1CREA

Cardiotoxin ii from taiwan cobra venom, naja naja atra: structure in solution and comparision among homologous cardiotoxins
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN II
publication title Cardiotoxin II from Taiwan cobra venom, Naja naja atra. Structure in solution and comparison among homologous cardiotoxins.
pubmed rcsb
source organism Naja atra
total genus 4
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1creA00
1QKEA 1KFHA 1NORA 1CB9A 1IK8A 1CTXA 1RGJA 1TGXA 3LAQU 3HH7A 4OM5A 1KBSA 2JVEA 2GOOB 2LCRA 1MR6A 2N99A 3BT2U 1NTXA 1CRFA 4ZQYA 1M9ZA 1BXPA 1IJCA 1ERAA 2QJ9C 2H64B 2QJAC 1ES7B 1MAHF 3NEQA 2CRSA 1KBAA 2BHIA 2OFSA 2CTXA 5DU1A 1NXBA 2X8BB 1JBDA 4OM4A 1KC4A 4P7UA 1KU6B 2PJYC 1NYUA 4IYEA 1QM7A 2HLRA 5IMYC 1CREA 3EVSC 3VTSA 1NEAA 1LXGA 1S4YA 1V6PA 1W6BA 2K3GA 2CDXA 3U74U 3ERAA 4FAOC 2PJYB 3KFDE 1I02A 4HQPF 2MFAA 4BDTB 1LJZA 1CDSA 4FAOE 1CVOA 1H0JA 3BT1U 5DO6A 2CCXA 2CRTA 2L5SA 3EBXA 1ONJA 2HLQA 3NDSA 4BIKB 1HAJA 1JE9A 1IDHA 1FSCA 1QKDA 1IDLA 5IMTD 2MUPA 2H62D 1VB0A 4RUDA 5EBXA 2JQPA 1IQ9A 1LXHA 1CODA 1NTNA 2VLWA 1KXIA 1LX5B 1NYSA 1CXOA 1ERGA 1TXAA 4QTIU 1IDGA 1XT3A 1REWC 3FEVA 4AEAA 2BTXA 1F8UB 2MUOA 2NBTA 1TFSA 2L03A 1FRAA 1RL5A 1LSIA 3QB4B 1JGKA 1ABTA 2UX2A 2QC1A 4LFTA 2MJYA 2LA1A 2MJ4A 1DRSA 2H62C 1HOYA 1CXNA 5DZ5A 1TXBA 1B41B 2H7ZA 1YWHA 2MJ0A 1UG4A 1L4WA 2J8BA 2QJBC 4UY2C 3U73U 1IKCA 1CDQA 1BTEA 1IDIA 1HC9B 1KBTA 3NH7A 1FSSB 1FFJA 2ERAA 1FASA 2MHYA 2H5FA 2ABXA 2I9BE 1CHVS 1KS6A 3KFDI 4XJJA 1FF4A 2H7ZB 2UWRA 3PLCA 6EBXA 2GOOC 1G6MA 2FD6U 1HC9A 1F94A 1CDRA 1PLOA 1ZADA 1KL8A 4EY8B 4DO8A 1CCQA 1KTZB 1HAAA 2H8UA 1CDTA 2H64C 1COEA
chains in the Genus database with same CATH superfamily
1QKEA 1KFHA 1NORA 1CB9A 1IK8A 1CTXA 1RGJA 1TGXA 3LAQU 3HH7A 4OM5A 1KBSA 2JVEA 2GOOB 2LCRA 1MR6A 2N99A 3BT2U 1NTXA 1CRFA 4ZQYA 1M9ZA 1BXPA 1IJCA 1ERAA 2QJ9C 2H64B 2QJAC 1ES7B 1MAHF 3NEQA 2CRSA 1KBAA 2BHIA 2OFSA 2CTXA 5DU1A 1NXBA 2X8BB 1JBDA 4OM4A 1KC4A 4P7UA 1KU6B 2PJYC 1NYUA 4IYEA 1QM7A 2HLRA 5IMYC 1CREA 3EVSC 3VTSA 1NEAA 1LXGA 1S4YA 1V6PA 1W6BA 2K3GA 2CDXA 3U74U 3ERAA 4FAOC 2PJYB 3KFDE 