3EBXA

Refinement at 1.4 angstroms resolution of a model of erabutoxin b. treatment of ordered solvent and discrete disorder
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
62
structure length
62
Chain Sequence
RICFNHQSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords ERABUTOXIN B
publication title Refinement at 1.4 A resolution of a model of erabutoxin b: treatment of ordered solvent and discrete disorder.
pubmed doi rcsb
source organism Laticauda semifasciata
total genus 14
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1988-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 3ebxA00
3NH7A 2HLQA 1IDIA 4XJJA 4BIKB 1IK8A 2MJ0A 3NEQA 2J8BA 1IDHA 1CDRA 1YWHA 2OFSA 1KS6A 2H5FA 2MUOA 4P7UA 2UWRA 1CDQA 2VLWA 2H7ZB 1FSSB 2CCXA 1KXIA 2X8BB 1CXNA 3FEVA 1KFHA 2HLRA 1HC9A 1IKCA 1IDGA 5IMTD 4EY8B 2MFAA 2JVEA 1COEA 5DU1A 2GOOC 1CHVS 1BXPA 4ZQYA 1L4WA 5EBXA 2BTXA 2CDXA 1KU6B 3LAQU 2I9BE 1S4YA 1I02A 2N99A 1CREA 2MJYA 2H62D 3U74U 1FASA 5IMYC 1JE9A 1QKEA 2H8UA 2LCRA 4LFTA 1CCQA 1IJCA 1RL5A 1NORA 1TGXA 1QM7A 3U73U 1TXAA 2PJYC 2CRTA 2H62C 1H0JA 1HAJA 1FRAA 2ERAA 4AEAA 1JGKA 3QB4B 1KBAA 2L03A 1QKDA 4IYEA 1ZADA 1TFSA 2H64B 1CRFA 1VB0A 2H7ZA 1FFJA 3BT2U 1F94A 1W6BA 1HAAA 2JQPA 3KFDI 3VTSA 1CTXA 1CDTA 1LSIA 1TXBA 2MJ4A 1RGJA 2QJAC 1ERAA 2UX2A 2LA1A 1LXGA 4OM5A 2CTXA 1ABTA 1LXHA 1LX5B 1ERGA 2CRSA 1F8UB 2MHYA 1NYUA 1MR6A 2MUPA 4RUDA 3KFDE 4FAOE 2ABXA 4HQPF 4FAOC 3EBXA 1KTZB 2BHIA 3BT1U 1KL8A 3EVSC 1JBDA 2PJYB 5DZ5A 1CB9A 1CXOA 1NEAA 2K3GA 6EBXA 3PLCA 1HC9B 1IDLA 1NYSA 5DO6A 3NDSA 1G6MA 1NTXA 1FSCA 2GOOB 1KC4A 1CODA 1ONJA 4QTIU 1IQ9A 4DO8A 1NXBA 1FF4A 2QC1A 1CVOA 1UG4A 1BTEA 2NBTA 1V6PA 2L5SA 2QJ9C 1B41B 1PLOA 1HOYA 1XT3A 1DRSA 1KBSA 3HH7A 1KBTA 1LJZA 2FD6U 2QJBC 1MAHF 3ERAA 1CDSA 4UY2C 1ES7B 1M9ZA 2H64C 4OM4A 1REWC 4BDTB 1NTNA
chains in the Genus database with same CATH superfamily
