 1DRSA 1BTEA 5DO6A 3U74U 3NEQA 2H5FA 2H62C 4OM5A 2PJYC 1KU6B 1CHVS 1LXHA 4ZQYA 1ONJA 2FD6U 1CVOA 4LFTA 2LCRA 1KTZB 1VB0A 1NYUA 1NEAA 4HQPF 1RL5A 1BXPA 1KFHA 3KFDE 1TGXA 3HH7A 1G6MA 2N99A 1KL8A 1LXGA 3NH7A 2NBTA 2QJBC 4OM4A 1CXNA 2CCXA 1I02A 2ERAA 1CCQA 2UX2A 5EBXA 1JGKA 2HLQA 2L03A 1V6PA 2ABXA 1ERAA 3BT1U 1B41B 3EVSC 2QC1A 5DZ5A 1HAJA 2MHYA 3PLCA 2CRTA 1FFJA 2MJ0A 1PLOA 1CDRA 2CDXA 2I9BE 1HC9A 4RUDA 1LX5B 2X8BB 1CDTA 1NYSA 1IJCA 3VTSA 1YWHA 4XJJA 2UWRA 1FF4A 1QKEA 2HLRA 2H64C 3FEVA 1IDGA 2L5SA 1QKDA 1XT3A 2MUPA 2GOOB 6EBXA 2MJ4A 1FSSB 1M9ZA 2VLWA
chains in the Genus database with same CATH superfamily
3U73U 1CODA 1CDSA 2MJYA 2BHIA 1KBAA 4EY8B 2K3GA 1IDIA 2QJ9C 4BIKB 2JVEA 2H7ZA 2PJYB 2MUOA 1UG4A 3KFDI 4KSNA 2OFSA 1IKCA 2CRSA 4FAOC 1TXAA 4QTIU 1ABTA 5IMTD 3NDSA 2H62D 1LSIA 3LAQU 4UY2C 1HC9B 1CDQA 1KBTA 1KS6A 4IYEA 1IQ9A 3QB4B 4FAOE 1FASA 1CRFA 1RGJA 1LJZA 1NXBA 1MAHF 1NTXA 1ZADA 2QJAC 1F8UB 3BT2U 1REWC 1NTNA 1CTXA 4BDTB 1JE9A 1F94A 1KBSA 2H8UA 5DU1A 1HOYA 1TXBA 1L4WA 1KXIA 1MR6A 2JQPA 4AEAA 2BTXA 1FSCA 1HAAA 1S4YA 1IDHA 1CREA 1COEA 1JBDA 1W6BA 4DO8A 1ES7B 5IMYC 1H0JA 1FRAA 2MFAA 3EBXA 2J8BA 2CTXA 2H7ZB 1TFSA 2GOOC 1KC4A 2H64B 3ERAA 1ERGA 4P7UA 2LA1A 1QM7A 1NORA 1CB9A 1CXOA 1IK8A 1IDLA 1DRSA 1BTEA 5DO6A 3U74U 3NEQA 2H5FA 2H62C 4OM5A 2PJYC 1KU6B 1CHVS 1LXHA 4ZQYA 1ONJA 2FD6U 1CVOA 4LFTA 2LCRA 1KTZB 1VB0A 1NYUA 1NEAA 4HQPF 1RL5A 1BXPA 1KFHA 3KFDE 1TGXA 3HH7A 1G6MA 2N99A 1KL8A 1LXGA 3NH7A 2NBTA 2QJBC 4OM4A 1CXNA 2CCXA 1I02A 2ERAA 1CCQA 2UX2A 5EBXA 1JGKA 2HLQA 2L03A 1V6PA 2ABXA 1ERAA 3BT1U 1B41B 3EVSC 2QC1A 5DZ5A 1HAJA 2MHYA 3PLCA 2CRTA 1FFJA 2MJ0A 1PLOA 1CDRA 2CDXA 2I9BE 1HC9A 4RUDA 1LX5B 2X8BB 1CDTA 1NYSA 1IJCA 3VTSA 1YWHA 4XJJA 2UWRA 1FF4A 1QKEA 2HLRA 2H64C 3FEVA 1IDGA 2L5SA 1QKDA 1XT3A 2MUPA 2GOOB 6EBXA 2MJ4A 1FSSB 1M9ZA 2VLWA
chains in the Genus database with same CATH topology
