2MFAA

Mambalgin-2
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
57
structure length
57
Chain Sequence
LKCFQHGKVVTCHRDMKFCYHNTGMPFRNLKLILQGCSSSCSETENNKCCSTDRCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mambalgin-2
publication title Chemical synthesis, 3D structure, and ASIC binding site of the toxin mambalgin-2.
pubmed doi rcsb
molecule tags Toxin
total genus 10
structure length 57
sequence length 57
ec nomenclature
pdb deposition date 2013-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2mfaA00
3EBXA 3ERAA 1FASA 5EBXA 2MFAA 1CDRA 1KFHA 1NXBA 2BTXA 1KL8A 1KTZB 2H64B 3NDSA 1V6PA 1KXIA 4EY8B 1IDHA 1ZADA 3U74U 1RGJA 3NH7A 1CRFA 4AEAA 1LSIA 1I02A 3QB4B 1IDIA 3KFDE 1F8UB 2ABXA 2JQPA 2X8BB 1L4WA 2CTXA 5IMTD 1S4YA 1HOYA 2QC1A 2VLWA 2BHIA 1KU6B 2N99A 3U73U 5DU1A 2H64C 4ZQYA 2NBTA 1TXBA 2JVEA 1IDLA 2H8UA 2MUPA 1CREA 1CDTA 2QJBC 1QM7A 4FAOE 1IQ9A 2L03A 2QJ9C 2K3GA 1W6BA 1LXGA 1KBSA 2J8BA 4LFTA 1YWHA 1JGKA 1MR6A 1ABTA 1UG4A 2H7ZB 3EVSC 1IDGA 1NYUA 1IKCA 2CDXA 1CXNA 3HH7A 1PLOA 2HLQA 2GOOB 3NEQA 1KBAA 1ONJA 1HAJA 1NTNA 3VTSA 2MHYA 3FEVA 1HC9A 1FFJA 1FRAA 2CRSA 1G6MA 2H5FA 2PJYB 2UWRA 1KBTA 1TFSA 1QKEA 5DZ5A 1REWC 1JE9A 2OFSA 1LXHA 1NEAA 4HQPF 2MUOA 4IYEA 1TGXA 1ES7B 1TXAA 1MAHF 1DRSA 4UY2C 2QJAC 3BT2U 1NYSA 4DO8A 1LX5B 2ERAA 1CXOA 1CDQA 2HLRA 2LA1A 4P7UA 2MJYA 3BT1U 1JBDA 5DO6A 1ERGA 2MJ0A 1XT3A 1BTEA 1NTXA 1HAAA 4BDTB 4RUDA 2LCRA 1CODA 1IJCA 1RL5A 1M9ZA 1CTXA 3KFDI 2H7ZA 1VB0A 3LAQU 1LJZA 1FSSB 2MJ4A 4OM4A 2CRTA 2FD6U 1HC9B 1IK8A 1CHVS 1KS6A 1QKDA 4OM5A 5IMYC 1COEA 1CDSA 2CCXA 1CCQA 1ERAA 4BIKB 1CB9A 1B41B 1FSCA 2I9BE 4FAOC 1NORA 2H62D 1H0JA 2GOOC 1BXPA 6EBXA 1CVOA 3PLCA 4XJJA 1KC4A 1FF4A 2UX2A 2PJYC 2L5SA 1F94A 2H62C 4QTIU
chains in the Genus database with same CATH superfamily
