1KC4A

Nmr structural analysis of the complex formed between alpha-bungarotoxin and the principal alpha-neurotoxin binding sequence on the alpha7 subunit of a neuronal nicotinic acetylcholine receptor
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords alpha-bungarotoxin
publication title NMR structural analysis of alpha-bungarotoxin and its complex with the principal alpha-neurotoxin-binding sequence on the alpha 7 subunit of a neuronal nicotinic acetylcholine receptor.
pubmed doi rcsb
source organism Gallus gallus
total genus 4
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-11-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1kc4A00
1IDIA 4AEAA 2NBTA 1IDLA 3U73U 1ONJA 1KXIA 1V6PA 1I02A 1IKCA 3U74U 1BTEA 2VLWA 1IK8A 1CHVS 3HH7A 2MUOA 1HC9A 2JQPA 2UX2A 1G6MA 1MR6A 1KC4A 4OM5A 4ZQYA 1XT3A 1NTXA 1CRFA 2GOOC 1CVOA 1ABTA 1HAAA 2J8BA 1ERGA 3PLCA 3QB4B 2CCXA 2H7ZB 2MFAA 2MJ0A 5EBXA 1KS6A 2ERAA 1FASA 5DO6A 1CDTA 2BTXA 1MAHF 1IQ9A 1KBSA 1M9ZA 1IDGA 1HOYA 4IYEA 4RUDA 1JBDA 2QJBC 2L5SA 2K3GA 5DU1A 1NEAA 4LFTA 2FD6U 3EVSC 4BDTB 2GOOB 1DRSA 1W6BA 1REWC 1HAJA 1NYUA 5IMTD 2H64C 3LAQU 3EBXA 2MJ4A 2JVEA 1CDRA 1NORA 2H62D 1TXBA 4P7UA 1IDHA 2CTXA 5IMYC 1UG4A 1LSIA 3BT2U 1CTXA 4HQPF 2PJYC 1NXBA 1FSSB 1RL5A 2BHIA 2H8UA 1FF4A 2OFSA 2H64B 1H0JA 4BIKB 1FRAA 1L4WA 1KBAA 4FAOC 1YWHA 1BXPA 3NDSA 1TGXA 1KFHA 1JE9A 1LX5B 1FSCA 3NH7A 1KBTA 1S4YA 1QM7A 1QKEA 1VB0A 2QJAC 2PJYB 2ABXA 1F8UB 2QC1A 3NEQA 2H7ZA 1B41B 4XJJA 3BT1U 1CDSA 2MHYA 3KFDE 2N99A 1RGJA 2QJ9C 5DZ5A 2LA1A 1ZADA 1CXOA 1HC9B 1TXAA 2LCRA 1JGKA 1ES7B 2HLQA 1IJCA 2I9BE 2CRSA 4UY2C 6EBXA 1CREA 4FAOE 2L03A 1COEA 2MJYA 4QTIU 1CODA 1KU6B 2X8BB 1TFSA 2HLRA 3KFDI 3FEVA 1CCQA 2H5FA 3VTSA 1KL8A 4DO8A 1CB9A 4EY8B 1LXGA 2MUPA 1CDQA 2CRTA 1NTNA 1LJZA 1QKDA 1F94A 3ERAA 2CDXA 4OM4A 1ERAA 1KTZB 2UWRA 2H62C 1CXNA 1FFJA 1LXHA 1PLOA 1NYSA
chains in the Genus database with same CATH superfamily