3NH7A 2HLQA 1IDIA 4XJJA 4BIKB 1IK8A 2MJ0A 3NEQA 2J8BA 1IDHA 1CDRA 1YWHA 2OFSA 1KS6A 2H5FA 2MUOA 4P7UA 2UWRA 1CDQA 2VLWA 2H7ZB 1FSSB 2CCXA 1KXIA 2X8BB 1CXNA 3FEVA 1KFHA 2HLRA 1HC9A 1IKCA 1IDGA 5IMTD 4EY8B 2MFAA 2JVEA 1COEA 5DU1A 2GOOC 1CHVS 1BXPA 4KSNA 4ZQYA 1L4WA 5EBXA 2BTXA 2CDXA 1KU6B 3LAQU 2I9BE 1S4YA 1I02A 2N99A 1CREA 2MJYA 2H62D 3U74U 1FASA 5IMYC 1JE9A 1QKEA 2H8UA 2LCRA 4LFTA 1CCQA 1IJCA 1RL5A 1NORA 1TGXA 1QM7A 3U73U 1TXAA 2PJYC 2CRTA 2H62C 1H0JA 1HAJA 1FRAA 2ERAA 4AEAA 1JGKA 3QB4B 1KBAA 2L03A 1QKDA 4IYEA 1ZADA 1TFSA 2H64B 1CRFA 1VB0A 2H7ZA 1FFJA 3BT2U 1F94A 1W6BA 1HAAA 2JQPA 3KFDI 3VTSA 1CTXA 1CDTA 1LSIA 1TXBA 2MJ4A 1RGJA 2QJAC 1ERAA 2UX2A 2LA1A 1LXGA 4OM5A 2CTXA 1ABTA 1LXHA 1LX5B 1ERGA 2CRSA 1F8UB 2MHYA 1NYUA 1MR6A 2MUPA 4RUDA 3KFDE 4FAOE 2ABXA 4HQPF 4FAOC 3EBXA 1KTZB 2BHIA 3BT1U 1KL8A 3EVSC 1JBDA 2PJYB 5DZ5A 1CB9A 1CXOA 1NEAA 2K3GA 6EBXA 3PLCA 1HC9B 1IDLA 1NYSA 5DO6A 3NDSA 1G6MA 1NTXA 1FSCA 2GOOB 1KC4A 1CODA 1ONJA 4QTIU 1IQ9A 4DO8A 1NXBA 1FF4A 2QC1A 1CVOA 1UG4A 1BTEA 2NBTA 1V6PA 2L5SA 2QJ9C 1B41B 1PLOA 1HOYA 1XT3A 1DRSA 1KBSA 3HH7A 1KBTA 1LJZA 2FD6U 2QJBC 1MAHF 3ERAA 1CDSA 4UY2C 1ES7B 1M9ZA 2H64C 4OM4A 1REWC 4BDTB 1NTNA
chains in the Genus database with same CATH topology
3NH7A 2HLQA 1IDIA 4XJJA 4BIKB 1IK8A 2MJ0A 3NEQA 2J8BA 1IDHA 1CDRA 1YWHA 2OFSA 1KS6A 2H5FA 2MUOA 4P7UA 2UWRA 1CDQA 2VLWA 2H7ZB 1FSSB 2CCXA 1KXIA 2X8BB 1CXNA 3FEVA 1KFHA 2HLRA 1HC9A 1IKCA 1IDGA 5IMTD 4EY8B 2MFAA 2JVEA 1COEA 5DU1A 2GOOC 1CHVS 1BXPA 4KSNA 4ZQYA 1L4WA 5EBXA 2BTXA 2CDXA 1KU6B 3LAQU 2I9BE 1S4YA 1I02A 2N99A 1CREA 2MJYA 2H62D 3U74U 1FASA 5IMYC 1JE9A 1QKEA 2H8UA 2LCRA 4LFTA 1CCQA 1IJCA 1RL5A 1NORA 1TGXA 1QM7A 3U73U 1TXAA 2PJYC 2CRTA 2H62C 1H0JA 1HAJA 1FRAA 2ERAA 4AEAA 1JGKA 3QB4B 1KBAA 2L03A 1QKDA 4IYEA 1ZADA 1TFSA 2H64B 1CRFA 1VB0A 2H7ZA 1FFJA 3BT2U 1F94A 1W6BA 1HAAA 2JQPA 3KFDI 3VTSA 1CTXA 1CDTA 1LSIA 1TXBA 2MJ4A 1RGJA 2QJAC 1ERAA 2UX2A 2LA1A 1LXGA 4OM5A 2CTXA 1ABTA 1LXHA 1LX5B 1ERGA 2CRSA 1F8UB 2MHYA 1NYUA 1MR6A 2MUPA 4RUDA 3KFDE 4FAOE 2ABXA 4HQPF 4FAOC 3EBXA 1KTZB 2BHIA 