2MFAA

Mambalgin-2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Mambalgin-2
publication title Chemical synthesis, 3D structure, and ASIC binding site of the toxin mambalgin-2.
pubmed doi rcsb
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mfaA00
1CHVS 1FF4A 4BIKB 1LX5B 2H64C 4RUDA 2K3GA 2NBTA 3QB4B 1IK8A 4BDTB 1F8UB 2MUPA 1HAJA 1TXBA 1TGXA 3U74U 1FSSB 1ERGA 1KXIA 1ZADA 3VTSA 1KTZB 1KL8A 2J8BA 5DU1A 2GOOC 1KBSA 1TFSA 1NTNA 1V6PA 2GOOB 4ZQYA 2LA1A 1REWC 1B41B 2H8UA 4P7UA 1FASA 4XJJA 1IQ9A 4LFTA 2X8BB 1FSCA 1CODA 2UWRA 2CTXA 1BXPA 6EBXA 1IDGA 1JGKA 2QJ9C 1RGJA 1CXOA 4AEAA 2MUOA 2H64B 1IDLA 3PLCA 3FEVA 1KBAA 1NYUA 2PJYC 1W6BA 1IKCA 1RL5A 2I9BE 1CRFA 1CDTA 1LXHA 5IMYC 1KBTA 1XT3A 2H5FA 1QKDA 4DO8A 5IMTD 3KFDI 5DZ5A 1HC9A 1CTXA 1JE9A 5DO6A 1CCQA 1CDQA 1UG4A 2MFAA 2ABXA 2OFSA 1HOYA 1CXNA 1IDHA 3U73U 2CRSA 5EBXA 1L4WA 1KFHA 2MJ0A 1ABTA 2LCRA 1HAAA 1QM7A 3BT2U 1KU6B 4FAOE 4HQPF 1YWHA 4EY8B 2QC1A 1PLOA 2MJ4A 3LAQU 3HH7A 2VLWA 2BHIA 4IYEA 1G6MA 3EBXA 1LJZA 1ERAA 4OM4A 4FAOC 2PJYB 2CRTA 1CDRA 2BTXA 2H62D 2H7ZA 2MJYA 4OM5A 1CVOA 1FRAA 2L5SA 1S4YA 2H62C 1CDSA 1MAHF 1NORA 2CCXA 1LXGA 1MR6A 1JBDA 1DRSA 1H0JA 2JQPA 1COEA 2ERAA 1NXBA 1HC9B 1KS6A 1CB9A 1NYSA 4UY2C 3NDSA 1NEAA 3NEQA 2FD6U 1F94A 1M9ZA 1NTXA 2L03A 3NH7A 2CDXA 1ES7B 2MHYA 4QTIU 1TXAA 1QKEA 2N99A 3ERAA 2HLRA 1IDIA 1LSIA 2QJBC 1VB0A 3KFDE 1IJCA 3BT1U 1BTEA 2H7ZB 1CREA 1ONJA 2JVEA 2QJAC 2UX2A 2HLQA 1I02A 1KC4A 3EVSC 1FFJA
chains in the Genus database with same CATH superfamily
1CHVS 1FF4A 4BIKB 1LX5B 2H64C 4RUDA 2K3GA 2NBTA 3QB4B 1IK8A 4BDTB 1F8UB 2MUPA 1HAJA 1TXBA 1TGXA 3U74U 1FSSB 1ERGA 1KXIA 1ZADA 3VTSA 1KTZB 1KL8A 2J8BA 5DU1A 2GOOC 1KBSA 1TFSA 1NTNA 1V6PA 2GOOB 4ZQYA 2LA1A 1REWC 1B41B 2H8UA 4P7UA 1FASA 4XJJA 1IQ9A 4LFTA 2X8BB 1FSCA 1CODA 2UWRA 2CTXA 1BXPA 6EBXA 1IDGA 1JGKA 2QJ9C 1RGJA 1CXOA 4AEAA 2MUOA 2H64B 1IDLA 3PLCA 3FEVA 1KBAA 1NYUA 2PJYC 