1I02A 4HQPF 2MFAA 4BDTB 1LJZA 1CDSA 4FAOE 1CVOA 1H0JA 3BT1U 5DO6A 2CCXA 2CRTA 2L5SA 3EBXA 1ONJA 2HLQA 3NDSA 4BIKB 1HAJA 1JE9A 1IDHA 1FSCA 1QKDA 1IDLA 5IMTD 2MUPA 2H62D 1VB0A 4RUDA 5EBXA 4KSNA 2JQPA 1IQ9A 1LXHA 1CODA 1NTNA 2VLWA 1KXIA 1LX5B 1NYSA 1CXOA 1ERGA 1TXAA 4QTIU 1IDGA 1XT3A 1REWC 3FEVA 4AEAA 2BTXA 1F8UB 2MUOA 2NBTA 1TFSA 2L03A 1FRAA 1RL5A 1LSIA 3QB4B 1JGKA 1ABTA 2UX2A 2QC1A 4LFTA 2MJYA 2LA1A 2MJ4A 1DRSA 2H62C 1HOYA 1CXNA 5DZ5A 1TXBA 1B41B 2H7ZA 1YWHA 2MJ0A 1UG4A 1L4WA 2J8BA 2QJBC 4UY2C 3U73U 1IKCA 1CDQA 1BTEA 1IDIA 1HC9B 1KBTA 3NH7A 1FSSB 1FFJA 2ERAA 1FASA 2MHYA 2H5FA 2ABXA 2I9BE 1CHVS 1KS6A 3KFDI 4XJJA 1FF4A 2H7ZB 2UWRA 3PLCA 6EBXA 2GOOC 1G6MA 2FD6U 1HC9A 1F94A 1CDRA 1PLOA 1ZADA 1KL8A 4EY8B 4DO8A 1CCQA 1KTZB 1HAAA 2H8UA 1CDTA 2H64C 1COEA
chains in the Genus database with same CATH topology
1QKEA 1KFHA 1NORA 1CB9A 1IK8A 1CTXA 1RGJA 1TGXA 3LAQU 3HH7A 4OM5A 1KBSA 2JVEA 2GOOB 2LCRA 1MR6A 2N99A 3BT2U 1NTXA 1CRFA 4ZQYA 1M9ZA 1BXPA 1IJCA 1ERAA 2QJ9C 2H64B 2QJAC 1ES7B 1MAHF 3NEQA 2CRSA 1KBAA 2BHIA 2OFSA 2CTXA 5DU1A 1NXBA 2X8BB 1JBDA 4OM4A 1KC4A 4P7UA 1KU6B 2PJYC 1NYUA 4IYEA 1QM7A 2HLRA 5IMYC 1CREA 3EVSC 3VTSA 1NEAA 1LXGA 1S4YA 1V6PA 1W6BA 2K3GA 2CDXA 3U74U 3ERAA 4FAOC 2PJYB 3KFDE 1I02A 4HQPF 2MFAA 4BDTB 1LJZA 1CDSA 4FAOE 1CVOA 1H0JA 3BT1U 5DO6A 2CCXA 2CRTA 2L5SA 3EBXA 1ONJA 2HLQA 3NDSA 4BIKB 1HAJA 1JE9A 1IDHA 1FSCA 1QKDA 1IDLA 5IMTD 2MUPA 2H62D 1VB0A 4RUDA 5EBXA 4KSNA 2JQPA 1IQ9A 1LXHA 1CODA 1NTNA 2VLWA 1KXIA 1LX5B 1NYSA 1CXOA 1ERGA 1TXAA 4QTIU 1IDGA 1XT3A 1REWC 3FEVA 4AEAA 2BTXA 1F8UB 2MUOA 2NBTA 1TFSA 2L03A 1FRAA 1RL5A 1LSIA 3QB4B 1JGKA 1ABTA 2UX2A 2QC1A 4LFTA 2MJYA 2LA1A 2MJ4A 1DRSA 2H62C 1HOYA 1CXNA 5DZ5A 1TXBA 1B41B 2H7ZA 1YWHA 2MJ0A 1UG4A 1L4WA 2J8BA 2QJBC 4UY2C 3U73U 1IKCA 1CDQA 1BTEA 1IDIA 1HC9B 1KBTA 3NH7A 1FSSB 1FFJA 2ERAA 1FASA 2MHYA 2H5FA 2ABXA 2I9BE 1CHVS 1KS6A 3KFDI 4XJJA 1FF4A 2H7ZB 2UWRA 3PLCA 6EBXA 2GOOC 1G6MA 2FD6U 1HC9A 1F94A 1CDRA 1PLOA 1ZADA 1KL8A 4EY8B 4DO8A 1CCQA 1KTZB 1HAAA 2H8UA 1CDTA 2H64C 1COEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QKE A;  1KFH A;  1NOR A;  1CB9 