3BT1U 1KL8A 3EVSC 1JBDA 2PJYB 5DZ5A 1CB9A 1CXOA 1NEAA 2K3GA 6EBXA 3PLCA 1HC9B 1IDLA 1NYSA 5DO6A 3NDSA 1G6MA 1NTXA 1FSCA 2GOOB 1KC4A 1CODA 1ONJA 4QTIU 1IQ9A 4DO8A 1NXBA 1FF4A 2QC1A 1CVOA 1UG4A 1BTEA 2NBTA 1V6PA 2L5SA 2QJ9C 1B41B 1PLOA 1HOYA 1XT3A 1DRSA 1KBSA 3HH7A 1KBTA 1LJZA 2FD6U 2QJBC 1MAHF 3ERAA 1CDSA 4UY2C 1ES7B 1M9ZA 2H64C 4OM4A 1REWC 4BDTB 1NTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH7 A;  2HLQ A;  1IDI A;  4XJJ A;  4BIK B;  1IK8 A;  2MJ0 A;  3NEQ A;  2J8B A;  1IDH A;  1CDR A;  1YWH A;  2OFS A;  1KS6 A;  2H5F A;  2MUO A;  4P7U A;  2UWR A;  1CDQ A;  2VLW A;  2H7Z B;  1FSS B;  2CCX A;  1KXI A;  2X8B B;  1CXN A;  3FEV A;  1KFH A;  2HLR A;  1HC9 A;  1IKC A;  1IDG A;  5IMT D;  4EY8 B;  2MFA A;  2JVE A;  1COE A;  5DU1 A;  2GOO C;  1CHV S;  1BXP A;  4ZQY A;  1L4W A;  5EBX A;  2BTX A;  2CDX A;  1KU6 B;  3LAQ U;  2I9B E;  1S4Y A;  1I02 A;  2N99 A;  1CRE A;  2MJY A;  2H62 D;  3U74 U;  1FAS A;  5IMY C;  1JE9 A;  1QKE A;  2H8U A;  2LCR A;  4LFT A;  1CCQ A;  1IJC A;  1RL5 A;  1NOR A;  1TGX A;  1QM7 A;  3U73 U;  1TXA A;  2PJY C;  2CRT A;  2H62 C;  1H0J A;  1HAJ A;  1FRA A;  2ERA A;  4AEA A;  1JGK A;  3QB4 B;  1KBA A;  2L03 A;  1QKD A;  4IYE A;  1ZAD A;  1TFS A;  2H64 B;  1CRF A;  1VB0 A;  2H7Z A;  1FFJ A;  3BT2 U;  1F94 A;  1W6B A;  1HAA A;  2JQP A;  3KFD I;  3VTS A;  1CTX A;  1CDT A;  1LSI A;  1TXB A;  2MJ4 A;  1RGJ A;  2QJA C;  1ERA A;  2UX2 A;  2LA1 A;  1LXG A;  4OM5 A;  2CTX A;  1ABT A;  1LXH A;  1LX5 B;  1ERG A;  2CRS A;  1F8U B;  2MHY A;  1NYU A;  1MR6 A;  2MUP A;  4RUD A;  3KFD E;  4FAO E;  2ABX A;  4HQP F;  4FAO C;  3EBX A;  1KTZ B;  2BHI A;  3BT1 U;  1KL8 A;  3EVS C;  1JBD A;  2PJY B;  5DZ5 A;  1CB9 A;  1CXO A;  1NEA A;  2K3G A;  6EBX A;  3PLC A;  1HC9 B;  1IDL A;  1NYS A;  5DO6 A;  3NDS A;  1G6M A;  1NTX A;  1FSC A;  2GOO B;  1KC4 A;  1COD A;  1ONJ A;  4QTI U;  1IQ9 A;  4DO8 A;  1NXB A;  1FF4 A;  2QC1 A;  1CVO A;  1UG4 A;  1BTE A;  2NBT A;  1V6P A;  2L5S A;  2QJ9 C;  1B41 B;  1PLO A;  1HOY A;  1XT3 A;  1DRS A;  1KBS A;  3HH7 A;  1KBT A;  1LJZ A;  2FD6 U;  2QJB C;  1MAH F;  3ERA A;  1CDS A;  4UY2 C;  1ES7 B;  1M9Z A;  2H64 C;  4OM4 A;  1REW C;  4BDT B;  1NTN A; 