3EBXA 3ERAA 1FASA 5EBXA 2MFAA 1CDRA 1KFHA 1NXBA 2BTXA 1KL8A 1KTZB 2H64B 3NDSA 1V6PA 1KXIA 4EY8B 1IDHA 1ZADA 3U74U 1RGJA 3NH7A 1CRFA 4AEAA 1LSIA 1I02A 3QB4B 1IDIA 3KFDE 1F8UB 2ABXA 2JQPA 2X8BB 1L4WA 2CTXA 5IMTD 1S4YA 1HOYA 2QC1A 2VLWA 2BHIA 1KU6B 2N99A 3U73U 5DU1A 2H64C 4ZQYA 2NBTA 1TXBA 2JVEA 1IDLA 2H8UA 2MUPA 1CREA 1CDTA 2QJBC 1QM7A 4FAOE 1IQ9A 2L03A 2QJ9C 4KSNA 2K3GA 1W6BA 1LXGA 1KBSA 2J8BA 4LFTA 1YWHA 1JGKA 1MR6A 1ABTA 1UG4A 2H7ZB 3EVSC 1IDGA 1NYUA 1IKCA 2CDXA 1CXNA 3HH7A 1PLOA 2HLQA 2GOOB 3NEQA 1KBAA 1ONJA 1HAJA 1NTNA 3VTSA 2MHYA 3FEVA 1HC9A 1FFJA 1FRAA 2CRSA 1G6MA 2H5FA 2PJYB 2UWRA 1KBTA 1TFSA 1QKEA 5DZ5A 1REWC 1JE9A 2OFSA 1LXHA 1NEAA 4HQPF 2MUOA 4IYEA 1TGXA 1ES7B 1TXAA 1MAHF 1DRSA 4UY2C 2QJAC 3BT2U 1NYSA 4DO8A 1LX5B 2ERAA 1CXOA 1CDQA 2HLRA 2LA1A 4P7UA 2MJYA 3BT1U 1JBDA 5DO6A 1ERGA 2MJ0A 1XT3A 1BTEA 1NTXA 1HAAA 4BDTB 4RUDA 2LCRA 1CODA 1IJCA 1RL5A 1M9ZA 1CTXA 3KFDI 2H7ZA 1VB0A 3LAQU 1LJZA 1FSSB 2MJ4A 4OM4A 2CRTA 2FD6U 1HC9B 1IK8A 1CHVS 1KS6A 1QKDA 4OM5A 5IMYC 1COEA 1CDSA 2CCXA 1CCQA 1ERAA 4BIKB 1CB9A 1B41B 1FSCA 2I9BE 4FAOC 1NORA 2H62D 1H0JA 2GOOC 1BXPA 6EBXA 1CVOA 3PLCA 4XJJA 1KC4A 1FF4A 2UX2A 2PJYC 2L5SA 1F94A 2H62C 4QTIU
chains in the Genus database with same CATH topology
3EBXA 3ERAA 1FASA 5EBXA 2MFAA 1CDRA 1KFHA 1NXBA 2BTXA 1KL8A 1KTZB 2H64B 3NDSA 1V6PA 1KXIA 4EY8B 1IDHA 1ZADA 3U74U 1RGJA 3NH7A 1CRFA 4AEAA 1LSIA 1I02A 3QB4B 1IDIA 3KFDE 1F8UB 2ABXA 2JQPA 2X8BB 1L4WA 2CTXA 5IMTD 1S4YA 1HOYA 2QC1A 2VLWA 2BHIA 1KU6B 2N99A 3U73U 5DU1A 2H64C 4ZQYA 2NBTA 1TXBA 2JVEA 1IDLA 2H8UA 2MUPA 1CREA 1CDTA 2QJBC 1QM7A 4FAOE 1IQ9A 2L03A 2QJ9C 4KSNA 2K3GA 1W6BA 1LXGA 1KBSA 2J8BA 4LFTA 1YWHA 1JGKA 1MR6A 1ABTA 1UG4A 2H7ZB 3EVSC 1IDGA 1NYUA 1IKCA 2CDXA 1CXNA 3HH7A 1PLOA 2HLQA 2GOOB 3NEQA 1KBAA 1ONJA 1HAJA 1NTNA 3VTSA 2MHYA 3FEVA 1HC9A 1FFJA 1FRAA 2CRSA 1G6MA 2H5FA 2PJYB 2UWRA 1KBTA 1TFSA 1QKEA 5DZ5A 1REWC 1JE9A 2OFSA 1LXHA 1NEAA 4HQPF 2MUOA 4IYEA 1TGXA 1ES7B 1TXAA 1MAHF 1DRSA 4UY2C 2QJAC 3BT2U 1NYSA 4DO8A 1LX5B 2ERAA 1CXOA 1CDQA 2HLRA 2LA1A 4P7UA 2MJYA 3BT1U 1JBDA 5DO6A 1ERGA 2MJ0A 1XT3A 1BTEA 1NTXA 1HAAA 4BDTB 4RUDA 2LCRA 1CODA 