3BT2U

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
276
structure length
259
Chain Sequence
SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQLGDAFSMNHIDVSCCTKSGCNHPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 259
sequence length 276
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U02
1ABTA 2FD6U 2QC1A 2CCXA 1COEA 4IYEA 1HC9B 1VB0A 2L5SA 2MUPA 3EVSC 1G6MA 1NTNA 3PLCA 1CRFA 5IMYC 1V6PA 3FEVA 2GOOB 2MUOA 1CXNA 1IDGA 1YWHA 2J8BA 2ABXA 1IQ9A 1QKEA 2CRTA 2BTXA 1TXBA 1XT3A 2JQPA 1B41B 2UX2A 4OM4A 4RUDA 6EBXA 1JE9A 1CXOA 2H64C 4OM5A 1KL8A 1LXHA 1IDIA 1FASA 3EBXA 3KFDE 2H8UA 1CDRA 1CCQA 2I9BE 1FRAA 3BT2U 2X8BB 1H0JA 4BDTB 1IDHA 2LA1A 3NDSA 3U74U 1NORA 1CDTA 1FSCA 1CODA 1KTZB 1ES7B 3NH7A 1ERAA 4XJJA 4FAOE 1KBTA 1DRSA 1CTXA 2BHIA 4EY8B 5EBXA 3NEQA 1MR6A 1NYSA 1CDQA 1L4WA 2LCRA 1IJCA 2PJYB 1ERGA 1FSSB 1NEAA 2MHYA 1RL5A 1NXBA 3U73U 2K3GA 1IK8A 1BXPA 1KFHA 1M9ZA 2ERAA 1LJZA 2H7ZA 1JGKA 4FAOC 5DO6A 2HLQA 1HAAA 1JBDA 2MJ4A 2MFAA 4BIKB 2JVEA 5DU1A 1KS6A 2H62C 2OFSA 1UG4A 1FF4A 2UWRA 1QM7A 4P7UA 1HAJA 1REWC 1ONJA 1LSIA 1W6BA 2MJYA 1NYUA 2HLRA 2N99A 2QJAC 4DO8A 3LAQU 2H5FA 2VLWA 1TGXA 2L03A 1S4YA 2H7ZB 4QTIU 4AEAA 3BT1U 3ERAA 1KU6B 1TFSA 1F94A 2GOOC 1LXGA 1MAHF 3HH7A 1IKCA 1KXIA 5DZ5A 2CTXA 2MJ0A 1FFJA 1CDSA 3KFDI 1QKDA 2H64B 1ZADA 3QB4B 2QJ9C 2QJBC 1HC9A 1TXAA 1RGJA 1LX5B 1PLOA 1KBAA 4HQPF 4UY2C 1CHVS 4ZQYA 1IDLA 1F8UB 1CB9A 1CREA 2CDXA 2H62D 1KBSA 2NBTA 1CVOA 1KC4A 4LFTA 3VTSA 1HOYA 2CRSA 2PJYC 1I02A 1BTEA 5IMTD 1NTXA
chains in the Genus database with same CATH superfamily
1ABTA 2FD6U 2QC1A 2CCXA 1COEA 4IYEA 1HC9B 1VB0A 2L5SA 2MUPA 3EVSC 1G6MA 1NTNA 3PLCA 1CRFA 5IMYC 1V6PA 3FEVA 2GOOB 2MUOA 1CXNA 1IDGA 1YWHA 2J8BA 2ABXA 1IQ9A 1QKEA 2CRTA 2BTXA 1TXBA 1XT3A 2JQPA 1B41B 2UX2A 4OM4A 4RUDA 6EBXA 1JE9A 1CXOA 2H64C 4OM5A 1KL8A 1LXHA 1IDIA 1FASA 3EBXA 3KFDE 2H8UA 1CDRA 1CCQA 2I9BE 1FRAA 3BT2U 2X8BB 1H0JA 