#chains in the Genus database with same CATH topology
 3NH7 A;  2HLQ A;  1IDI A;  4XJJ A;  4BIK B;  1IK8 A;  2MJ0 A;  3NEQ A;  2J8B A;  1IDH A;  1CDR A;  1YWH A;  2OFS A;  1KS6 A;  2H5F A;  2MUO A;  4P7U A;  2UWR A;  1CDQ A;  2VLW A;  2H7Z B;  1FSS B;  2CCX A;  1KXI A;  2X8B B;  1CXN A;  3FEV A;  1KFH A;  2HLR A;  1HC9 A;  1IKC A;  1IDG A;  5IMT D;  4EY8 B;  2MFA A;  2JVE A;  1COE A;  5DU1 A;  2GOO C;  1CHV S;  1BXP A;  4KSN A;  4ZQY A;  1L4W A;  5EBX A;  2BTX A;  2CDX A;  1KU6 B;  3LAQ U;  2I9B E;  1S4Y A;  1I02 A;  2N99 A;  1CRE A;  2MJY A;  2H62 D;  3U74 U;  1FAS A;  5IMY C;  1JE9 A;  1QKE A;  2H8U A;  2LCR A;  4LFT A;  1CCQ A;  1IJC A;  1RL5 A;  1NOR A;  1TGX A;  1QM7 A;  3U73 U;  1TXA A;  2PJY C;  2CRT A;  2H62 C;  1H0J A;  1HAJ A;  1FRA A;  2ERA A;  4AEA A;  1JGK A;  3QB4 B;  1KBA A;  2L03 A;  1QKD A;  4IYE A;  1ZAD A;  1TFS A;  2H64 B;  1CRF A;  1VB0 A;  2H7Z A;  1FFJ A;  3BT2 U;  1F94 A;  1W6B A;  1HAA A;  2JQP A;  3KFD I;  3VTS A;  1CTX A;  1CDT A;  1LSI A;  1TXB A;  2MJ4 A;  1RGJ A;  2QJA C;  1ERA A;  2UX2 A;  2LA1 A;  1LXG A;  4OM5 A;  2CTX A;  1ABT A;  1LXH A;  1LX5 B;  1ERG A;  2CRS A;  1F8U B;  2MHY A;  1NYU A;  1MR6 A;  2MUP A;  4RUD A;  3KFD E;  4FAO E;  2ABX A;  4HQP F;  4FAO C;  3EBX A;  1KTZ B;  2BHI A;  3BT1 U;  1KL8 A;  3EVS C;  1JBD A;  2PJY B;  5DZ5 A;  1CB9 A;  1CXO A;  1NEA A;  2K3G A;  6EBX A;  3PLC A;  1HC9 B;  1IDL A;  1NYS A;  5DO6 A;  3NDS A;  1G6M A;  1NTX A;  1FSC A;  2GOO B;  1KC4 A;  1COD A;  1ONJ A;  4QTI U;  1IQ9 A;  4DO8 A;  1NXB A;  1FF4 A;  2QC1 A;  1CVO A;  1UG4 A;  1BTE A;  2NBT A;  1V6P A;  2L5S A;  2QJ9 C;  1B41 B;  1PLO A;  1HOY A;  1XT3 A;  1DRS A;  1KBS A;  3HH7 A;  1KBT A;  1LJZ A;  2FD6 U;  2QJB C;  1MAH F;  3ERA A;  1CDS A;  4UY2 C;  1ES7 B;  1M9Z A;  2H64 C;  4OM4 A;  1REW C;  4BDT B;  1NTN A; 