3U73U 1CODA 1CDSA 2MJYA 2BHIA 1KBAA 4EY8B 2K3GA 1IDIA 2QJ9C 4BIKB 2JVEA 2H7ZA 2PJYB 2MUOA 1UG4A 3KFDI 4KSNA 2OFSA 1IKCA 2CRSA 4FAOC 1TXAA 4QTIU 1ABTA 5IMTD 3NDSA 2H62D 1LSIA 3LAQU 4UY2C 1HC9B 1CDQA 1KBTA 1KS6A 4IYEA 1IQ9A 3QB4B 4FAOE 1FASA 1CRFA 1RGJA 1LJZA 1NXBA 1MAHF 1NTXA 1ZADA 2QJAC 1F8UB 3BT2U 1REWC 1NTNA 1CTXA 4BDTB 1JE9A 1F94A 1KBSA 2H8UA 5DU1A 1HOYA 1TXBA 1L4WA 1KXIA 1MR6A 2JQPA 4AEAA 2BTXA 1FSCA 1HAAA 1S4YA 1IDHA 1CREA 1COEA 1JBDA 1W6BA 4DO8A 1ES7B 5IMYC 1H0JA 1FRAA 2MFAA 3EBXA 2J8BA 2CTXA 2H7ZB 1TFSA 2GOOC 1KC4A 2H64B 3ERAA 1ERGA 4P7UA 2LA1A 1QM7A 1NORA 1CB9A 1CXOA 1IK8A 1IDLA 1DRSA 1BTEA 5DO6A 3U74U 3NEQA 2H5FA 2H62C 4OM5A 2PJYC 1KU6B 1CHVS 1LXHA 4ZQYA 1ONJA 2FD6U 1CVOA 4LFTA 2LCRA 1KTZB 1VB0A 1NYUA 1NEAA 4HQPF 1RL5A 1BXPA 1KFHA 3KFDE 1TGXA 3HH7A 1G6MA 2N99A 1KL8A 1LXGA 3NH7A 2NBTA 2QJBC 4OM4A 1CXNA 2CCXA 1I02A 2ERAA 1CCQA 2UX2A 5EBXA 1JGKA 2HLQA 2L03A 1V6PA 2ABXA 1ERAA 3BT1U 1B41B 3EVSC 2QC1A 5DZ5A 1HAJA 2MHYA 3PLCA 2CRTA 1FFJA 2MJ0A 1PLOA 1CDRA 2CDXA 2I9BE 1HC9A 4RUDA 1LX5B 2X8BB 1CDTA 1NYSA 1IJCA 3VTSA 1YWHA 4XJJA 2UWRA 1FF4A 1QKEA 2HLRA 2H64C 3FEVA 1IDGA 2L5SA 1QKDA 1XT3A 2MUPA 2GOOB 6EBXA 2MJ4A 1FSSB 1M9ZA 2VLWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U73 U;  1COD A;  1CDS A;  2MJY A;  2BHI A;  1KBA A;  4EY8 B;  2K3G A;  1IDI A;  2QJ9 C;  4BIK B;  2JVE A;  2H7Z A;  2PJY B;  2MUO A;  1UG4 A;  3KFD I;  2OFS A;  1IKC A;  2CRS A;  4FAO C;  1TXA A;  4QTI U;  1ABT A;  5IMT D;  3NDS A;  2H62 D;  1LSI A;  3LAQ U;  4UY2 C;  1HC9 B;  1CDQ A;  1KBT A;  1KS6 A;  4IYE A;  1IQ9 A;  3QB4 B;  4FAO E;  1FAS A;  1CRF A;  1RGJ A;  1LJZ A;  1NXB A;  1MAH F;  1NTX A;  1ZAD A;  2QJA C;  1F8U B;  3BT2 U;  1REW C;  1NTN A;  1CTX A;  4BDT B;  1JE9 A;  1F94 A;  1KBS A;  2H8U A;  5DU1 A;  1HOY A;  1TXB A;  1L4W A;  1KXI A;  1MR6 A;  2JQP A;  4AEA A;  2BTX A;  1FSC A;  1HAA A;  1S4Y A;  1IDH A;  1CRE A;  1COE A;  1JBD A;  1W6B A;  4DO8 A;  1ES7 B;  5IMY C;  1H0J A;  1FRA A;  2MFA A;  3EBX A;  2J8B A;  2CTX A;  2H7Z B;  1TFS A;  2GOO C;  1KC4 A;  2H64 B;  3ERA A;  1ERG A;  4P7U A;  2LA1 A;  1QM7 A;  1NOR A;  1CB9 A;  1CXO A;  1IK8 A;  1IDL A;  1DRS A;  1BTE A;  5DO6 A;  3U74 U;  3NEQ A;  2H5F A;  2H62 C;  4OM5 A;  2PJY C;  1KU6 B;  1CHV S;  1LXH A;  4ZQY A;  1ONJ A;  2FD6 U;  1CVO A;  4LFT A;  2LCR A;  1KTZ B;  1VB0 A;  1NYU A;  1NEA A;  4HQP F;  1RL5 A;  1BXP A;  1KFH A;  3KFD E;  1TGX A;  3HH7 A;  1G6M A;  