4KSNA 4BDTB 2LA1A 1IDHA 3NDSA 3U74U 1NORA 1CDTA 1FSCA 1CODA 1KTZB 1ES7B 3NH7A 1ERAA 4XJJA 4FAOE 1KBTA 1DRSA 1CTXA 2BHIA 4EY8B 5EBXA 3NEQA 1MR6A 1NYSA 1CDQA 1L4WA 2LCRA 1IJCA 2PJYB 1ERGA 1FSSB 1NEAA 2MHYA 1RL5A 1NXBA 3U73U 2K3GA 1IK8A 1BXPA 1KFHA 1M9ZA 2ERAA 1LJZA 2H7ZA 1JGKA 4FAOC 5DO6A 2HLQA 1HAAA 1JBDA 2MJ4A 2MFAA 4BIKB 2JVEA 5DU1A 1KS6A 2H62C 2OFSA 1UG4A 1FF4A 2UWRA 1QM7A 4P7UA 1HAJA 1REWC 1ONJA 1LSIA 1W6BA 2MJYA 1NYUA 2HLRA 2N99A 2QJAC 4DO8A 3LAQU 2H5FA 2VLWA 1TGXA 2L03A 1S4YA 2H7ZB 4QTIU 4AEAA 3BT1U 3ERAA 1KU6B 1TFSA 1F94A 2GOOC 1LXGA 1MAHF 3HH7A 1IKCA 1KXIA 5DZ5A 2CTXA 2MJ0A 1FFJA 1CDSA 3KFDI 1QKDA 2H64B 1ZADA 3QB4B 2QJ9C 2QJBC 1HC9A 1TXAA 1RGJA 1LX5B 1PLOA 1KBAA 4HQPF 4UY2C 1CHVS 4ZQYA 1IDLA 1F8UB 1CB9A 1CREA 2CDXA 2H62D 1KBSA 2NBTA 1CVOA 1KC4A 4LFTA 3VTSA 1HOYA 2CRSA 2PJYC 1I02A 1BTEA 5IMTD 1NTXA
chains in the Genus database with same CATH topology
1ABTA 2FD6U 2QC1A 2CCXA 1COEA 4IYEA 1HC9B 1VB0A 2L5SA 2MUPA 3EVSC 1G6MA 1NTNA 3PLCA 1CRFA 5IMYC 1V6PA 3FEVA 2GOOB 2MUOA 1CXNA 1IDGA 1YWHA 2J8BA 2ABXA 1IQ9A 1QKEA 2CRTA 2BTXA 1TXBA 1XT3A 2JQPA 1B41B 2UX2A 4OM4A 4RUDA 6EBXA 1JE9A 1CXOA 2H64C 4OM5A 1KL8A 1LXHA 1IDIA 1FASA 3EBXA 3KFDE 2H8UA 1CDRA 1CCQA 2I9BE 1FRAA 3BT2U 2X8BB 1H0JA 4KSNA 4BDTB 2LA1A 1IDHA 3NDSA 3U74U 1NORA 1CDTA 1FSCA 1CODA 1KTZB 1ES7B 3NH7A 1ERAA 4XJJA 4FAOE 1KBTA 1DRSA 1CTXA 2BHIA 4EY8B 5EBXA 3NEQA 1MR6A 1NYSA 1CDQA 1L4WA 2LCRA 1IJCA 2PJYB 1ERGA 1FSSB 1NEAA 2MHYA 1RL5A 1NXBA 3U73U 2K3GA 1IK8A 1BXPA 1KFHA 1M9ZA 2ERAA 1LJZA 2H7ZA 1JGKA 4FAOC 5DO6A 2HLQA 1HAAA 1JBDA 2MJ4A 2MFAA 4BIKB 2JVEA 5DU1A 1KS6A 2H62C 2OFSA 1UG4A 1FF4A 2UWRA 1QM7A 4P7UA 1HAJA 1REWC 1ONJA 1LSIA 1W6BA 2MJYA 1NYUA 2HLRA 2N99A 2QJAC 4DO8A 3LAQU 2H5FA 2VLWA 1TGXA 2L03A 1S4YA 2H7ZB 4QTIU 4AEAA 3BT1U 3ERAA 1KU6B 1TFSA 1F94A 2GOOC 1LXGA 1MAHF 3HH7A 1IKCA 1KXIA 5DZ5A 2CTXA 2MJ0A 1FFJA 1CDSA 3KFDI 1QKDA 2H64B 1ZADA 3QB4B 2QJ9C 2QJBC 1HC9A 