1KC4A

Nmr structural analysis of the complex formed between alpha-bungarotoxin and the principal alpha-neurotoxin binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords alpha-bungarotoxin
publication title NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Toxin
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kc4A00
4OM5A 4UY2C 1LXGA 2CRTA 1ERGA 1NORA 4BDTB 5DU1A 3BT1U 1CVOA 5EBXA 1KL8A 2H7ZB 1BTEA 1UG4A 2QC1A 1B41B 4OM4A 2H7ZA 1HC9B 1F94A 4AEAA 2VLWA 2CCXA 3EBXA 4QTIU 1BXPA 1KU6B 1G6MA 1HAAA 4IYEA 1MR6A 2K3GA 1H0JA 2MJYA 1COEA 1IDLA 1CXNA 1HC9A 1HOYA 1FSSB 2CTXA 1IDIA 1CREA 1REWC 1IDGA 1TXAA 1MAHF 3U73U 4FAOE 1CDTA 1YWHA 1KC4A 4EY8B 3LAQU 1IJCA 2GOOC 4LFTA 2BHIA 1LJZA 1IQ9A 3FEVA 4BIKB 3PLCA 1KTZB 1FFJA 1ONJA 2FD6U 2QJ9C 4RUDA 2MUPA 1TXBA 5DZ5A 1NXBA 2ERAA 6EBXA 1I02A 1IDHA 4HQPF 1QM7A 2H62D 2H5FA 2QJAC 1CDRA 1NEAA 1CB9A 1RGJA 1CRFA 1TGXA 2JQPA 2NBTA 2L03A 2GOOB 1ZADA 2H64C 1LSIA 3KFDE 1CDSA 2QJBC 2L5SA 1NYUA 1NYSA 5IMYC 1PLOA 1KS6A 2MJ4A 1FSCA 1CTXA 3HH7A 2CRSA 2OFSA 1IK8A 2BTXA 1KBSA 1CCQA 1NTNA 1L4WA 4P7UA 2N99A 3EVSC 2MFAA 1ABTA 2UWRA 4DO8A 1IKCA 1KBAA 1FF4A 1ES7B 1NTXA 2H8UA 5IMTD 1CODA 1XT3A 1KFHA 1KBTA 1V6PA 1CDQA 2MJ0A 3NDSA 3U74U 3QB4B 2PJYC 2J8BA 3VTSA 1F8UB 2LA1A 2I9BE 2MHYA 1DRSA 1LXHA 1QKDA 5DO6A 2H64B 1JGKA 4ZQYA 1CHVS 1VB0A 1FASA 2PJYB 1FRAA 1JBDA 1HAJA 2ABXA 2X8BB 2H62C 2JVEA 4FAOC 1LX5B 2LCRA 2HLRA 4XJJA 3ERAA 2HLQA 1JE9A 2MUOA 3NH7A 1M9ZA 1QKEA 1W6BA 2UX2A 1CXOA 3BT2U 2CDXA 3KFDI 1RL5A 1TFSA 3NEQA 1KXIA 1ERAA 1S4YA
chains in the Genus database with same CATH superfamily
4OM5A 4UY2C 1LXGA 2CRTA 1ERGA 1NORA 4BDTB 5DU1A 3BT1U 1CVOA 5EBXA 1KL8A 2H7ZB 1BTEA 1UG4A 2QC1A 1B41B 4OM4A 2H7ZA 1HC9B 1F94A 4AEAA 2VLWA 2CCXA 3EBXA 4QTIU 1BXPA 1KU6B 1G6MA 1HAAA 4IYEA 1MR6A 2K3GA 1H0JA 2MJYA 1COEA 1IDLA 1CXNA 1HC9A 1HOYA 1FSSB 2CTXA 1IDIA 1CREA 1REWC 1IDGA 1TXAA 1MAHF 3U73U 4FAOE 1CDTA 1YWHA 1KC4A 