1CREA

Cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN II
publication title Cardiotoxin II from Taiwan cobra venom, Naja naja atra. Structure in solution and comparison among homologous cardiotoxins.
pubmed rcsb
source organism Naja atra
molecule tags Cardiotoxin
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1creA00
1NORA 2GOOC 1CTXA 2ABXA 4LFTA 1BXPA 2X8BB 1F94A 1ZADA 1QM7A 2UX2A 1LJZA 1IDGA 1W6BA 2CDXA 3ERAA 4UY2C 1ERAA 2MUPA 1HOYA 1ES7B 3U74U 1BTEA 1CDQA 4RUDA 2H62C 1F8UB 1KL8A 2H64C 3FEVA 1CCQA 1KBAA 1KBTA 3NEQA 1PLOA 2BHIA 2MJYA 3BT1U 1I02A 4HQPF 1KFHA 2CRSA 2MUOA 1TGXA 4EY8B 5EBXA 1QKDA 2VLWA 3LAQU 4OM5A 4OM4A 1IKCA 1REWC 1KC4A 3EBXA 1FSCA 2H5FA 3EVSC 1CDSA 2HLRA 1CDTA 1NTNA 2L5SA 1QKEA 1CB9A 1CODA 4ZQYA 1IDHA 2QJAC 2MJ0A 3KFDE 4IYEA 1HC9B 1NXBA 2QJ9C 2LA1A 2PJYB 1LXHA 2QJBC 5IMYC 5DU1A 1FRAA 1XT3A 1IDIA 1KXIA 2OFSA 1NYSA 2CCXA 2I9BE 1ERGA 1KS6A 1FASA 4QTIU 1MR6A 3QB4B 1H0JA 1KU6B 2MJ4A 3VTSA 3KFDI 4BDTB 1M9ZA 1NTXA 2NBTA 2GOOB 3HH7A 1CXOA 2UWRA 1VB0A 3NDSA 2H7ZB 1JE9A 1JGKA 1V6PA 1DRSA 1CVOA 1CXNA 1COEA 1YWHA 1NYUA 1IQ9A 5DZ5A 2J8BA 4AEAA 1MAHF 5DO6A 1JBDA 1IJCA 1CREA 2N99A 1TXAA 1LXGA 1IK8A 2LCRA 1TFSA 1UG4A 4XJJA 4P7UA 1NEAA 1KTZB 1CDRA 1LSIA 3BT2U 2CRTA 3NH7A 4FAOC 1FFJA 3U73U 4DO8A 1CHVS 1LX5B 2CTXA 2PJYC 1FF4A 1IDLA 3PLCA 2JVEA 2MHYA 1FSSB 2H8UA 4BIKB 2BTXA 2ERAA 2HLQA 1ABTA 2H7ZA 2FD6U 2MFAA 1HC9A 1KBSA 2K3GA 4FAOE 1G6MA 1S4YA 1HAJA 1B41B 2L03A 2JQPA 2QC1A 1L4WA 6EBXA 1ONJA 1RGJA 1TXBA 2H64B 5IMTD 2H62D 1CRFA 1RL5A 1HAAA
chains in the Genus database with same CATH superfamily
1NORA 2GOOC 1CTXA 2ABXA 4LFTA 1BXPA 2X8BB 1F94A 1ZADA 1QM7A 2UX2A 1LJZA 1IDGA 1W6BA 2CDXA 3ERAA 4UY2C 1ERAA 2MUPA 1HOYA 1ES7B 3U74U 1BTEA 1CDQA 4RUDA 2H62C 1F8UB 1KL8A 2H64C 3FEVA 1CCQA 1KBAA 1KBTA 3NEQA 1PLOA 2BHIA 2MJYA 3BT1U 1I02A 4HQPF 1KFHA 2CRSA 2MUOA 1TGXA 4EY8B 5EBXA 1QKDA 2VLWA 3LAQU 4OM5A 4OM4A 1IKCA 1REWC 