1W6BA 1IKCA 1RL5A 2I9BE 1CRFA 1CDTA 1LXHA 5IMYC 1KBTA 1XT3A 2H5FA 1QKDA 4DO8A 5IMTD 3KFDI 5DZ5A 1HC9A 1CTXA 1JE9A 5DO6A 1CCQA 1CDQA 1UG4A 2MFAA 2ABXA 2OFSA 1HOYA 1CXNA 1IDHA 3U73U 2CRSA 5EBXA 1L4WA 1KFHA 2MJ0A 1ABTA 2LCRA 1HAAA 1QM7A 3BT2U 1KU6B 4FAOE 4HQPF 1YWHA 4EY8B 2QC1A 1PLOA 2MJ4A 3LAQU 3HH7A 2VLWA 2BHIA 4IYEA 1G6MA 3EBXA 1LJZA 1ERAA 4OM4A 4FAOC 2PJYB 2CRTA 1CDRA 2BTXA 2H62D 2H7ZA 2MJYA 4OM5A 1CVOA 1FRAA 2L5SA 1S4YA 2H62C 1CDSA 1MAHF 1NORA 2CCXA 4KSNA 1LXGA 1MR6A 1JBDA 1DRSA 1H0JA 2JQPA 1COEA 2ERAA 1NXBA 1HC9B 1KS6A 1CB9A 1NYSA 4UY2C 3NDSA 1NEAA 3NEQA 2FD6U 1F94A 1M9ZA 1NTXA 2L03A 3NH7A 2CDXA 1ES7B 2MHYA 4QTIU 1TXAA 1QKEA 2N99A 3ERAA 2HLRA 1IDIA 1LSIA 2QJBC 1VB0A 3KFDE 1IJCA 3BT1U 1BTEA 2H7ZB 1CREA 1ONJA 2JVEA 2QJAC 2UX2A 2HLQA 1I02A 1KC4A 3EVSC 1FFJA
chains in the Genus database with same CATH topology
1CHVS 1FF4A 4BIKB 1LX5B 2H64C 4RUDA 2K3GA 2NBTA 3QB4B 1IK8A 4BDTB 1F8UB 2MUPA 1HAJA 1TXBA 1TGXA 3U74U 1FSSB 1ERGA 1KXIA 1ZADA 3VTSA 1KTZB 1KL8A 2J8BA 5DU1A 2GOOC 1KBSA 1TFSA 1NTNA 1V6PA 2GOOB 4ZQYA 2LA1A 1REWC 1B41B 2H8UA 4P7UA 1FASA 4XJJA 1IQ9A 4LFTA 2X8BB 1FSCA 1CODA 2UWRA 2CTXA 1BXPA 6EBXA 1IDGA 1JGKA 2QJ9C 1RGJA 1CXOA 4AEAA 2MUOA 2H64B 1IDLA 3PLCA 3FEVA 1KBAA 1NYUA 2PJYC 1W6BA 1IKCA 1RL5A 2I9BE 1CRFA 1CDTA 1LXHA 5IMYC 1KBTA 1XT3A 2H5FA 1QKDA 4DO8A 5IMTD 3KFDI 5DZ5A 1HC9A 1CTXA 1JE9A 5DO6A 1CCQA 1CDQA 1UG4A 2MFAA 2ABXA 2OFSA 1HOYA 1CXNA 1IDHA 3U73U 2CRSA 5EBXA 1L4WA 1KFHA 2MJ0A 1ABTA 2LCRA 1HAAA 1QM7A 3BT2U 1KU6B 4FAOE 4HQPF 1YWHA 4EY8B 2QC1A 1PLOA 2MJ4A 3LAQU 3HH7A 2VLWA 2BHIA 4IYEA 1G6MA 3EBXA 1LJZA 1ERAA 4OM4A 4FAOC 2PJYB 2CRTA 1CDRA 2BTXA 2H62D 2H7ZA 2MJYA 4OM5A 1CVOA 1FRAA 2L5SA 1S4YA 2H62C 1CDSA 1MAHF 1NORA 2CCXA 4KSNA 1LXGA 1MR6A 1JBDA 1DRSA 1H0JA 2JQPA 1COEA 2ERAA 1NXBA 1HC9B 1KS6A 1CB9A 1NYSA 4UY2C 3NDSA 1NEAA 3NEQA 2FD6U 1F94A 1M9ZA 1NTXA 2L03A 3NH7A 2CDXA 1ES7B 2MHYA 4QTIU 1TXAA 