1TXAA 1RGJA 1LX5B 1PLOA 1KBAA 4HQPF 4UY2C 1CHVS 4ZQYA 1IDLA 1F8UB 1CB9A 1CREA 2CDXA 2H62D 1KBSA 2NBTA 1CVOA 1KC4A 4LFTA 3VTSA 1HOYA 2CRSA 2PJYC 1I02A 1BTEA 5IMTD 1NTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ABT A;  2FD6 U;  2QC1 A;  2CCX A;  1COE A;  4IYE A;  1HC9 B;  1VB0 A;  2L5S A;  2MUP A;  3EVS C;  1G6M A;  1NTN A;  3PLC A;  1CRF A;  5IMY C;  1V6P A;  3FEV A;  2GOO B;  2MUO A;  1CXN A;  1IDG A;  1YWH A;  2J8B A;  2ABX A;  1IQ9 A;  1QKE A;  2CRT A;  2BTX A;  1TXB A;  1XT3 A;  2JQP A;  1B41 B;  2UX2 A;  4OM4 A;  4RUD A;  6EBX A;  1JE9 A;  1CXO A;  2H64 C;  4OM5 A;  1KL8 A;  1LXH A;  1IDI A;  1FAS A;  3EBX A;  3KFD E;  2H8U A;  1CDR A;  1CCQ A;  2I9B E;  1FRA A;  3BT2 U;  2X8B B;  1H0J A;  4BDT B;  1IDH A;  2LA1 A;  3NDS A;  3U74 U;  1NOR A;  1CDT A;  1FSC A;  1COD A;  1KTZ B;  1ES7 B;  3NH7 A;  1ERA A;  4XJJ A;  4FAO E;  1KBT A;  1DRS A;  1CTX A;  2BHI A;  4EY8 B;  5EBX A;  3NEQ A;  1MR6 A;  1NYS A;  1CDQ A;  1L4W A;  2LCR A;  1IJC A;  2PJY B;  1ERG A;  1FSS B;  1NEA A;  2MHY A;  1RL5 A;  1NXB A;  3U73 U;  2K3G A;  1IK8 A;  1BXP A;  1KFH A;  1M9Z A;  2ERA A;  1LJZ A;  2H7Z A;  1JGK A;  4FAO C;  5DO6 A;  2HLQ A;  1HAA A;  1JBD A;  2MJ4 A;  2MFA A;  4BIK B;  2JVE A;  5DU1 A;  1KS6 A;  2H62 C;  2OFS A;  1UG4 A;  1FF4 A;  2UWR A;  1QM7 A;  4P7U A;  1HAJ A;  1REW C;  1ONJ A;  1LSI A;  1W6B A;  2MJY A;  1NYU A;  2HLR A;  2N99 A;  2QJA C;  4DO8 A;  3LAQ U;  2H5F A;  2VLW A;  1TGX A;  2L03 A;  1S4Y A;  2H7Z B;  4QTI U;  4AEA A;  3BT1 U;  3ERA A;  1KU6 B;  1TFS A;  1F94 A;  2GOO C;  1LXG A;  1MAH F;  3HH7 A;  1IKC A;  1KXI A;  5DZ5 A;  2CTX A;  2MJ0 A;  1FFJ A;  1CDS A;  3KFD I;  1QKD A;  2H64 B;  1ZAD A;  3QB4 B;  2QJ9 C;  2QJB C;  1HC9 A;  1TXA A;  1RGJ A;  1LX5 B;  1PLO A;  1KBA A;  4HQP F;  4UY2 C;  1CHV S;  4ZQY A;  1IDL A;  1F8U B;  1CB9 A;  1CRE A;  2CDX A;  2H62 D;  1KBS A;  2NBT A;  1CVO A;  1KC4 A;  4LFT A;  3VTS A;  1HOY A;  2CRS A;  2PJY C;  1I02 A;  1BTE A;  5IMT D;  1NTX A; 