1IDIA 4AEAA 2NBTA 1IDLA 3U73U 1ONJA 1KXIA 1V6PA 1I02A 1IKCA 3U74U 1BTEA 2VLWA 1IK8A 1CHVS 3HH7A 2MUOA 1HC9A 2JQPA 2UX2A 1G6MA 1MR6A 1KC4A 4OM5A 4ZQYA 1XT3A 1NTXA 1CRFA 2GOOC 1CVOA 1ABTA 1HAAA 2J8BA 1ERGA 3PLCA 3QB4B 2CCXA 2H7ZB 2MFAA 2MJ0A 5EBXA 1KS6A 2ERAA 1FASA 5DO6A 1CDTA 2BTXA 1MAHF 1IQ9A 1KBSA 1M9ZA 1IDGA 1HOYA 4IYEA 4RUDA 1JBDA 2QJBC 2L5SA 2K3GA 5DU1A 1NEAA 4LFTA 2FD6U 3EVSC 4BDTB 2GOOB 1DRSA 1W6BA 1REWC 1HAJA 1NYUA 5IMTD 2H64C 4KSNA 3LAQU 3EBXA 2MJ4A 2JVEA 1CDRA 1NORA 2H62D 1TXBA 4P7UA 1IDHA 2CTXA 5IMYC 1UG4A 1LSIA 3BT2U 1CTXA 4HQPF 2PJYC 1NXBA 1FSSB 1RL5A 2BHIA 2H8UA 1FF4A 2OFSA 2H64B 1H0JA 4BIKB 1FRAA 1L4WA 1KBAA 4FAOC 1YWHA 1BXPA 3NDSA 1TGXA 1KFHA 1JE9A 1LX5B 1FSCA 3NH7A 1KBTA 1S4YA 1QM7A 1QKEA 1VB0A 2QJAC 2PJYB 2ABXA 1F8UB 2QC1A 3NEQA 2H7ZA 1B41B 4XJJA 3BT1U 1CDSA 2MHYA 3KFDE 2N99A 1RGJA 2QJ9C 5DZ5A 2LA1A 1ZADA 1CXOA 1HC9B 1TXAA 2LCRA 1JGKA 1ES7B 2HLQA 1IJCA 2I9BE 2CRSA 4UY2C 6EBXA 1CREA 4FAOE 2L03A 1COEA 2MJYA 4QTIU 1CODA 1KU6B 2X8BB 1TFSA 2HLRA 3KFDI 3FEVA 1CCQA 2H5FA 3VTSA 1KL8A 4DO8A 1CB9A 4EY8B 1LXGA 2MUPA 1CDQA 2CRTA 1NTNA 1LJZA 1QKDA 1F94A 3ERAA 2CDXA 4OM4A 1ERAA 1KTZB 2UWRA 2H62C 1CXNA 1FFJA 1LXHA 1PLOA 1NYSA
chains in the Genus database with same CATH topology
1IDIA 4AEAA 2NBTA 1IDLA 3U73U 1ONJA 1KXIA 1V6PA 1I02A 1IKCA 3U74U 1BTEA 2VLWA 1IK8A 1CHVS 3HH7A 2MUOA 1HC9A 2JQPA 2UX2A 1G6MA 1MR6A 1KC4A 4OM5A 4ZQYA 1XT3A 1NTXA 1CRFA 2GOOC 1CVOA 1ABTA 1HAAA 2J8BA 1ERGA 3PLCA 3QB4B 2CCXA 2H7ZB 2MFAA 2MJ0A 5EBXA 1KS6A 2ERAA 1FASA 5DO6A 1CDTA 2BTXA 1MAHF 1IQ9A 1KBSA 1M9ZA 1IDGA 1HOYA 4IYEA 4RUDA 1JBDA 2QJBC 2L5SA 2K3GA 5DU1A 1NEAA 4LFTA 2FD6U 3EVSC 4BDTB 2GOOB 1DRSA 1W6BA 1REWC 1HAJA 1NYUA 5IMTD 2H64C 4KSNA 3LAQU 3EBXA 2MJ4A 2JVEA 1CDRA 1NORA 2H62D 1TXBA 4P7UA 1IDHA 2CTXA 5IMYC 1UG4A 1LSIA 3BT2U 1CTXA 4HQPF 2PJYC 1NXBA 1FSSB 1RL5A 2BHIA 2H8UA 1FF4A 2OFSA 2H64B 1H0JA 4BIKB 1FRAA 1L4WA 1KBAA 4FAOC 1YWHA 1BXPA 3NDSA 1TGXA 1KFHA 1JE9A 1LX5B 1FSCA 3NH7A 1KBTA 1S4YA 1QM7A 1QKEA 1VB0A 2QJAC 2PJYB 2ABXA 1F8UB 2QC1A 3NEQA 2H7ZA 1B41B 