3BT2U

Structure of urokinase receptor, urokinase and vitronectin complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
276
structure length
259
Chain Sequence
b'SLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQLGDAFSMNHIDVSCCTKSGCNHPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Crystal structures of two human vitronectin, urokinase and urokinase receptor complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 259
sequence length 276
ec nomenclature
pdb deposition date 2007-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U01
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U03
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3bt2U02
1CDQA 1PLOA 4OM5A 4RUDA 1KXIA 1LJZA 1ZADA 2BTXA 3U73U 1JGKA 1CREA 1IJCA 3KFDE 2GOOC 1FSCA 1ABTA 1FRAA 1UG4A 4BDTB 2MFAA 2QJ9C 3KFDI 1KBSA 2QC1A 5DO6A 2MJ4A 1LX5B 2BHIA 1CDRA 1COEA 1TFSA 1RGJA 3NDSA 4IYEA 2L5SA 5EBXA 2X8BB 1RL5A 2H8UA 2PJYB 2H5FA 1LXHA 3BT2U 2MUOA 2J8BA 1ES7B 1FF4A 1LSIA 2MJYA 3EVSC 2MJ0A 1KU6B 2CRTA 2GOOB 1IK8A 2LA1A 1HAAA 1QKDA 1IKCA 1CB9A 3EBXA 2QJAC 2UWRA 2OFSA 2ERAA 1CDTA 1ERAA 2CDXA 1CRFA 3QB4B 1BTEA 1ERGA 1NXBA 1FFJA 1JE9A 1CODA 2H62C 1F8UB 1KBAA 1KTZB 2JVEA 1KS6A 1QM7A 2CCXA 3HH7A 1V6PA 2MUPA 1YWHA 1CHVS 1QKEA 1CXOA 1XT3A 1M9ZA 1IDLA 3FEVA 4ZQYA 4FAOE 1HAJA 1L4WA 4DO8A 3ERAA 1FSSB 6EBXA 2H64C 3NEQA 1FASA 5IMYC 1KFHA 1JBDA 4OM4A 1IQ9A 1HC9A 2L03A 5IMTD 2H7ZA 1LXGA 2I9BE 3PLCA 4EY8B 1KC4A 1TXBA 1KL8A 1ONJA 1TXAA 1IDGA 2CRSA 1I02A 2ABXA 3NH7A 1MR6A 1F94A 1NTNA 2UX2A 1CCQA 1IDIA 1S4YA 3LAQU 2H62D 4FAOC 2LCRA 2FD6U 4XJJA 2CTXA 1NEAA 1REWC 2H64B 1NYUA 4QTIU 1CVOA 1MAHF 1NTXA 2HLRA 1W6BA 4UY2C 1NORA 1TGXA 2MHYA 1BXPA 1CXNA 1VB0A 1HC9B 1H0JA 5DZ5A 1DRSA 2HLQA 4BIKB 2H7ZB 2QJBC 4P7UA 2K3GA 1HOYA 2NBTA 1IDHA 3VTSA 4LFTA 5DU1A 1KBTA 2JQPA 2VLWA 4HQPF 3U74U 1CDSA 1B41B 4AEAA 1NYSA 2N99A 1CTXA 2PJYC 1G6MA 3BT1U
chains in the Genus database with same CATH superfamily