1KC4A 3EBXA 1FSCA 2H5FA 3EVSC 1CDSA 2HLRA 1CDTA 1NTNA 4KSNA 2L5SA 1QKEA 1CB9A 1CODA 4ZQYA 1IDHA 2QJAC 2MJ0A 3KFDE 4IYEA 1HC9B 1NXBA 2QJ9C 2LA1A 2PJYB 1LXHA 2QJBC 5IMYC 5DU1A 1FRAA 1XT3A 1IDIA 1KXIA 2OFSA 1NYSA 2CCXA 2I9BE 1ERGA 1KS6A 1FASA 4QTIU 1MR6A 3QB4B 1H0JA 1KU6B 2MJ4A 3VTSA 3KFDI 4BDTB 1M9ZA 1NTXA 2NBTA 2GOOB 3HH7A 1CXOA 2UWRA 1VB0A 3NDSA 2H7ZB 1JE9A 1JGKA 1V6PA 1DRSA 1CVOA 1CXNA 1COEA 1YWHA 1NYUA 1IQ9A 5DZ5A 2J8BA 4AEAA 1MAHF 5DO6A 1JBDA 1IJCA 1CREA 2N99A 1TXAA 1LXGA 1IK8A 2LCRA 1TFSA 1UG4A 4XJJA 4P7UA 1NEAA 1KTZB 1CDRA 1LSIA 3BT2U 2CRTA 3NH7A 4FAOC 1FFJA 3U73U 4DO8A 1CHVS 1LX5B 2CTXA 2PJYC 1FF4A 1IDLA 3PLCA 2JVEA 2MHYA 1FSSB 2H8UA 4BIKB 2BTXA 2ERAA 2HLQA 1ABTA 2H7ZA 2FD6U 2MFAA 1HC9A 1KBSA 2K3GA 4FAOE 1G6MA 1S4YA 1HAJA 1B41B 2L03A 2JQPA 2QC1A 1L4WA 6EBXA 1ONJA 1RGJA 1TXBA 2H64B 5IMTD 2H62D 1CRFA 1RL5A 1HAAA
chains in the Genus database with same CATH topology
1NORA 2GOOC 1CTXA 2ABXA 4LFTA 1BXPA 2X8BB 1F94A 1ZADA 1QM7A 2UX2A 1LJZA 1IDGA 1W6BA 2CDXA 3ERAA 4UY2C 1ERAA 2MUPA 1HOYA 1ES7B 3U74U 1BTEA 1CDQA 4RUDA 2H62C 1F8UB 1KL8A 2H64C 3FEVA 1CCQA 1KBAA 1KBTA 3NEQA 1PLOA 2BHIA 2MJYA 3BT1U 1I02A 4HQPF 1KFHA 2CRSA 2MUOA 1TGXA 4EY8B 5EBXA 1QKDA 2VLWA 3LAQU 4OM5A 4OM4A 1IKCA 1REWC 1KC4A 3EBXA 1FSCA 2H5FA 3EVSC 1CDSA 2HLRA 1CDTA 1NTNA 4KSNA 2L5SA 1QKEA 1CB9A 1CODA 4ZQYA 1IDHA 2QJAC 2MJ0A 3KFDE 4IYEA 1HC9B 1NXBA 2QJ9C 2LA1A 2PJYB 1LXHA 2QJBC 5IMYC 5DU1A 1FRAA 1XT3A 1IDIA 1KXIA 2OFSA 1NYSA 2CCXA 2I9BE 1ERGA 1KS6A 1FASA 4QTIU 1MR6A 3QB4B 1H0JA 1KU6B 2MJ4A 3VTSA 3KFDI 4BDTB 1M9ZA 1NTXA 2NBTA 2GOOB 3HH7A 1CXOA 2UWRA 1VB0A 3NDSA 2H7ZB 1JE9A 1JGKA 1V6PA 1DRSA 1CVOA 1CXNA 1COEA 1YWHA 1NYUA 1IQ9A 5DZ5A 2J8BA 4AEAA 1MAHF 5DO6A 1JBDA 1IJCA 1CREA 2N99A 1TXAA 1LXGA 1IK8A 2LCRA 1TFSA 1UG4A 4XJJA 4P7UA 1NEAA 1KTZB 1CDRA 1LSIA 3BT2U 2CRTA 3NH7A 4FAOC 1FFJA 3U73U 4DO8A 1CHVS 1LX5B 2CTXA 2PJYC 1FF4A 1IDLA 3PLCA 2JVEA 2MHYA 1FSSB 2H8UA 