1QKEA 2N99A 3ERAA 2HLRA 1IDIA 1LSIA 2QJBC 1VB0A 3KFDE 1IJCA 3BT1U 1BTEA 2H7ZB 1CREA 1ONJA 2JVEA 2QJAC 2UX2A 2HLQA 1I02A 1KC4A 3EVSC 1FFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHV S;  1FF4 A;  4BIK B;  1LX5 B;  2H64 C;  4RUD A;  2K3G A;  2NBT A;  3QB4 B;  1IK8 A;  4BDT B;  1F8U B;  2MUP A;  1HAJ A;  1TXB A;  1TGX A;  3U74 U;  1FSS B;  1ERG A;  1KXI A;  1ZAD A;  3VTS A;  1KTZ B;  1KL8 A;  2J8B A;  5DU1 A;  2GOO C;  1KBS A;  1TFS A;  1NTN A;  1V6P A;  2GOO B;  4ZQY A;  2LA1 A;  1REW C;  1B41 B;  2H8U A;  4P7U A;  1FAS A;  4XJJ A;  1IQ9 A;  4LFT A;  2X8B B;  1FSC A;  1COD A;  2UWR A;  2CTX A;  1BXP A;  6EBX A;  1IDG A;  1JGK A;  2QJ9 C;  1RGJ A;  1CXO A;  4AEA A;  2MUO A;  2H64 B;  1IDL A;  3PLC A;  3FEV A;  1KBA A;  1NYU A;  2PJY C;  1W6B A;  1IKC A;  1RL5 A;  2I9B E;  1CRF A;  1CDT A;  1LXH A;  5IMY C;  1KBT A;  1XT3 A;  2H5F A;  1QKD A;  4DO8 A;  5IMT D;  3KFD I;  5DZ5 A;  1HC9 A;  1CTX A;  1JE9 A;  5DO6 A;  1CCQ A;  1CDQ A;  1UG4 A;  2MFA A;  2ABX A;  2OFS A;  1HOY A;  1CXN A;  1IDH A;  3U73 U;  2CRS A;  5EBX A;  1L4W A;  1KFH A;  2MJ0 A;  1ABT A;  2LCR A;  1HAA A;  1QM7 A;  3BT2 U;  1KU6 B;  4FAO E;  4HQP F;  1YWH A;  4EY8 B;  2QC1 A;  1PLO A;  2MJ4 A;  3LAQ U;  3HH7 A;  2VLW A;  2BHI A;  4IYE A;  1G6M A;  3EBX A;  1LJZ A;  1ERA A;  4OM4 A;  4FAO C;  2PJY B;  2CRT A;  1CDR A;  2BTX A;  2H62 D;  2H7Z A;  2MJY A;  4OM5 A;  1CVO A;  1FRA A;  2L5S A;  1S4Y A;  2H62 C;  1CDS A;  1MAH F;  1NOR A;  2CCX A;  1LXG A;  1MR6 A;  1JBD A;  1DRS A;  1H0J A;  2JQP A;  1COE A;  2ERA A;  1NXB A;  1HC9 B;  1KS6 A;  1CB9 A;  1NYS A;  4UY2 C;  3NDS A;  1NEA A;  3NEQ A;  2FD6 U;  1F94 A;  1M9Z A;  1NTX A;  2L03 A;  3NH7 A;  2CDX A;  1ES7 B;  2MHY A;  4QTI U;  1TXA A;  1QKE A;  2N99 A;  3ERA A;  2HLR A;  1IDI A;  1LSI A;  2QJB C;  1VB0 A;  3KFD E;  1IJC A;  3BT1 U;  1BTE A;  2H7Z B;  1CRE A;  1ONJ A;  2JVE A;  2QJA C;  2UX2 A;  2HLQ A;  1I02 A;  1KC4 A;  3EVS C;  1FFJ A; 