#chains in the Genus database with same CATH homology
 3NH7 A;  2HLQ A;  1IDI A;  4XJJ A;  4BIK B;  1IK8 A;  2MJ0 A;  3NEQ A;  2J8B A;  1IDH A;  1CDR A;  1YWH A;  2OFS A;  1KS6 A;  2H5F A;  2MUO A;  4P7U A;  2UWR A;  1CDQ A;  2VLW A;  2H7Z B;  1FSS B;  2CCX A;  1KXI A;  2X8B B;  1CXN A;  3FEV A;  1KFH A;  2HLR A;  1HC9 A;  1IKC A;  1IDG A;  5IMT D;  4EY8 B;  2MFA A;  2JVE A;  1COE A;  5DU1 A;  2GOO C;  1CHV S;  1BXP A;  4KSN A;  4ZQY A;  1L4W A;  5EBX A;  2BTX A;  2CDX A;  1KU6 B;  3LAQ U;  2I9B E;  1S4Y A;  1I02 A;  2N99 A;  1CRE A;  2MJY A;  2H62 D;  3U74 U;  1FAS A;  5IMY C;  1JE9 A;  1QKE A;  2H8U A;  2LCR A;  4LFT A;  1CCQ A;  1IJC A;  1RL5 A;  1NOR A;  1TGX A;  1QM7 A;  3U73 U;  1TXA A;  2PJY C;  2CRT A;  2H62 C;  1H0J A;  1HAJ A;  1FRA A;  2ERA A;  4AEA A;  1JGK A;  3QB4 B;  1KBA A;  2L03 A;  1QKD A;  4IYE A;  1ZAD A;  1TFS A;  2H64 B;  1CRF A;  1VB0 A;  2H7Z A;  1FFJ A;  3BT2 U;  1F94 A;  1W6B A;  1HAA A;  2JQP A;  3KFD I;  3VTS A;  1CTX A;  1CDT A;  1LSI A;  1TXB A;  2MJ4 A;  1RGJ A;  2QJA C;  1ERA A;  2UX2 A;  2LA1 A;  1LXG A;  4OM5 A;  2CTX A;  1ABT A;  1LXH A;  1LX5 B;  1ERG A;  2CRS A;  1F8U B;  2MHY A;  1NYU A;  1MR6 A;  2MUP A;  4RUD A;  3KFD E;  4FAO E;  2ABX A;  4HQP F;  4FAO C;  3EBX A;  1KTZ B;  2BHI A;  3BT1 U;  1KL8 A;  3EVS C;  1JBD A;  2PJY B;  5DZ5 A;  1CB9 A;  1CXO A;  1NEA A;  2K3G A;  6EBX A;  3PLC A;  1HC9 B;  1IDL A;  1NYS A;  5DO6 A;  3NDS A;  1G6M A;  1NTX A;  1FSC A;  2GOO B;  1KC4 A;  1COD A;  1ONJ A;  4QTI U;  1IQ9 A;  4DO8 A;  1NXB A;  1FF4 A;  2QC1 A;  1CVO A;  1UG4 A;  1BTE A;  2NBT A;  1V6P A;  2L5S A;  2QJ9 C;  1B41 B;  1PLO A;  1HOY A;  1XT3 A;  1DRS A;  1KBS A;  3HH7 A;  1KBT A;  1LJZ A;  2FD6 U;  2QJB C;  1MAH F;  3ERA A;  1CDS A;  4UY2 C;  1ES7 B;  1M9Z A;  2H64 C;  4OM4 A;  1REW C;  4BDT B;  1NTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...