4XJJA 3BT1U 1CDSA 2MHYA 3KFDE 2N99A 1RGJA 2QJ9C 5DZ5A 2LA1A 1ZADA 1CXOA 1HC9B 1TXAA 2LCRA 1JGKA 1ES7B 2HLQA 1IJCA 2I9BE 2CRSA 4UY2C 6EBXA 1CREA 4FAOE 2L03A 1COEA 2MJYA 4QTIU 1CODA 1KU6B 2X8BB 1TFSA 2HLRA 3KFDI 3FEVA 1CCQA 2H5FA 3VTSA 1KL8A 4DO8A 1CB9A 4EY8B 1LXGA 2MUPA 1CDQA 2CRTA 1NTNA 1LJZA 1QKDA 1F94A 3ERAA 2CDXA 4OM4A 1ERAA 1KTZB 2UWRA 2H62C 1CXNA 1FFJA 1LXHA 1PLOA 1NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDI A;  4AEA A;  2NBT A;  1IDL A;  3U73 U;  1ONJ A;  1KXI A;  1V6P A;  1I02 A;  1IKC A;  3U74 U;  1BTE A;  2VLW A;  1IK8 A;  1CHV S;  3HH7 A;  2MUO A;  1HC9 A;  2JQP A;  2UX2 A;  1G6M A;  1MR6 A;  1KC4 A;  4OM5 A;  4ZQY A;  1XT3 A;  1NTX A;  1CRF A;  2GOO C;  1CVO A;  1ABT A;  1HAA A;  2J8B A;  1ERG A;  3PLC A;  3QB4 B;  2CCX A;  2H7Z B;  2MFA A;  2MJ0 A;  5EBX A;  1KS6 A;  2ERA A;  1FAS A;  5DO6 A;  1CDT A;  2BTX A;  1MAH F;  1IQ9 A;  1KBS A;  1M9Z A;  1IDG A;  1HOY A;  4IYE A;  4RUD A;  1JBD A;  2QJB C;  2L5S A;  2K3G A;  5DU1 A;  1NEA A;  4LFT A;  2FD6 U;  3EVS C;  4BDT B;  2GOO B;  1DRS A;  1W6B A;  1REW C;  1HAJ A;  1NYU A;  5IMT D;  2H64 C;  3LAQ U;  3EBX A;  2MJ4 A;  2JVE A;  1CDR A;  1NOR A;  2H62 D;  1TXB A;  4P7U A;  1IDH A;  2CTX A;  5IMY C;  1UG4 A;  1LSI A;  3BT2 U;  1CTX A;  4HQP F;  2PJY C;  1NXB A;  1FSS B;  1RL5 A;  2BHI A;  2H8U A;  1FF4 A;  2OFS A;  2H64 B;  1H0J A;  4BIK B;  1FRA A;  1L4W A;  1KBA A;  4FAO C;  1YWH A;  1BXP A;  3NDS A;  1TGX A;  1KFH A;  1JE9 A;  1LX5 B;  1FSC A;  3NH7 A;  1KBT A;  1S4Y A;  1QM7 A;  1QKE A;  1VB0 A;  2QJA C;  2PJY B;  2ABX A;  1F8U B;  2QC1 A;  3NEQ A;  2H7Z A;  1B41 B;  4XJJ A;  3BT1 U;  1CDS A;  2MHY A;  3KFD E;  2N99 A;  1RGJ A;  2QJ9 C;  5DZ5 A;  2LA1 A;  1ZAD A;  1CXO A;  1HC9 B;  1TXA A;  2LCR A;  1JGK A;  1ES7 B;  2HLQ A;  1IJC A;  2I9B E;  2CRS A;  4UY2 C;  6EBX A;  1CRE A;  4FAO E;  2L03 A;  1COE A;  2MJY A;  4QTI U;  1COD A;  1KU6 B;  2X8B B;  1TFS A;  2HLR A;  3KFD I;  3FEV A;  1CCQ A;  2H5F A;  3VTS A;  1KL8 A;  4DO8 A;  1CB9 A;  4EY8 B;  1LXG A;  2MUP A;  1CDQ A;  2CRT A;  1NTN A;  1LJZ A;  1QKD A;  1F94 A;  3ERA A;  2CDX A;  4OM4 A;  1ERA A;  1KTZ B;  2UWR A;  2H62 C;  1CXN A;  1FFJ A;  1LXH A;  1PLO A;  1NYS A; 