2N99 A;  1KL8 A;  1LXG A;  3NH7 A;  2NBT A;  2QJB C;  4OM4 A;  1CXN A;  2CCX A;  1I02 A;  2ERA A;  1CCQ A;  2UX2 A;  5EBX A;  1JGK A;  2HLQ A;  2L03 A;  1V6P A;  2ABX A;  1ERA A;  3BT1 U;  1B41 B;  3EVS C;  2QC1 A;  5DZ5 A;  1HAJ A;  2MHY A;  3PLC A;  2CRT A;  1FFJ A;  2MJ0 A;  1PLO A;  1CDR A;  2CDX A;  2I9B E;  1HC9 A;  4RUD A;  1LX5 B;  2X8B B;  1CDT A;  1NYS A;  1IJC A;  3VTS A;  1YWH A;  4XJJ A;  2UWR A;  1FF4 A;  1QKE A;  2HLR A;  2H64 C;  3FEV A;  1IDG A;  2L5S A;  1QKD A;  1XT3 A;  2MUP A;  2GOO B;  6EBX A;  2MJ4 A;  1FSS B;  1M9Z A;  2VLW A; 
#chains in the Genus database with same CATH topology
 3U73 U;  1COD A;  1CDS A;  2MJY A;  2BHI A;  1KBA A;  4EY8 B;  2K3G A;  1IDI A;  2QJ9 C;  4BIK B;  2JVE A;  2H7Z A;  2PJY B;  2MUO A;  1UG4 A;  3KFD I;  4KSN A;  2OFS A;  1IKC A;  2CRS A;  4FAO C;  1TXA A;  4QTI U;  1ABT A;  5IMT D;  3NDS A;  2H62 D;  1LSI A;  3LAQ U;  4UY2 C;  1HC9 B;  1CDQ A;  1KBT A;  1KS6 A;  4IYE A;  1IQ9 A;  3QB4 B;  4FAO E;  1FAS A;  1CRF A;  1RGJ A;  1LJZ A;  1NXB A;  1MAH F;  1NTX A;  1ZAD A;  2QJA C;  1F8U B;  3BT2 U;  1REW C;  1NTN A;  1CTX A;  4BDT B;  1JE9 A;  1F94 A;  1KBS A;  2H8U A;  5DU1 A;  1HOY A;  1TXB A;  1L4W A;  1KXI A;  1MR6 A;  2JQP A;  4AEA A;  2BTX A;  1FSC A;  1HAA A;  1S4Y A;  1IDH A;  1CRE A;  1COE A;  1JBD A;  1W6B A;  4DO8 A;  1ES7 B;  5IMY C;  1H0J A;  1FRA A;  2MFA A;  3EBX A;  2J8B A;  2CTX A;  2H7Z B;  1TFS A;  2GOO C;  1KC4 A;  2H64 B;  3ERA A;  1ERG A;  4P7U A;  2LA1 A;  1QM7 A;  1NOR A;  1CB9 A;  1CXO A;  1IK8 A;  1IDL A;  1DRS A;  1BTE A;  5DO6 A;  3U74 U;  3NEQ A;  2H5F A;  2H62 C;  4OM5 A;  2PJY C;  1KU6 B;  1CHV S;  1LXH A;  4ZQY A;  1ONJ A;  2FD6 U;  1CVO A;  4LFT A;  2LCR A;  1KTZ B;  1VB0 A;  1NYU A;  1NEA A;  4HQP F;  1RL5 A;  1BXP A;  1KFH A;  3KFD E;  1TGX A;  3HH7 A;  1G6M A;  2N99 A;  1KL8 A;  1LXG A;  3NH7 A;  2NBT A;  2QJB C;  4OM4 A;  1CXN A;  2CCX A;  1I02 A;  2ERA A;  1CCQ A;  2UX2 A;  5EBX A;  1JGK A;  2HLQ A;  2L03 A;  1V6P A;  2ABX A;  1ERA A;  3BT1 U;  1B41 B;  3EVS C;  2QC1 A;  5DZ5 A;  1HAJ A;  2MHY A;  3PLC A;  2CRT A;  1FFJ A;  2MJ0 A;  1PLO A;  1CDR A;  2CDX A;  2I9B E;  1HC9 A;  4RUD A;  1LX5 B;  2X8B B;  1CDT A;  1NYS A;  1IJC A;  3VTS A;  1YWH A;  4XJJ A;  2UWR A;  1FF4 A;  1QKE A;  2HLR A;  2H64 C;  3FEV A;  1IDG A;  2L5S A;  1QKD A;  1XT3 A;  2MUP A;  2GOO B;  6EBX A;  2MJ4 A;  1FSS B;  1M9Z A;  2VLW A; 