4BIKB 2BTXA 2ERAA 2HLQA 1ABTA 2H7ZA 2FD6U 2MFAA 1HC9A 1KBSA 2K3GA 4FAOE 1G6MA 1S4YA 1HAJA 1B41B 2L03A 2JQPA 2QC1A 1L4WA 6EBXA 1ONJA 1RGJA 1TXBA 2H64B 5IMTD 2H62D 1CRFA 1RL5A 1HAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NOR A;  2GOO C;  1CTX A;  2ABX A;  4LFT A;  1BXP A;  2X8B B;  1F94 A;  1ZAD A;  1QM7 A;  2UX2 A;  1LJZ A;  1IDG A;  1W6B A;  2CDX A;  3ERA A;  4UY2 C;  1ERA A;  2MUP A;  1HOY A;  1ES7 B;  3U74 U;  1BTE A;  1CDQ A;  4RUD A;  2H62 C;  1F8U B;  1KL8 A;  2H64 C;  3FEV A;  1CCQ A;  1KBA A;  1KBT A;  3NEQ A;  1PLO A;  2BHI A;  2MJY A;  3BT1 U;  1I02 A;  4HQP F;  1KFH A;  2CRS A;  2MUO A;  1TGX A;  4EY8 B;  5EBX A;  1QKD A;  2VLW A;  3LAQ U;  4OM5 A;  4OM4 A;  1IKC A;  1REW C;  1KC4 A;  3EBX A;  1FSC A;  2H5F A;  3EVS C;  1CDS A;  2HLR A;  1CDT A;  1NTN A;  2L5S A;  1QKE A;  1CB9 A;  1COD A;  4ZQY A;  1IDH A;  2QJA C;  2MJ0 A;  3KFD E;  4IYE A;  1HC9 B;  1NXB A;  2QJ9 C;  2LA1 A;  2PJY B;  1LXH A;  2QJB C;  5IMY C;  5DU1 A;  1FRA A;  1XT3 A;  1IDI A;  1KXI A;  2OFS A;  1NYS A;  2CCX A;  2I9B E;  1ERG A;  1KS6 A;  1FAS A;  4QTI U;  1MR6 A;  3QB4 B;  1H0J A;  1KU6 B;  2MJ4 A;  3VTS A;  3KFD I;  4BDT B;  1M9Z A;  1NTX A;  2NBT A;  2GOO B;  3HH7 A;  1CXO A;  2UWR A;  1VB0 A;  3NDS A;  2H7Z B;  1JE9 A;  1JGK A;  1V6P A;  1DRS A;  1CVO A;  1CXN A;  1COE A;  1YWH A;  1NYU A;  1IQ9 A;  5DZ5 A;  2J8B A;  4AEA A;  1MAH F;  5DO6 A;  1JBD A;  1IJC A;  1CRE A;  2N99 A;  1TXA A;  1LXG A;  1IK8 A;  2LCR A;  1TFS A;  1UG4 A;  4XJJ A;  4P7U A;  1NEA A;  1KTZ B;  1CDR A;  1LSI A;  3BT2 U;  2CRT A;  3NH7 A;  4FAO C;  1FFJ A;  3U73 U;  4DO8 A;  1CHV S;  1LX5 B;  2CTX A;  2PJY C;  1FF4 A;  1IDL A;  3PLC A;  2JVE A;  2MHY A;  1FSS B;  2H8U A;  4BIK B;  2BTX A;  2ERA A;  2HLQ A;  1ABT A;  2H7Z A;  2FD6 U;  2MFA A;  1HC9 A;  1KBS A;  2K3G A;  4FAO E;  1G6M A;  1S4Y A;  1HAJ A;  1B41 B;  2L03 A;  2JQP A;  2QC1 A;  1L4W A;  6EBX A;  1ONJ A;  1RGJ A;  1TXB A;  2H64 B;  5IMT D;  2H62 D;  1CRF A;  1RL5 A;  1HAA A; 