4EY8B 3LAQU 1IJCA 2GOOC 4LFTA 2BHIA 1LJZA 1IQ9A 3FEVA 4BIKB 3PLCA 1KTZB 4KSNA 1FFJA 1ONJA 2FD6U 2QJ9C 4RUDA 2MUPA 1TXBA 5DZ5A 1NXBA 2ERAA 6EBXA 1I02A 1IDHA 4HQPF 1QM7A 2H62D 2H5FA 2QJAC 1CDRA 1NEAA 1CB9A 1RGJA 1CRFA 1TGXA 2JQPA 2NBTA 2L03A 2GOOB 1ZADA 2H64C 1LSIA 3KFDE 1CDSA 2QJBC 2L5SA 1NYUA 1NYSA 5IMYC 1PLOA 1KS6A 2MJ4A 1FSCA 1CTXA 3HH7A 2CRSA 2OFSA 1IK8A 2BTXA 1KBSA 1CCQA 1NTNA 1L4WA 4P7UA 2N99A 3EVSC 2MFAA 1ABTA 2UWRA 4DO8A 1IKCA 1KBAA 1FF4A 1ES7B 1NTXA 2H8UA 5IMTD 1CODA 1XT3A 1KFHA 1KBTA 1V6PA 1CDQA 2MJ0A 3NDSA 3U74U 3QB4B 2PJYC 2J8BA 3VTSA 1F8UB 2LA1A 2I9BE 2MHYA 1DRSA 1LXHA 1QKDA 5DO6A 2H64B 1JGKA 4ZQYA 1CHVS 1VB0A 1FASA 2PJYB 1FRAA 1JBDA 1HAJA 2ABXA 2X8BB 2H62C 2JVEA 4FAOC 1LX5B 2LCRA 2HLRA 4XJJA 3ERAA 2HLQA 1JE9A 2MUOA 3NH7A 1M9ZA 1QKEA 1W6BA 2UX2A 1CXOA 3BT2U 2CDXA 3KFDI 1RL5A 1TFSA 3NEQA 1KXIA 1ERAA 1S4YA
chains in the Genus database with same CATH topology
4OM5A 4UY2C 1LXGA 2CRTA 1ERGA 1NORA 4BDTB 5DU1A 3BT1U 1CVOA 5EBXA 1KL8A 2H7ZB 1BTEA 1UG4A 2QC1A 1B41B 4OM4A 2H7ZA 1HC9B 1F94A 4AEAA 2VLWA 2CCXA 3EBXA 4QTIU 1BXPA 1KU6B 1G6MA 1HAAA 4IYEA 1MR6A 2K3GA 1H0JA 2MJYA 1COEA 1IDLA 1CXNA 1HC9A 1HOYA 1FSSB 2CTXA 1IDIA 1CREA 1REWC 1IDGA 1TXAA 1MAHF 3U73U 4FAOE 1CDTA 1YWHA 1KC4A 4EY8B 3LAQU 1IJCA 2GOOC 4LFTA 2BHIA 1LJZA 1IQ9A 3FEVA 4BIKB 3PLCA 1KTZB 4KSNA 1FFJA 1ONJA 2FD6U 2QJ9C 4RUDA 2MUPA 1TXBA 5DZ5A 1NXBA 2ERAA 6EBXA 1I02A 1IDHA 4HQPF 1QM7A 2H62D 2H5FA 2QJAC 1CDRA 1NEAA 1CB9A 1RGJA 1CRFA 1TGXA 2JQPA 2NBTA 2L03A 2GOOB 1ZADA 2H64C 1LSIA 3KFDE 1CDSA 2QJBC 2L5SA 1NYUA 1NYSA 5IMYC 1PLOA 1KS6A 2MJ4A 1FSCA 1CTXA 3HH7A 2CRSA 2OFSA 1IK8A 2BTXA 1KBSA 1CCQA 1NTNA 1L4WA 4P7UA 2N99A 3EVSC 2MFAA 1ABTA 2UWRA 4DO8A 1IKCA 1KBAA 1FF4A 1ES7B 1NTXA 2H8UA 5IMTD 1CODA 1XT3A 1KFHA 1KBTA 1V6PA 1CDQA 2MJ0A 3NDSA 3U74U 3QB4B 2PJYC 2J8BA 3VTSA 1F8UB 2LA1A 2I9BE 2MHYA 1DRSA 1LXHA 1QKDA 5DO6A 2H64B 1JGKA 4ZQYA 1CHVS 1VB0A 1FASA 2PJYB 