#chains in the Genus database with same CATH topology
 1CHV S;  1FF4 A;  4BIK B;  1LX5 B;  2H64 C;  4RUD A;  2K3G A;  2NBT A;  3QB4 B;  1IK8 A;  4BDT B;  1F8U B;  2MUP A;  1HAJ A;  1TXB A;  1TGX A;  3U74 U;  1FSS B;  1ERG A;  1KXI A;  1ZAD A;  3VTS A;  1KTZ B;  1KL8 A;  2J8B A;  5DU1 A;  2GOO C;  1KBS A;  1TFS A;  1NTN A;  1V6P A;  2GOO B;  4ZQY A;  2LA1 A;  1REW C;  1B41 B;  2H8U A;  4P7U A;  1FAS A;  4XJJ A;  1IQ9 A;  4LFT A;  2X8B B;  1FSC A;  1COD A;  2UWR A;  2CTX A;  1BXP A;  6EBX A;  1IDG A;  1JGK A;  2QJ9 C;  1RGJ A;  1CXO A;  4AEA A;  2MUO A;  2H64 B;  1IDL A;  3PLC A;  3FEV A;  1KBA A;  1NYU A;  2PJY C;  1W6B A;  1IKC A;  1RL5 A;  2I9B E;  1CRF A;  1CDT A;  1LXH A;  5IMY C;  1KBT A;  1XT3 A;  2H5F A;  1QKD A;  4DO8 A;  5IMT D;  3KFD I;  5DZ5 A;  1HC9 A;  1CTX A;  1JE9 A;  5DO6 A;  1CCQ A;  1CDQ A;  1UG4 A;  2MFA A;  2ABX A;  2OFS A;  1HOY A;  1CXN A;  1IDH A;  3U73 U;  2CRS A;  5EBX A;  1L4W A;  1KFH A;  2MJ0 A;  1ABT A;  2LCR A;  1HAA A;  1QM7 A;  3BT2 U;  1KU6 B;  4FAO E;  4HQP F;  1YWH A;  4EY8 B;  2QC1 A;  1PLO A;  2MJ4 A;  3LAQ U;  3HH7 A;  2VLW A;  2BHI A;  4IYE A;  1G6M A;  3EBX A;  1LJZ A;  1ERA A;  4OM4 A;  4FAO C;  2PJY B;  2CRT A;  1CDR A;  2BTX A;  2H62 D;  2H7Z A;  2MJY A;  4OM5 A;  1CVO A;  1FRA A;  2L5S A;  1S4Y A;  2H62 C;  1CDS A;  1MAH F;  1NOR A;  2CCX A;  4KSN A;  1LXG A;  1MR6 A;  1JBD A;  1DRS A;  1H0J A;  2JQP A;  1COE A;  2ERA A;  1NXB A;  1HC9 B;  1KS6 A;  1CB9 A;  1NYS A;  4UY2 C;  3NDS A;  1NEA A;  3NEQ A;  2FD6 U;  1F94 A;  1M9Z A;  1NTX A;  2L03 A;  3NH7 A;  2CDX A;  1ES7 B;  2MHY A;  4QTI U;  1TXA A;  1QKE A;  2N99 A;  3ERA A;  2HLR A;  1IDI A;  1LSI A;  2QJB C;  1VB0 A;  3KFD E;  1IJC A;  3BT1 U;  1BTE A;  2H7Z B;  1CRE A;  1ONJ A;  2JVE A;  2QJA C;  2UX2 A;  2HLQ A;  1I02 A;  1KC4 A;  3EVS C;  1FFJ A; 