#chains in the Genus database with same CATH topology
 1NOR A;  2GOO C;  1CTX A;  2ABX A;  4LFT A;  1BXP A;  2X8B B;  1F94 A;  1ZAD A;  1QM7 A;  2UX2 A;  1LJZ A;  1IDG A;  1W6B A;  2CDX A;  3ERA A;  4UY2 C;  1ERA A;  2MUP A;  1HOY A;  1ES7 B;  3U74 U;  1BTE A;  1CDQ A;  4RUD A;  2H62 C;  1F8U B;  1KL8 A;  2H64 C;  3FEV A;  1CCQ A;  1KBA A;  1KBT A;  3NEQ A;  1PLO A;  2BHI A;  2MJY A;  3BT1 U;  1I02 A;  4HQP F;  1KFH A;  2CRS A;  2MUO A;  1TGX A;  4EY8 B;  5EBX A;  1QKD A;  2VLW A;  3LAQ U;  4OM5 A;  4OM4 A;  1IKC A;  1REW C;  1KC4 A;  3EBX A;  1FSC A;  2H5F A;  3EVS C;  1CDS A;  2HLR A;  1CDT A;  1NTN A;  4KSN A;  2L5S A;  1QKE A;  1CB9 A;  1COD A;  4ZQY A;  1IDH A;  2QJA C;  2MJ0 A;  3KFD E;  4IYE A;  1HC9 B;  1NXB A;  2QJ9 C;  2LA1 A;  2PJY B;  1LXH A;  2QJB C;  5IMY C;  5DU1 A;  1FRA A;  1XT3 A;  1IDI A;  1KXI A;  2OFS A;  1NYS A;  2CCX A;  2I9B E;  1ERG A;  1KS6 A;  1FAS A;  4QTI U;  1MR6 A;  3QB4 B;  1H0J A;  1KU6 B;  2MJ4 A;  3VTS A;  3KFD I;  4BDT B;  1M9Z A;  1NTX A;  2NBT A;  2GOO B;  3HH7 A;  1CXO A;  2UWR A;  1VB0 A;  3NDS A;  2H7Z B;  1JE9 A;  1JGK A;  1V6P A;  1DRS A;  1CVO A;  1CXN A;  1COE A;  1YWH A;  1NYU A;  1IQ9 A;  5DZ5 A;  2J8B A;  4AEA A;  1MAH F;  5DO6 A;  1JBD A;  1IJC A;  1CRE A;  2N99 A;  1TXA A;  1LXG A;  1IK8 A;  2LCR A;  1TFS A;  1UG4 A;  4XJJ A;  4P7U A;  1NEA A;  1KTZ B;  1CDR A;  1LSI A;  3BT2 U;  2CRT A;  3NH7 A;  4FAO C;  1FFJ A;  3U73 U;  4DO8 A;  1CHV S;  1LX5 B;  2CTX A;  2PJY C;  1FF4 A;  1IDL A;  3PLC A;  2JVE A;  2MHY A;  1FSS B;  2H8U A;  4BIK B;  2BTX A;  2ERA A;  2HLQ A;  1ABT A;  2H7Z A;  2FD6 U;  2MFA A;  1HC9 A;  1KBS A;  2K3G A;  4FAO E;  1G6M A;  1S4Y A;  1HAJ A;  1B41 B;  2L03 A;  2JQP A;  2QC1 A;  1L4W A;  6EBX A;  1ONJ A;  1RGJ A;  1TXB A;  2H64 B;  5IMT D;  2H62 D;  1CRF A;  1RL5 A;  1HAA A; 