1CDQA 1PLOA 4OM5A 4RUDA 1KXIA 1LJZA 1ZADA 2BTXA 3U73U 1JGKA 1CREA 1IJCA 3KFDE 2GOOC 1FSCA 1ABTA 1FRAA 1UG4A 4BDTB 2MFAA 2QJ9C 3KFDI 1KBSA 2QC1A 5DO6A 2MJ4A 1LX5B 2BHIA 1CDRA 1COEA 1TFSA 1RGJA 3NDSA 4IYEA 2L5SA 5EBXA 2X8BB 1RL5A 2H8UA 2PJYB 2H5FA 1LXHA 3BT2U 2MUOA 2J8BA 1ES7B 1FF4A 1LSIA 2MJYA 3EVSC 2MJ0A 1KU6B 2CRTA 2GOOB 1IK8A 2LA1A 1HAAA 1QKDA 1IKCA 1CB9A 3EBXA 2QJAC 2UWRA 2OFSA 2ERAA 1CDTA 1ERAA 2CDXA 1CRFA 3QB4B 1BTEA 1ERGA 1NXBA 1FFJA 1JE9A 1CODA 2H62C 1F8UB 1KBAA 4KSNA 1KTZB 2JVEA 1KS6A 1QM7A 2CCXA 3HH7A 1V6PA 2MUPA 1YWHA 1CHVS 1QKEA 1CXOA 1XT3A 1M9ZA 1IDLA 3FEVA 4ZQYA 4FAOE 1HAJA 1L4WA 4DO8A 3ERAA 1FSSB 6EBXA 2H64C 3NEQA 1FASA 5IMYC 1KFHA 1JBDA 4OM4A 1IQ9A 1HC9A 2L03A 5IMTD 2H7ZA 1LXGA 2I9BE 3PLCA 4EY8B 1KC4A 1TXBA 1KL8A 1ONJA 1TXAA 1IDGA 2CRSA 1I02A 2ABXA 3NH7A 1MR6A 1F94A 1NTNA 2UX2A 1CCQA 1IDIA 1S4YA 3LAQU 2H62D 4FAOC 2LCRA 2FD6U 4XJJA 2CTXA 1NEAA 1REWC 2H64B 1NYUA 4QTIU 1CVOA 1MAHF 1NTXA 2HLRA 1W6BA 4UY2C 1NORA 1TGXA 2MHYA 1BXPA 1CXNA 1VB0A 1HC9B 1H0JA 5DZ5A 1DRSA 2HLQA 4BIKB 2H7ZB 2QJBC 4P7UA 2K3GA 1HOYA 2NBTA 1IDHA 3VTSA 4LFTA 5DU1A 1KBTA 2JQPA 2VLWA 4HQPF 3U74U 1CDSA 1B41B 4AEAA 1NYSA 2N99A 1CTXA 2PJYC 1G6MA 3BT1U
chains in the Genus database with same CATH topology
1CDQA 1PLOA 4OM5A 4RUDA 1KXIA 1LJZA 1ZADA 2BTXA 3U73U 1JGKA 1CREA 1IJCA 3KFDE 2GOOC 1FSCA 1ABTA 1FRAA 1UG4A 4BDTB 2MFAA 2QJ9C 3KFDI 1KBSA 2QC1A 5DO6A 2MJ4A 1LX5B 2BHIA 1CDRA 1COEA 1TFSA 1RGJA 3NDSA 4IYEA 2L5SA 5EBXA 2X8BB 1RL5A 2H8UA 2PJYB 2H5FA 1LXHA 3BT2U 2MUOA 2J8BA 1ES7B 1FF4A 1LSIA 2MJYA 3EVSC 2MJ0A 1KU6B 2CRTA 2GOOB 1IK8A 2LA1A 1HAAA 1QKDA 1IKCA 1CB9A 3EBXA 2QJAC 2UWRA 2OFSA 2ERAA 1CDTA 1ERAA 2CDXA 1CRFA 3QB4B 1BTEA 1ERGA 1NXBA 1FFJA 1JE9A 1CODA 2H62C 1F8UB 1KBAA 4KSNA 1KTZB 2JVEA 1KS6A 1QM7A 2CCXA 3HH7A 1V6PA 2MUPA 1YWHA 1CHVS 1QKEA 1CXOA 1XT3A 1M9ZA 1IDLA 3FEVA 4ZQYA 4FAOE 1HAJA 1L4WA 4DO8A 3ERAA 1FSSB 6EBXA 2H64C 3NEQA 1FASA 5IMYC 1KFHA 1JBDA 4OM4A 1IQ9A 1HC9A 2L03A 5IMTD 2H7ZA 1LXGA 2I9BE 3PLCA 4EY8B 1KC4A 1TXBA 1KL8A 1ONJA 1TXAA 1IDGA 2CRSA 