#chains in the Genus database with same CATH topology
 1IDI A;  4AEA A;  2NBT A;  1IDL A;  3U73 U;  1ONJ A;  1KXI A;  1V6P A;  1I02 A;  1IKC A;  3U74 U;  1BTE A;  2VLW A;  1IK8 A;  1CHV S;  3HH7 A;  2MUO A;  1HC9 A;  2JQP A;  2UX2 A;  1G6M A;  1MR6 A;  1KC4 A;  4OM5 A;  4ZQY A;  1XT3 A;  1NTX A;  1CRF A;  2GOO C;  1CVO A;  1ABT A;  1HAA A;  2J8B A;  1ERG A;  3PLC A;  3QB4 B;  2CCX A;  2H7Z B;  2MFA A;  2MJ0 A;  5EBX A;  1KS6 A;  2ERA A;  1FAS A;  5DO6 A;  1CDT A;  2BTX A;  1MAH F;  1IQ9 A;  1KBS A;  1M9Z A;  1IDG A;  1HOY A;  4IYE A;  4RUD A;  1JBD A;  2QJB C;  2L5S A;  2K3G A;  5DU1 A;  1NEA A;  4LFT A;  2FD6 U;  3EVS C;  4BDT B;  2GOO B;  1DRS A;  1W6B A;  1REW C;  1HAJ A;  1NYU A;  5IMT D;  2H64 C;  4KSN A;  3LAQ U;  3EBX A;  2MJ4 A;  2JVE A;  1CDR A;  1NOR A;  2H62 D;  1TXB A;  4P7U A;  1IDH A;  2CTX A;  5IMY C;  1UG4 A;  1LSI A;  3BT2 U;  1CTX A;  4HQP F;  2PJY C;  1NXB A;  1FSS B;  1RL5 A;  2BHI A;  2H8U A;  1FF4 A;  2OFS A;  2H64 B;  1H0J A;  4BIK B;  1FRA A;  1L4W A;  1KBA A;  4FAO C;  1YWH A;  1BXP A;  3NDS A;  1TGX A;  1KFH A;  1JE9 A;  1LX5 B;  1FSC A;  3NH7 A;  1KBT A;  1S4Y A;  1QM7 A;  1QKE A;  1VB0 A;  2QJA C;  2PJY B;  2ABX A;  1F8U B;  2QC1 A;  3NEQ A;  2H7Z A;  1B41 B;  4XJJ A;  3BT1 U;  1CDS A;  2MHY A;  3KFD E;  2N99 A;  1RGJ A;  2QJ9 C;  5DZ5 A;  2LA1 A;  1ZAD A;  1CXO A;  1HC9 B;  1TXA A;  2LCR A;  1JGK A;  1ES7 B;  2HLQ A;  1IJC A;  2I9B E;  2CRS A;  4UY2 C;  6EBX A;  1CRE A;  4FAO E;  2L03 A;  1COE A;  2MJY A;  4QTI U;  1COD A;  1KU6 B;  2X8B B;  1TFS A;  2HLR A;  3KFD I;  3FEV A;  1CCQ A;  2H5F A;  3VTS A;  1KL8 A;  4DO8 A;  1CB9 A;  4EY8 B;  1LXG A;  2MUP A;  1CDQ A;  2CRT A;  1NTN A;  1LJZ A;  1QKD A;  1F94 A;  3ERA A;  2CDX A;  4OM4 A;  1ERA A;  1KTZ B;  2UWR A;  2H62 C;  1CXN A;  1FFJ A;  1LXH A;  1PLO A;  1NYS A; 