1IJCA 1RL5A 1M9ZA 1CTXA 3KFDI 2H7ZA 1VB0A 3LAQU 1LJZA 1FSSB 2MJ4A 4OM4A 2CRTA 2FD6U 1HC9B 1IK8A 1CHVS 1KS6A 1QKDA 4OM5A 5IMYC 1COEA 1CDSA 2CCXA 1CCQA 1ERAA 4BIKB 1CB9A 1B41B 1FSCA 2I9BE 4FAOC 1NORA 2H62D 1H0JA 2GOOC 1BXPA 6EBXA 1CVOA 3PLCA 4XJJA 1KC4A 1FF4A 2UX2A 2PJYC 2L5SA 1F94A 2H62C 4QTIU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBX A;  3ERA A;  1FAS A;  5EBX A;  2MFA A;  1CDR A;  1KFH A;  1NXB A;  2BTX A;  1KL8 A;  1KTZ B;  2H64 B;  3NDS A;  1V6P A;  1KXI A;  4EY8 B;  1IDH A;  1ZAD A;  3U74 U;  1RGJ A;  3NH7 A;  1CRF A;  4AEA A;  1LSI A;  1I02 A;  3QB4 B;  1IDI A;  3KFD E;  1F8U B;  2ABX A;  2JQP A;  2X8B B;  1L4W A;  2CTX A;  5IMT D;  1S4Y A;  1HOY A;  2QC1 A;  2VLW A;  2BHI A;  1KU6 B;  2N99 A;  3U73 U;  5DU1 A;  2H64 C;  4ZQY A;  2NBT A;  1TXB A;  2JVE A;  1IDL A;  2H8U A;  2MUP A;  1CRE A;  1CDT A;  2QJB C;  1QM7 A;  4FAO E;  1IQ9 A;  2L03 A;  2QJ9 C;  2K3G A;  1W6B A;  1LXG A;  1KBS A;  2J8B A;  4LFT A;  1YWH A;  1JGK A;  1MR6 A;  1ABT A;  1UG4 A;  2H7Z B;  3EVS C;  1IDG A;  1NYU A;  1IKC A;  2CDX A;  1CXN A;  3HH7 A;  1PLO A;  2HLQ A;  2GOO B;  3NEQ A;  1KBA A;  1ONJ A;  1HAJ A;  1NTN A;  3VTS A;  2MHY A;  3FEV A;  1HC9 A;  1FFJ A;  1FRA A;  2CRS A;  1G6M A;  2H5F A;  2PJY B;  2UWR A;  1KBT A;  1TFS A;  1QKE A;  5DZ5 A;  1REW C;  1JE9 A;  2OFS A;  1LXH A;  1NEA A;  4HQP F;  2MUO A;  4IYE A;  1TGX A;  1ES7 B;  1TXA A;  1MAH F;  1DRS A;  4UY2 C;  2QJA C;  3BT2 U;  1NYS A;  4DO8 A;  1LX5 B;  2ERA A;  1CXO A;  1CDQ A;  2HLR A;  2LA1 A;  4P7U A;  2MJY A;  3BT1 U;  1JBD A;  5DO6 A;  1ERG A;  2MJ0 A;  1XT3 A;  1BTE A;  1NTX A;  1HAA A;  4BDT B;  4RUD A;  2LCR A;  1COD A;  1IJC A;  1RL5 A;  1M9Z A;  1CTX A;  3KFD I;  2H7Z A;  1VB0 A;  3LAQ U;  1LJZ A;  1FSS B;  2MJ4 A;  4OM4 A;  2CRT A;  2FD6 U;  1HC9 B;  1IK8 A;  1CHV S;  1KS6 A;  1QKD A;  4OM5 A;  5IMY C;  1COE A;  1CDS A;  2CCX A;  1CCQ A;  1ERA A;  4BIK B;  1CB9 A;  1B41 B;  1FSC A;  2I9B E;  4FAO C;  1NOR A;  2H62 D;  1H0J A;  2GOO C;  1BXP A;  6EBX A;  1CVO A;  3PLC A;  4XJJ A;  1KC4 A;  1FF4 A;  2UX2 A;  2PJY C;  2L5S A;  1F94 A;  2H62 C;  4QTI U; 