1I02A 2ABXA 3NH7A 1MR6A 1F94A 1NTNA 2UX2A 1CCQA 1IDIA 1S4YA 3LAQU 2H62D 4FAOC 2LCRA 2FD6U 4XJJA 2CTXA 1NEAA 1REWC 2H64B 1NYUA 4QTIU 1CVOA 1MAHF 1NTXA 2HLRA 1W6BA 4UY2C 1NORA 1TGXA 2MHYA 1BXPA 1CXNA 1VB0A 1HC9B 1H0JA 5DZ5A 1DRSA 2HLQA 4BIKB 2H7ZB 2QJBC 4P7UA 2K3GA 1HOYA 2NBTA 1IDHA 3VTSA 4LFTA 5DU1A 1KBTA 2JQPA 2VLWA 4HQPF 3U74U 1CDSA 1B41B 4AEAA 1NYSA 2N99A 1CTXA 2PJYC 1G6MA 3BT1U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CDQ A;  1PLO A;  4OM5 A;  4RUD A;  1KXI A;  1LJZ A;  1ZAD A;  2BTX A;  3U73 U;  1JGK A;  1CRE A;  1IJC A;  3KFD E;  2GOO C;  1FSC A;  1ABT A;  1FRA A;  1UG4 A;  4BDT B;  2MFA A;  2QJ9 C;  3KFD I;  1KBS A;  2QC1 A;  5DO6 A;  2MJ4 A;  1LX5 B;  2BHI A;  1CDR A;  1COE A;  1TFS A;  1RGJ A;  3NDS A;  4IYE A;  2L5S A;  5EBX A;  2X8B B;  1RL5 A;  2H8U A;  2PJY B;  2H5F A;  1LXH A;  3BT2 U;  2MUO A;  2J8B A;  1ES7 B;  1FF4 A;  1LSI A;  2MJY A;  3EVS C;  2MJ0 A;  1KU6 B;  2CRT A;  2GOO B;  1IK8 A;  2LA1 A;  1HAA A;  1QKD A;  1IKC A;  1CB9 A;  3EBX A;  2QJA C;  2UWR A;  2OFS A;  2ERA A;  1CDT A;  1ERA A;  2CDX A;  1CRF A;  3QB4 B;  1BTE A;  1ERG A;  1NXB A;  1FFJ A;  1JE9 A;  1COD A;  2H62 C;  1F8U B;  1KBA A;  1KTZ B;  2JVE A;  1KS6 A;  1QM7 A;  2CCX A;  3HH7 A;  1V6P A;  2MUP A;  1YWH A;  1CHV S;  1QKE A;  1CXO A;  1XT3 A;  1M9Z A;  1IDL A;  3FEV A;  4ZQY A;  4FAO E;  1HAJ A;  1L4W A;  4DO8 A;  3ERA A;  1FSS B;  6EBX A;  2H64 C;  3NEQ A;  1FAS A;  5IMY C;  1KFH A;  1JBD A;  4OM4 A;  1IQ9 A;  1HC9 A;  2L03 A;  5IMT D;  2H7Z A;  1LXG A;  2I9B E;  3PLC A;  4EY8 B;  1KC4 A;  1TXB A;  1KL8 A;  1ONJ A;  1TXA A;  1IDG A;  2CRS A;  1I02 A;  2ABX A;  3NH7 A;  1MR6 A;  1F94 A;  1NTN A;  2UX2 A;  1CCQ A;  1IDI A;  1S4Y A;  3LAQ U;  2H62 D;  4FAO C;  2LCR A;  2FD6 U;  4XJJ A;  2CTX A;  1NEA A;  1REW C;  2H64 B;  1NYU A;  4QTI U;  1CVO A;  1MAH F;  1NTX A;  2HLR A;  1W6B A;  4UY2 C;  1NOR A;  1TGX A;  2MHY A;  1BXP A;  1CXN A;  1VB0 A;  1HC9 B;  1H0J A;  5DZ5 A;  1DRS A;  2HLQ A;  4BIK B;  2H7Z B;  2QJB C;  4P7U A;  2K3G A;  1HOY A;  2NBT A;  1IDH A;  3VTS A;  4LFT A;  5DU1 A;  1KBT A;  2JQP A;  2VLW A;  4HQP F;  3U74 U;  1CDS A;  1B41 B;  4AEA A;  1NYS A;  2N99 A;  1CTX A;  2PJY C;  1G6M A;  3BT1 U; 