#chains in the Genus database with same CATH homology
 3U73 U;  1COD A;  1CDS A;  2MJY A;  2BHI A;  1KBA A;  4EY8 B;  2K3G A;  1IDI A;  2QJ9 C;  4BIK B;  2JVE A;  2H7Z A;  2PJY B;  2MUO A;  1UG4 A;  3KFD I;  4KSN A;  2OFS A;  1IKC A;  2CRS A;  4FAO C;  1TXA A;  4QTI U;  1ABT A;  5IMT D;  3NDS A;  2H62 D;  1LSI A;  3LAQ U;  4UY2 C;  1HC9 B;  1CDQ A;  1KBT A;  1KS6 A;  4IYE A;  1IQ9 A;  3QB4 B;  4FAO E;  1FAS A;  1CRF A;  1RGJ A;  1LJZ A;  1NXB A;  1MAH F;  1NTX A;  1ZAD A;  2QJA C;  1F8U B;  3BT2 U;  1REW C;  1NTN A;  1CTX A;  4BDT B;  1JE9 A;  1F94 A;  1KBS A;  2H8U A;  5DU1 A;  1HOY A;  1TXB A;  1L4W A;  1KXI A;  1MR6 A;  2JQP A;  4AEA A;  2BTX A;  1FSC A;  1HAA A;  1S4Y A;  1IDH A;  1CRE A;  1COE A;  1JBD A;  1W6B A;  4DO8 A;  1ES7 B;  5IMY C;  1H0J A;  1FRA A;  2MFA A;  3EBX A;  2J8B A;  2CTX A;  2H7Z B;  1TFS A;  2GOO C;  1KC4 A;  2H64 B;  3ERA A;  1ERG A;  4P7U A;  2LA1 A;  1QM7 A;  1NOR A;  1CB9 A;  1CXO A;  1IK8 A;  1IDL A;  1DRS A;  1BTE A;  5DO6 A;  3U74 U;  3NEQ A;  2H5F A;  2H62 C;  4OM5 A;  2PJY C;  1KU6 B;  1CHV S;  1LXH A;  4ZQY A;  1ONJ A;  2FD6 U;  1CVO A;  4LFT A;  2LCR A;  1KTZ B;  1VB0 A;  1NYU A;  1NEA A;  4HQP F;  1RL5 A;  1BXP A;  1KFH A;  3KFD E;  1TGX A;  3HH7 A;  1G6M A;  2N99 A;  1KL8 A;  1LXG A;  3NH7 A;  2NBT A;  2QJB C;  4OM4 A;  1CXN A;  2CCX A;  1I02 A;  2ERA A;  1CCQ A;  2UX2 A;  5EBX A;  1JGK A;  2HLQ A;  2L03 A;  1V6P A;  2ABX A;  1ERA A;  3BT1 U;  1B41 B;  3EVS C;  2QC1 A;  5DZ5 A;  1HAJ A;  2MHY A;  3PLC A;  2CRT A;  1FFJ A;  2MJ0 A;  1PLO A;  1CDR A;  2CDX A;  2I9B E;  1HC9 A;  4RUD A;  1LX5 B;  2X8B B;  1CDT A;  1NYS A;  1IJC A;  3VTS A;  1YWH A;  4XJJ A;  2UWR A;  1FF4 A;  1QKE A;  2HLR A;  2H64 C;  3FEV A;  1IDG A;  2L5S A;  1QKD A;  1XT3 A;  2MUP A;  2GOO B;  6EBX A;  2MJ4 A;  1FSS B;  1M9Z A;  2VLW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...