#chains in the Genus database with same CATH topology
 3EBX A;  3ERA A;  1FAS A;  5EBX A;  2MFA A;  1CDR A;  1KFH A;  1NXB A;  2BTX A;  1KL8 A;  1KTZ B;  2H64 B;  3NDS A;  1V6P A;  1KXI A;  4EY8 B;  1IDH A;  1ZAD A;  3U74 U;  1RGJ A;  3NH7 A;  1CRF A;  4AEA A;  1LSI A;  1I02 A;  3QB4 B;  1IDI A;  3KFD E;  1F8U B;  2ABX A;  2JQP A;  2X8B B;  1L4W A;  2CTX A;  5IMT D;  1S4Y A;  1HOY A;  2QC1 A;  2VLW A;  2BHI A;  1KU6 B;  2N99 A;  3U73 U;  5DU1 A;  2H64 C;  4ZQY A;  2NBT A;  1TXB A;  2JVE A;  1IDL A;  2H8U A;  2MUP A;  1CRE A;  1CDT A;  2QJB C;  1QM7 A;  4FAO E;  1IQ9 A;  2L03 A;  2QJ9 C;  4KSN A;  2K3G A;  1W6B A;  1LXG A;  1KBS A;  2J8B A;  4LFT A;  1YWH A;  1JGK A;  1MR6 A;  1ABT A;  1UG4 A;  2H7Z B;  3EVS C;  1IDG A;  1NYU A;  1IKC A;  2CDX A;  1CXN A;  3HH7 A;  1PLO A;  2HLQ A;  2GOO B;  3NEQ A;  1KBA A;  1ONJ A;  1HAJ A;  1NTN A;  3VTS A;  2MHY A;  3FEV A;  1HC9 A;  1FFJ A;  1FRA A;  2CRS A;  1G6M A;  2H5F A;  2PJY B;  2UWR A;  1KBT A;  1TFS A;  1QKE A;  5DZ5 A;  1REW C;  1JE9 A;  2OFS A;  1LXH A;  1NEA A;  4HQP F;  2MUO A;  4IYE A;  1TGX A;  1ES7 B;  1TXA A;  1MAH F;  1DRS A;  4UY2 C;  2QJA C;  3BT2 U;  1NYS A;  4DO8 A;  1LX5 B;  2ERA A;  1CXO A;  1CDQ A;  2HLR A;  2LA1 A;  4P7U A;  2MJY A;  3BT1 U;  1JBD A;  5DO6 A;  1ERG A;  2MJ0 A;  1XT3 A;  1BTE A;  1NTX A;  1HAA A;  4BDT B;  4RUD A;  2LCR A;  1COD A;  1IJC A;  1RL5 A;  1M9Z A;  1CTX A;  3KFD I;  2H7Z A;  1VB0 A;  3LAQ U;  1LJZ A;  1FSS B;  2MJ4 A;  4OM4 A;  2CRT A;  2FD6 U;  1HC9 B;  1IK8 A;  1CHV S;  1KS6 A;  1QKD A;  4OM5 A;  5IMY C;  1COE A;  1CDS A;  2CCX A;  1CCQ A;  1ERA A;  4BIK B;  1CB9 A;  1B41 B;  1FSC A;  2I9B E;  4FAO C;  1NOR A;  2H62 D;  1H0J A;  2GOO C;  1BXP A;  6EBX A;  1CVO A;  3PLC A;  4XJJ A;  1KC4 A;  1FF4 A;  2UX2 A;  2PJY C;  2L5S A;  1F94 A;  2H62 C;  4QTI U; 