#chains in the Genus database with same CATH topology
 1CDQ A;  1PLO A;  4OM5 A;  4RUD A;  1KXI A;  1LJZ A;  1ZAD A;  2BTX A;  3U73 U;  1JGK A;  1CRE A;  1IJC A;  3KFD E;  2GOO C;  1FSC A;  1ABT A;  1FRA A;  1UG4 A;  4BDT B;  2MFA A;  2QJ9 C;  3KFD I;  1KBS A;  2QC1 A;  5DO6 A;  2MJ4 A;  1LX5 B;  2BHI A;  1CDR A;  1COE A;  1TFS A;  1RGJ A;  3NDS A;  4IYE A;  2L5S A;  5EBX A;  2X8B B;  1RL5 A;  2H8U A;  2PJY B;  2H5F A;  1LXH A;  3BT2 U;  2MUO A;  2J8B A;  1ES7 B;  1FF4 A;  1LSI A;  2MJY A;  3EVS C;  2MJ0 A;  1KU6 B;  2CRT A;  2GOO B;  1IK8 A;  2LA1 A;  1HAA A;  1QKD A;  1IKC A;  1CB9 A;  3EBX A;  2QJA C;  2UWR A;  2OFS A;  2ERA A;  1CDT A;  1ERA A;  2CDX A;  1CRF A;  3QB4 B;  1BTE A;  1ERG A;  1NXB A;  1FFJ A;  1JE9 A;  1COD A;  2H62 C;  1F8U B;  1KBA A;  4KSN A;  1KTZ B;  2JVE A;  1KS6 A;  1QM7 A;  2CCX A;  3HH7 A;  1V6P A;  2MUP A;  1YWH A;  1CHV S;  1QKE A;  1CXO A;  1XT3 A;  1M9Z A;  1IDL A;  3FEV A;  4ZQY A;  4FAO E;  1HAJ A;  1L4W A;  4DO8 A;  3ERA A;  1FSS B;  6EBX A;  2H64 C;  3NEQ A;  1FAS A;  5IMY C;  1KFH A;  1JBD A;  4OM4 A;  1IQ9 A;  1HC9 A;  2L03 A;  5IMT D;  2H7Z A;  1LXG A;  2I9B E;  3PLC A;  4EY8 B;  1KC4 A;  1TXB A;  1KL8 A;  1ONJ A;  1TXA A;  1IDG A;  2CRS A;  1I02 A;  2ABX A;  3NH7 A;  1MR6 A;  1F94 A;  1NTN A;  2UX2 A;  1CCQ A;  1IDI A;  1S4Y A;  3LAQ U;  2H62 D;  4FAO C;  2LCR A;  2FD6 U;  4XJJ A;  2CTX A;  1NEA A;  1REW C;  2H64 B;  1NYU A;  4QTI U;  1CVO A;  1MAH F;  1NTX A;  2HLR A;  1W6B A;  4UY2 C;  1NOR A;  1TGX A;  2MHY A;  1BXP A;  1CXN A;  1VB0 A;  1HC9 B;  1H0J A;  5DZ5 A;  1DRS A;  2HLQ A;  4BIK B;  2H7Z B;  2QJB C;  4P7U A;  2K3G A;  1HOY A;  2NBT A;  1IDH A;  3VTS A;  4LFT A;  5DU1 A;  1KBT A;  2JQP A;  2VLW A;  4HQP F;  3U74 U;  1CDS A;  1B41 B;  4AEA A;  1NYS A;  2N99 A;  1CTX A;  2PJY C;  1G6M A;  3BT1 U; 