#chains in the Genus database with same CATH topology
 1ABT A;  2FD6 U;  2QC1 A;  2CCX A;  1COE A;  4IYE A;  1HC9 B;  1VB0 A;  2L5S A;  2MUP A;  3EVS C;  1G6M A;  1NTN A;  3PLC A;  1CRF A;  5IMY C;  1V6P A;  3FEV A;  2GOO B;  2MUO A;  1CXN A;  1IDG A;  1YWH A;  2J8B A;  2ABX A;  1IQ9 A;  1QKE A;  2CRT A;  2BTX A;  1TXB A;  1XT3 A;  2JQP A;  1B41 B;  2UX2 A;  4OM4 A;  4RUD A;  6EBX A;  1JE9 A;  1CXO A;  2H64 C;  4OM5 A;  1KL8 A;  1LXH A;  1IDI A;  1FAS A;  3EBX A;  3KFD E;  2H8U A;  1CDR A;  1CCQ A;  2I9B E;  1FRA A;  3BT2 U;  2X8B B;  1H0J A;  4KSN A;  4BDT B;  2LA1 A;  1IDH A;  3NDS A;  3U74 U;  1NOR A;  1CDT A;  1FSC A;  1COD A;  1KTZ B;  1ES7 B;  3NH7 A;  1ERA A;  4XJJ A;  4FAO E;  1KBT A;  1DRS A;  1CTX A;  2BHI A;  4EY8 B;  5EBX A;  3NEQ A;  1MR6 A;  1NYS A;  1CDQ A;  1L4W A;  2LCR A;  1IJC A;  2PJY B;  1ERG A;  1FSS B;  1NEA A;  2MHY A;  1RL5 A;  1NXB A;  3U73 U;  2K3G A;  1IK8 A;  1BXP A;  1KFH A;  1M9Z A;  2ERA A;  1LJZ A;  2H7Z A;  1JGK A;  4FAO C;  5DO6 A;  2HLQ A;  1HAA A;  1JBD A;  2MJ4 A;  2MFA A;  4BIK B;  2JVE A;  5DU1 A;  1KS6 A;  2H62 C;  2OFS A;  1UG4 A;  1FF4 A;  2UWR A;  1QM7 A;  4P7U A;  1HAJ A;  1REW C;  1ONJ A;  1LSI A;  1W6B A;  2MJY A;  1NYU A;  2HLR A;  2N99 A;  2QJA C;  4DO8 A;  3LAQ U;  2H5F A;  2VLW A;  1TGX A;  2L03 A;  1S4Y A;  2H7Z B;  4QTI U;  4AEA A;  3BT1 U;  3ERA A;  1KU6 B;  1TFS A;  1F94 A;  2GOO C;  1LXG A;  1MAH F;  3HH7 A;  1IKC A;  1KXI A;  5DZ5 A;  2CTX A;  2MJ0 A;  1FFJ A;  1CDS A;  3KFD I;  1QKD A;  2H64 B;  1ZAD A;  3QB4 B;  2QJ9 C;  2QJB C;  1HC9 A;  1TXA A;  1RGJ A;  1LX5 B;  1PLO A;  1KBA A;  4HQP F;  4UY2 C;  1CHV S;  4ZQY A;  1IDL A;  1F8U B;  1CB9 A;  1CRE A;  2CDX A;  2H62 D;  1KBS A;  2NBT A;  1CVO A;  1KC4 A;  4LFT A;  3VTS A;  1HOY A;  2CRS A;  2PJY C;  1I02 A;  1BTE A;  5IMT D;  1NTX A; 