1FRAA 1JBDA 1HAJA 2ABXA 2X8BB 2H62C 2JVEA 4FAOC 1LX5B 2LCRA 2HLRA 4XJJA 3ERAA 2HLQA 1JE9A 2MUOA 3NH7A 1M9ZA 1QKEA 1W6BA 2UX2A 1CXOA 3BT2U 2CDXA 3KFDI 1RL5A 1TFSA 3NEQA 1KXIA 1ERAA 1S4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  4UY2 C;  1LXG A;  2CRT A;  1ERG A;  1NOR A;  4BDT B;  5DU1 A;  3BT1 U;  1CVO A;  5EBX A;  1KL8 A;  2H7Z B;  1BTE A;  1UG4 A;  2QC1 A;  1B41 B;  4OM4 A;  2H7Z A;  1HC9 B;  1F94 A;  4AEA A;  2VLW A;  2CCX A;  3EBX A;  4QTI U;  1BXP A;  1KU6 B;  1G6M A;  1HAA A;  4IYE A;  1MR6 A;  2K3G A;  1H0J A;  2MJY A;  1COE A;  1IDL A;  1CXN A;  1HC9 A;  1HOY A;  1FSS B;  2CTX A;  1IDI A;  1CRE A;  1REW C;  1IDG A;  1TXA A;  1MAH F;  3U73 U;  4FAO E;  1CDT A;  1YWH A;  1KC4 A;  4EY8 B;  3LAQ U;  1IJC A;  2GOO C;  4LFT A;  2BHI A;  1LJZ A;  1IQ9 A;  3FEV A;  4BIK B;  3PLC A;  1KTZ B;  1FFJ A;  1ONJ A;  2FD6 U;  2QJ9 C;  4RUD A;  2MUP A;  1TXB A;  5DZ5 A;  1NXB A;  2ERA A;  6EBX A;  1I02 A;  1IDH A;  4HQP F;  1QM7 A;  2H62 D;  2H5F A;  2QJA C;  1CDR A;  1NEA A;  1CB9 A;  1RGJ A;  1CRF A;  1TGX A;  2JQP A;  2NBT A;  2L03 A;  2GOO B;  1ZAD A;  2H64 C;  1LSI A;  3KFD E;  1CDS A;  2QJB C;  2L5S A;  1NYU A;  1NYS A;  5IMY C;  1PLO A;  1KS6 A;  2MJ4 A;  1FSC A;  1CTX A;  3HH7 A;  2CRS A;  2OFS A;  1IK8 A;  2BTX A;  1KBS A;  1CCQ A;  1NTN A;  1L4W A;  4P7U A;  2N99 A;  3EVS C;  2MFA A;  1ABT A;  2UWR A;  4DO8 A;  1IKC A;  1KBA A;  1FF4 A;  1ES7 B;  1NTX A;  2H8U A;  5IMT D;  1COD A;  1XT3 A;  1KFH A;  1KBT A;  1V6P A;  1CDQ A;  2MJ0 A;  3NDS A;  3U74 U;  3QB4 B;  2PJY C;  2J8B A;  3VTS A;  1F8U B;  2LA1 A;  2I9B E;  2MHY A;  1DRS A;  1LXH A;  1QKD A;  5DO6 A;  2H64 B;  1JGK A;  4ZQY A;  1CHV S;  1VB0 A;  1FAS A;  2PJY B;  1FRA A;  1JBD A;  1HAJ A;  2ABX A;  2X8B B;  2H62 C;  2JVE A;  4FAO C;  1LX5 B;  2LCR A;  2HLR A;  4XJJ A;  3ERA A;  2HLQ A;  1JE9 A;  2MUO A;  3NH7 A;  1M9Z A;  1QKE A;  1W6B A;  2UX2 A;  1CXO A;  3BT2 U;  2CDX A;  3KFD I;  1RL5 A;  1TFS A;  3NEQ A;  1KXI A;  1ERA A;  1S4Y A; 