#chains in the Genus database with same CATH homology
 1CDQ A;  1PLO A;  4OM5 A;  4RUD A;  1KXI A;  1LJZ A;  1ZAD A;  2BTX A;  3U73 U;  1JGK A;  1CRE A;  1IJC A;  3KFD E;  2GOO C;  1FSC A;  1ABT A;  1FRA A;  1UG4 A;  4BDT B;  2MFA A;  2QJ9 C;  3KFD I;  1KBS A;  2QC1 A;  5DO6 A;  2MJ4 A;  1LX5 B;  2BHI A;  1CDR A;  1COE A;  1TFS A;  1RGJ A;  3NDS A;  4IYE A;  2L5S A;  5EBX A;  2X8B B;  1RL5 A;  2H8U A;  2PJY B;  2H5F A;  1LXH A;  3BT2 U;  2MUO A;  2J8B A;  1ES7 B;  1FF4 A;  1LSI A;  2MJY A;  3EVS C;  2MJ0 A;  1KU6 B;  2CRT A;  2GOO B;  1IK8 A;  2LA1 A;  1HAA A;  1QKD A;  1IKC A;  1CB9 A;  3EBX A;  2QJA C;  2UWR A;  2OFS A;  2ERA A;  1CDT A;  1ERA A;  2CDX A;  1CRF A;  3QB4 B;  1BTE A;  1ERG A;  1NXB A;  1FFJ A;  1JE9 A;  1COD A;  2H62 C;  1F8U B;  1KBA A;  4KSN A;  1KTZ B;  2JVE A;  1KS6 A;  1QM7 A;  2CCX A;  3HH7 A;  1V6P A;  2MUP A;  1YWH A;  1CHV S;  1QKE A;  1CXO A;  1XT3 A;  1M9Z A;  1IDL A;  3FEV A;  4ZQY A;  4FAO E;  1HAJ A;  1L4W A;  4DO8 A;  3ERA A;  1FSS B;  6EBX A;  2H64 C;  3NEQ A;  1FAS A;  5IMY C;  1KFH A;  1JBD A;  4OM4 A;  1IQ9 A;  1HC9 A;  2L03 A;  5IMT D;  2H7Z A;  1LXG A;  2I9B E;  3PLC A;  4EY8 B;  1KC4 A;  1TXB A;  1KL8 A;  1ONJ A;  1TXA A;  1IDG A;  2CRS A;  1I02 A;  2ABX A;  3NH7 A;  1MR6 A;  1F94 A;  1NTN A;  2UX2 A;  1CCQ A;  1IDI A;  1S4Y A;  3LAQ U;  2H62 D;  4FAO C;  2LCR A;  2FD6 U;  4XJJ A;  2CTX A;  1NEA A;  1REW C;  2H64 B;  1NYU A;  4QTI U;  1CVO A;  1MAH F;  1NTX A;  2HLR A;  1W6B A;  4UY2 C;  1NOR A;  1TGX A;  2MHY A;  1BXP A;  1CXN A;  1VB0 A;  1HC9 B;  1H0J A;  5DZ5 A;  1DRS A;  2HLQ A;  4BIK B;  2H7Z B;  2QJB C;  4P7U A;  2K3G A;  1HOY A;  2NBT A;  1IDH A;  3VTS A;  4LFT A;  5DU1 A;  1KBT A;  2JQP A;  2VLW A;  4HQP F;  3U74 U;  1CDS A;  1B41 B;  4AEA A;  1NYS A;  2N99 A;  1CTX A;  2PJY C;  1G6M A;  3BT1 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...