#chains in the Genus database with same CATH homology
 1ABT A;  2FD6 U;  2QC1 A;  2CCX A;  1COE A;  4IYE A;  1HC9 B;  1VB0 A;  2L5S A;  2MUP A;  3EVS C;  1G6M A;  1NTN A;  3PLC A;  1CRF A;  5IMY C;  1V6P A;  3FEV A;  2GOO B;  2MUO A;  1CXN A;  1IDG A;  1YWH A;  2J8B A;  2ABX A;  1IQ9 A;  1QKE A;  2CRT A;  2BTX A;  1TXB A;  1XT3 A;  2JQP A;  1B41 B;  2UX2 A;  4OM4 A;  4RUD A;  6EBX A;  1JE9 A;  1CXO A;  2H64 C;  4OM5 A;  1KL8 A;  1LXH A;  1IDI A;  1FAS A;  3EBX A;  3KFD E;  2H8U A;  1CDR A;  1CCQ A;  2I9B E;  1FRA A;  3BT2 U;  2X8B B;  1H0J A;  4KSN A;  4BDT B;  2LA1 A;  1IDH A;  3NDS A;  3U74 U;  1NOR A;  1CDT A;  1FSC A;  1COD A;  1KTZ B;  1ES7 B;  3NH7 A;  1ERA A;  4XJJ A;  4FAO E;  1KBT A;  1DRS A;  1CTX A;  2BHI A;  4EY8 B;  5EBX A;  3NEQ A;  1MR6 A;  1NYS A;  1CDQ A;  1L4W A;  2LCR A;  1IJC A;  2PJY B;  1ERG A;  1FSS B;  1NEA A;  2MHY A;  1RL5 A;  1NXB A;  3U73 U;  2K3G A;  1IK8 A;  1BXP A;  1KFH A;  1M9Z A;  2ERA A;  1LJZ A;  2H7Z A;  1JGK A;  4FAO C;  5DO6 A;  2HLQ A;  1HAA A;  1JBD A;  2MJ4 A;  2MFA A;  4BIK B;  2JVE A;  5DU1 A;  1KS6 A;  2H62 C;  2OFS A;  1UG4 A;  1FF4 A;  2UWR A;  1QM7 A;  4P7U A;  1HAJ A;  1REW C;  1ONJ A;  1LSI A;  1W6B A;  2MJY A;  1NYU A;  2HLR A;  2N99 A;  2QJA C;  4DO8 A;  3LAQ U;  2H5F A;  2VLW A;  1TGX A;  2L03 A;  1S4Y A;  2H7Z B;  4QTI U;  4AEA A;  3BT1 U;  3ERA A;  1KU6 B;  1TFS A;  1F94 A;  2GOO C;  1LXG A;  1MAH F;  3HH7 A;  1IKC A;  1KXI A;  5DZ5 A;  2CTX A;  2MJ0 A;  1FFJ A;  1CDS A;  3KFD I;  1QKD A;  2H64 B;  1ZAD A;  3QB4 B;  2QJ9 C;  2QJB C;  1HC9 A;  1TXA A;  1RGJ A;  1LX5 B;  1PLO A;  1KBA A;  4HQP F;  4UY2 C;  1CHV S;  4ZQY A;  1IDL A;  1F8U B;  1CB9 A;  1CRE A;  2CDX A;  2H62 D;  1KBS A;  2NBT A;  1CVO A;  1KC4 A;  4LFT A;  3VTS A;  1HOY A;  2CRS A;  2PJY C;  1I02 A;  1BTE A;  5IMT D;  1NTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...