#chains in the Genus database with same CATH topology
 4OM5 A;  4UY2 C;  1LXG A;  2CRT A;  1ERG A;  1NOR A;  4BDT B;  5DU1 A;  3BT1 U;  1CVO A;  5EBX A;  1KL8 A;  2H7Z B;  1BTE A;  1UG4 A;  2QC1 A;  1B41 B;  4OM4 A;  2H7Z A;  1HC9 B;  1F94 A;  4AEA A;  2VLW A;  2CCX A;  3EBX A;  4QTI U;  1BXP A;  1KU6 B;  1G6M A;  1HAA A;  4IYE A;  1MR6 A;  2K3G A;  1H0J A;  2MJY A;  1COE A;  1IDL A;  1CXN A;  1HC9 A;  1HOY A;  1FSS B;  2CTX A;  1IDI A;  1CRE A;  1REW C;  1IDG A;  1TXA A;  1MAH F;  3U73 U;  4FAO E;  1CDT A;  1YWH A;  1KC4 A;  4EY8 B;  3LAQ U;  1IJC A;  2GOO C;  4LFT A;  2BHI A;  1LJZ A;  1IQ9 A;  3FEV A;  4BIK B;  3PLC A;  1KTZ B;  4KSN A;  1FFJ A;  1ONJ A;  2FD6 U;  2QJ9 C;  4RUD A;  2MUP A;  1TXB A;  5DZ5 A;  1NXB A;  2ERA A;  6EBX A;  1I02 A;  1IDH A;  4HQP F;  1QM7 A;  2H62 D;  2H5F A;  2QJA C;  1CDR A;  1NEA A;  1CB9 A;  1RGJ A;  1CRF A;  1TGX A;  2JQP A;  2NBT A;  2L03 A;  2GOO B;  1ZAD A;  2H64 C;  1LSI A;  3KFD E;  1CDS A;  2QJB C;  2L5S A;  1NYU A;  1NYS A;  5IMY C;  1PLO A;  1KS6 A;  2MJ4 A;  1FSC A;  1CTX A;  3HH7 A;  2CRS A;  2OFS A;  1IK8 A;  2BTX A;  1KBS A;  1CCQ A;  1NTN A;  1L4W A;  4P7U A;  2N99 A;  3EVS C;  2MFA A;  1ABT A;  2UWR A;  4DO8 A;  1IKC A;  1KBA A;  1FF4 A;  1ES7 B;  1NTX A;  2H8U A;  5IMT D;  1COD A;  1XT3 A;  1KFH A;  1KBT A;  1V6P A;  1CDQ A;  2MJ0 A;  3NDS A;  3U74 U;  3QB4 B;  2PJY C;  2J8B A;  3VTS A;  1F8U B;  2LA1 A;  2I9B E;  2MHY A;  1DRS A;  1LXH A;  1QKD A;  5DO6 A;  2H64 B;  1JGK A;  4ZQY A;  1CHV S;  1VB0 A;  1FAS A;  2PJY B;  1FRA A;  1JBD A;  1HAJ A;  2ABX A;  2X8B B;  2H62 C;  2JVE A;  4FAO C;  1LX5 B;  2LCR A;  2HLR A;  4XJJ A;  3ERA A;  2HLQ A;  1JE9 A;  2MUO A;  3NH7 A;  1M9Z A;  1QKE A;  1W6B A;  2UX2 A;  1CXO A;  3BT2 U;  2CDX A;  3KFD I;  1RL5 A;  1TFS A;  3NEQ A;  1KXI A;  1ERA A;  1S4Y A; 