#chains in the Genus database with same CATH homology
 1CHV S;  1FF4 A;  4BIK B;  1LX5 B;  2H64 C;  4RUD A;  2K3G A;  2NBT A;  3QB4 B;  1IK8 A;  4BDT B;  1F8U B;  2MUP A;  1HAJ A;  1TXB A;  1TGX A;  3U74 U;  1FSS B;  1ERG A;  1KXI A;  1ZAD A;  3VTS A;  1KTZ B;  1KL8 A;  2J8B A;  5DU1 A;  2GOO C;  1KBS A;  1TFS A;  1NTN A;  1V6P A;  2GOO B;  4ZQY A;  2LA1 A;  1REW C;  1B41 B;  2H8U A;  4P7U A;  1FAS A;  4XJJ A;  1IQ9 A;  4LFT A;  2X8B B;  1FSC A;  1COD A;  2UWR A;  2CTX A;  1BXP A;  6EBX A;  1IDG A;  1JGK A;  2QJ9 C;  1RGJ A;  1CXO A;  4AEA A;  2MUO A;  2H64 B;  1IDL A;  3PLC A;  3FEV A;  1KBA A;  1NYU A;  2PJY C;  1W6B A;  1IKC A;  1RL5 A;  2I9B E;  1CRF A;  1CDT A;  1LXH A;  5IMY C;  1KBT A;  1XT3 A;  2H5F A;  1QKD A;  4DO8 A;  5IMT D;  3KFD I;  5DZ5 A;  1HC9 A;  1CTX A;  1JE9 A;  5DO6 A;  1CCQ A;  1CDQ A;  1UG4 A;  2MFA A;  2ABX A;  2OFS A;  1HOY A;  1CXN A;  1IDH A;  3U73 U;  2CRS A;  5EBX A;  1L4W A;  1KFH A;  2MJ0 A;  1ABT A;  2LCR A;  1HAA A;  1QM7 A;  3BT2 U;  1KU6 B;  4FAO E;  4HQP F;  1YWH A;  4EY8 B;  2QC1 A;  1PLO A;  2MJ4 A;  3LAQ U;  3HH7 A;  2VLW A;  2BHI A;  4IYE A;  1G6M A;  3EBX A;  1LJZ A;  1ERA A;  4OM4 A;  4FAO C;  2PJY B;  2CRT A;  1CDR A;  2BTX A;  2H62 D;  2H7Z A;  2MJY A;  4OM5 A;  1CVO A;  1FRA A;  2L5S A;  1S4Y A;  2H62 C;  1CDS A;  1MAH F;  1NOR A;  2CCX A;  4KSN A;  1LXG A;  1MR6 A;  1JBD A;  1DRS A;  1H0J A;  2JQP A;  1COE A;  2ERA A;  1NXB A;  1HC9 B;  1KS6 A;  1CB9 A;  1NYS A;  4UY2 C;  3NDS A;  1NEA A;  3NEQ A;  2FD6 U;  1F94 A;  1M9Z A;  1NTX A;  2L03 A;  3NH7 A;  2CDX A;  1ES7 B;  2MHY A;  4QTI U;  1TXA A;  1QKE A;  2N99 A;  3ERA A;  2HLR A;  1IDI A;  1LSI A;  2QJB C;  1VB0 A;  3KFD E;  1IJC A;  3BT1 U;  1BTE A;  2H7Z B;  1CRE A;  1ONJ A;  2JVE A;  2QJA C;  2UX2 A;  2HLQ A;  1I02 A;  1KC4 A;  3EVS C;  1FFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...