#chains in the Genus database with same CATH homology
 3EBX A;  3ERA A;  1FAS A;  5EBX A;  2MFA A;  1CDR A;  1KFH A;  1NXB A;  2BTX A;  1KL8 A;  1KTZ B;  2H64 B;  3NDS A;  1V6P A;  1KXI A;  4EY8 B;  1IDH A;  1ZAD A;  3U74 U;  1RGJ A;  3NH7 A;  1CRF A;  4AEA A;  1LSI A;  1I02 A;  3QB4 B;  1IDI A;  3KFD E;  1F8U B;  2ABX A;  2JQP A;  2X8B B;  1L4W A;  2CTX A;  5IMT D;  1S4Y A;  1HOY A;  2QC1 A;  2VLW A;  2BHI A;  1KU6 B;  2N99 A;  3U73 U;  5DU1 A;  2H64 C;  4ZQY A;  2NBT A;  1TXB A;  2JVE A;  1IDL A;  2H8U A;  2MUP A;  1CRE A;  1CDT A;  2QJB C;  1QM7 A;  4FAO E;  1IQ9 A;  2L03 A;  2QJ9 C;  4KSN A;  2K3G A;  1W6B A;  1LXG A;  1KBS A;  2J8B A;  4LFT A;  1YWH A;  1JGK A;  1MR6 A;  1ABT A;  1UG4 A;  2H7Z B;  3EVS C;  1IDG A;  1NYU A;  1IKC A;  2CDX A;  1CXN A;  3HH7 A;  1PLO A;  2HLQ A;  2GOO B;  3NEQ A;  1KBA A;  1ONJ A;  1HAJ A;  1NTN A;  3VTS A;  2MHY A;  3FEV A;  1HC9 A;  1FFJ A;  1FRA A;  2CRS A;  1G6M A;  2H5F A;  2PJY B;  2UWR A;  1KBT A;  1TFS A;  1QKE A;  5DZ5 A;  1REW C;  1JE9 A;  2OFS A;  1LXH A;  1NEA A;  4HQP F;  2MUO A;  4IYE A;  1TGX A;  1ES7 B;  1TXA A;  1MAH F;  1DRS A;  4UY2 C;  2QJA C;  3BT2 U;  1NYS A;  4DO8 A;  1LX5 B;  2ERA A;  1CXO A;  1CDQ A;  2HLR A;  2LA1 A;  4P7U A;  2MJY A;  3BT1 U;  1JBD A;  5DO6 A;  1ERG A;  2MJ0 A;  1XT3 A;  1BTE A;  1NTX A;  1HAA A;  4BDT B;  4RUD A;  2LCR A;  1COD A;  1IJC A;  1RL5 A;  1M9Z A;  1CTX A;  3KFD I;  2H7Z A;  1VB0 A;  3LAQ U;  1LJZ A;  1FSS B;  2MJ4 A;  4OM4 A;  2CRT A;  2FD6 U;  1HC9 B;  1IK8 A;  1CHV S;  1KS6 A;  1QKD A;  4OM5 A;  5IMY C;  1COE A;  1CDS A;  2CCX A;  1CCQ A;  1ERA A;  4BIK B;  1CB9 A;  1B41 B;  1FSC A;  2I9B E;  4FAO C;  1NOR A;  2H62 D;  1H0J A;  2GOO C;  1BXP A;  6EBX A;  1CVO A;  3PLC A;  4XJJ A;  1KC4 A;  1FF4 A;  2UX2 A;  2PJY C;  2L5S A;  1F94 A;  2H62 C;  4QTI U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...