#chains in the Genus database with same CATH homology
 1NOR A;  2GOO C;  1CTX A;  2ABX A;  4LFT A;  1BXP A;  2X8B B;  1F94 A;  1ZAD A;  1QM7 A;  2UX2 A;  1LJZ A;  1IDG A;  1W6B A;  2CDX A;  3ERA A;  4UY2 C;  1ERA A;  2MUP A;  1HOY A;  1ES7 B;  3U74 U;  1BTE A;  1CDQ A;  4RUD A;  2H62 C;  1F8U B;  1KL8 A;  2H64 C;  3FEV A;  1CCQ A;  1KBA A;  1KBT A;  3NEQ A;  1PLO A;  2BHI A;  2MJY A;  3BT1 U;  1I02 A;  4HQP F;  1KFH A;  2CRS A;  2MUO A;  1TGX A;  4EY8 B;  5EBX A;  1QKD A;  2VLW A;  3LAQ U;  4OM5 A;  4OM4 A;  1IKC A;  1REW C;  1KC4 A;  3EBX A;  1FSC A;  2H5F A;  3EVS C;  1CDS A;  2HLR A;  1CDT A;  1NTN A;  4KSN A;  2L5S A;  1QKE A;  1CB9 A;  1COD A;  4ZQY A;  1IDH A;  2QJA C;  2MJ0 A;  3KFD E;  4IYE A;  1HC9 B;  1NXB A;  2QJ9 C;  2LA1 A;  2PJY B;  1LXH A;  2QJB C;  5IMY C;  5DU1 A;  1FRA A;  1XT3 A;  1IDI A;  1KXI A;  2OFS A;  1NYS A;  2CCX A;  2I9B E;  1ERG A;  1KS6 A;  1FAS A;  4QTI U;  1MR6 A;  3QB4 B;  1H0J A;  1KU6 B;  2MJ4 A;  3VTS A;  3KFD I;  4BDT B;  1M9Z A;  1NTX A;  2NBT A;  2GOO B;  3HH7 A;  1CXO A;  2UWR A;  1VB0 A;  3NDS A;  2H7Z B;  1JE9 A;  1JGK A;  1V6P A;  1DRS A;  1CVO A;  1CXN A;  1COE A;  1YWH A;  1NYU A;  1IQ9 A;  5DZ5 A;  2J8B A;  4AEA A;  1MAH F;  5DO6 A;  1JBD A;  1IJC A;  1CRE A;  2N99 A;  1TXA A;  1LXG A;  1IK8 A;  2LCR A;  1TFS A;  1UG4 A;  4XJJ A;  4P7U A;  1NEA A;  1KTZ B;  1CDR A;  1LSI A;  3BT2 U;  2CRT A;  3NH7 A;  4FAO C;  1FFJ A;  3U73 U;  4DO8 A;  1CHV S;  1LX5 B;  2CTX A;  2PJY C;  1FF4 A;  1IDL A;  3PLC A;  2JVE A;  2MHY A;  1FSS B;  2H8U A;  4BIK B;  2BTX A;  2ERA A;  2HLQ A;  1ABT A;  2H7Z A;  2FD6 U;  2MFA A;  1HC9 A;  1KBS A;  2K3G A;  4FAO E;  1G6M A;  1S4Y A;  1HAJ A;  1B41 B;  2L03 A;  2JQP A;  2QC1 A;  1L4W A;  6EBX A;  1ONJ A;  1RGJ A;  1TXB A;  2H64 B;  5IMT D;  2H62 D;  1CRF A;  1RL5 A;  1HAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...