#chains in the Genus database with same CATH homology
 4OM5 A;  4UY2 C;  1LXG A;  2CRT A;  1ERG A;  1NOR A;  4BDT B;  5DU1 A;  3BT1 U;  1CVO A;  5EBX A;  1KL8 A;  2H7Z B;  1BTE A;  1UG4 A;  2QC1 A;  1B41 B;  4OM4 A;  2H7Z A;  1HC9 B;  1F94 A;  4AEA A;  2VLW A;  2CCX A;  3EBX A;  4QTI U;  1BXP A;  1KU6 B;  1G6M A;  1HAA A;  4IYE A;  1MR6 A;  2K3G A;  1H0J A;  2MJY A;  1COE A;  1IDL A;  1CXN A;  1HC9 A;  1HOY A;  1FSS B;  2CTX A;  1IDI A;  1CRE A;  1REW C;  1IDG A;  1TXA A;  1MAH F;  3U73 U;  4FAO E;  1CDT A;  1YWH A;  1KC4 A;  4EY8 B;  3LAQ U;  1IJC A;  2GOO C;  4LFT A;  2BHI A;  1LJZ A;  1IQ9 A;  3FEV A;  4BIK B;  3PLC A;  1KTZ B;  4KSN A;  1FFJ A;  1ONJ A;  2FD6 U;  2QJ9 C;  4RUD A;  2MUP A;  1TXB A;  5DZ5 A;  1NXB A;  2ERA A;  6EBX A;  1I02 A;  1IDH A;  4HQP F;  1QM7 A;  2H62 D;  2H5F A;  2QJA C;  1CDR A;  1NEA A;  1CB9 A;  1RGJ A;  1CRF A;  1TGX A;  2JQP A;  2NBT A;  2L03 A;  2GOO B;  1ZAD A;  2H64 C;  1LSI A;  3KFD E;  1CDS A;  2QJB C;  2L5S A;  1NYU A;  1NYS A;  5IMY C;  1PLO A;  1KS6 A;  2MJ4 A;  1FSC A;  1CTX A;  3HH7 A;  2CRS A;  2OFS A;  1IK8 A;  2BTX A;  1KBS A;  1CCQ A;  1NTN A;  1L4W A;  4P7U A;  2N99 A;  3EVS C;  2MFA A;  1ABT A;  2UWR A;  4DO8 A;  1IKC A;  1KBA A;  1FF4 A;  1ES7 B;  1NTX A;  2H8U A;  5IMT D;  1COD A;  1XT3 A;  1KFH A;  1KBT A;  1V6P A;  1CDQ A;  2MJ0 A;  3NDS A;  3U74 U;  3QB4 B;  2PJY C;  2J8B A;  3VTS A;  1F8U B;  2LA1 A;  2I9B E;  2MHY A;  1DRS A;  1LXH A;  1QKD A;  5DO6 A;  2H64 B;  1JGK A;  4ZQY A;  1CHV S;  1VB0 A;  1FAS A;  2PJY B;  1FRA A;  1JBD A;  1HAJ A;  2ABX A;  2X8B B;  2H62 C;  2JVE A;  4FAO C;  1LX5 B;  2LCR A;  2HLR A;  4XJJ A;  3ERA A;  2HLQ A;  1JE9 A;  2MUO A;  3NH7 A;  1M9Z A;  1QKE A;  1W6B A;  2UX2 A;  1CXO A;  3BT2 U;  2CDX A;  3KFD I;  1RL5 A;  1TFS A;  3NEQ A;  1KXI A;  1ERA A;  1S4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...