#chains in the Genus database with same CATH homology
 1IDI A;  4AEA A;  2NBT A;  1IDL A;  3U73 U;  1ONJ A;  1KXI A;  1V6P A;  1I02 A;  1IKC A;  3U74 U;  1BTE A;  2VLW A;  1IK8 A;  1CHV S;  3HH7 A;  2MUO A;  1HC9 A;  2JQP A;  2UX2 A;  1G6M A;  1MR6 A;  1KC4 A;  4OM5 A;  4ZQY A;  1XT3 A;  1NTX A;  1CRF A;  2GOO C;  1CVO A;  1ABT A;  1HAA A;  2J8B A;  1ERG A;  3PLC A;  3QB4 B;  2CCX A;  2H7Z B;  2MFA A;  2MJ0 A;  5EBX A;  1KS6 A;  2ERA A;  1FAS A;  5DO6 A;  1CDT A;  2BTX A;  1MAH F;  1IQ9 A;  1KBS A;  1M9Z A;  1IDG A;  1HOY A;  4IYE A;  4RUD A;  1JBD A;  2QJB C;  2L5S A;  2K3G A;  5DU1 A;  1NEA A;  4LFT A;  2FD6 U;  3EVS C;  4BDT B;  2GOO B;  1DRS A;  1W6B A;  1REW C;  1HAJ A;  1NYU A;  5IMT D;  2H64 C;  4KSN A;  3LAQ U;  3EBX A;  2MJ4 A;  2JVE A;  1CDR A;  1NOR A;  2H62 D;  1TXB A;  4P7U A;  1IDH A;  2CTX A;  5IMY C;  1UG4 A;  1LSI A;  3BT2 U;  1CTX A;  4HQP F;  2PJY C;  1NXB A;  1FSS B;  1RL5 A;  2BHI A;  2H8U A;  1FF4 A;  2OFS A;  2H64 B;  1H0J A;  4BIK B;  1FRA A;  1L4W A;  1KBA A;  4FAO C;  1YWH A;  1BXP A;  3NDS A;  1TGX A;  1KFH A;  1JE9 A;  1LX5 B;  1FSC A;  3NH7 A;  1KBT A;  1S4Y A;  1QM7 A;  1QKE A;  1VB0 A;  2QJA C;  2PJY B;  2ABX A;  1F8U B;  2QC1 A;  3NEQ A;  2H7Z A;  1B41 B;  4XJJ A;  3BT1 U;  1CDS A;  2MHY A;  3KFD E;  2N99 A;  1RGJ A;  2QJ9 C;  5DZ5 A;  2LA1 A;  1ZAD A;  1CXO A;  1HC9 B;  1TXA A;  2LCR A;  1JGK A;  1ES7 B;  2HLQ A;  1IJC A;  2I9B E;  2CRS A;  4UY2 C;  6EBX A;  1CRE A;  4FAO E;  2L03 A;  1COE A;  2MJY A;  4QTI U;  1COD A;  1KU6 B;  2X8B B;  1TFS A;  2HLR A;  3KFD I;  3FEV A;  1CCQ A;  2H5F A;  3VTS A;  1KL8 A;  4DO8 A;  1CB9 A;  4EY8 B;  1LXG A;  2MUP A;  1CDQ A;  2CRT A;  1NTN A;  1LJZ A;  1QKD A;  1F94 A;  3ERA A;  2CDX A;  4OM4 A;  1ERA A;  1KTZ B;  2UWR A;  2H62 C;  1CXN A;  1FFJ A;  1LXH A;  1PLO A;  1NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...