A;  1IK8 A;  1CTX A;  1RGJ A;  1TGX A;  3LAQ U;  3HH7 A;  4OM5 A;  1KBS A;  2JVE A;  2GOO B;  2LCR A;  1MR6 A;  2N99 A;  3BT2 U;  1NTX A;  1CRF A;  4ZQY A;  1M9Z A;  1BXP A;  1IJC A;  1ERA A;  2QJ9 C;  2H64 B;  2QJA C;  1ES7 B;  1MAH F;  3NEQ A;  2CRS A;  1KBA A;  2BHI A;  2OFS A;  2CTX A;  5DU1 A;  1NXB A;  2X8B B;  1JBD A;  4OM4 A;  1KC4 A;  4P7U A;  1KU6 B;  2PJY C;  1NYU A;  4IYE A;  1QM7 A;  2HLR A;  5IMY C;  1CRE A;  3EVS C;  3VTS A;  1NEA A;  1LXG A;  1S4Y A;  1V6P A;  1W6B A;  2K3G A;  2CDX A;  3U74 U;  3ERA A;  4FAO C;  2PJY B;  3KFD E;  1I02 A;  4HQP F;  2MFA A;  4BDT B;  1LJZ A;  1CDS A;  4FAO E;  1CVO A;  1H0J A;  3BT1 U;  5DO6 A;  2CCX A;  2CRT A;  2L5S A;  3EBX A;  1ONJ A;  2HLQ A;  3NDS A;  4BIK B;  1HAJ A;  1JE9 A;  1IDH A;  1FSC A;  1QKD A;  1IDL A;  5IMT D;  2MUP A;  2H62 D;  1VB0 A;  4RUD A;  5EBX A;  2JQP A;  1IQ9 A;  1LXH A;  1COD A;  1NTN A;  2VLW A;  1KXI A;  1LX5 B;  1NYS A;  1CXO A;  1ERG A;  1TXA A;  4QTI U;  1IDG A;  1XT3 A;  1REW C;  3FEV A;  4AEA A;  2BTX A;  1F8U B;  2MUO A;  2NBT A;  1TFS A;  2L03 A;  1FRA A;  1RL5 A;  1LSI A;  3QB4 B;  1JGK A;  1ABT A;  2UX2 A;  2QC1 A;  4LFT A;  2MJY A;  2LA1 A;  2MJ4 A;  1DRS A;  2H62 C;  1HOY A;  1CXN A;  5DZ5 A;  1TXB A;  1B41 B;  2H7Z A;  1YWH A;  2MJ0 A;  1UG4 A;  1L4W A;  2J8B A;  2QJB C;  4UY2 C;  3U73 U;  1IKC A;  1CDQ A;  1BTE A;  1IDI A;  1HC9 B;  1KBT A;  3NH7 A;  1FSS B;  1FFJ A;  2ERA A;  1FAS A;  2MHY A;  2H5F A;  2ABX A;  2I9B E;  1CHV S;  1KS6 A;  3KFD I;  4XJJ A;  1FF4 A;  2H7Z B;  2UWR A;  3PLC A;  6EBX A;  2GOO C;  1G6M A;  2FD6 U;  1HC9 A;  1F94 A;  1CDR A;  1PLO A;  1ZAD A;  1KL8 A;  4EY8 B;  4DO8 A;  1CCQ A;  1KTZ B;  1HAA A;  2H8U A;  1CDT A;  2H64 C;  1COE A; 
#chains in the Genus database with same CATH topology
 1QKE A;  1KFH A;  1NOR A;  1CB9 A;  1IK8 A;  1CTX A;  1RGJ A;  1TGX A;  3LAQ U;  3HH7 A;  4OM5 A;  1KBS A;  2JVE A;  2GOO B;  2LCR A;  1MR6 A;  2N99 A;  3BT2 U;  1NTX A;  1CRF A;  4ZQY A;  1M9Z A;  1BXP A;  1IJC A;  1ERA A;  2QJ9 C;  2H64 B;  2QJA C;  1ES7 B;  1MAH F;  3NEQ A;  2CRS A;  1KBA A;  2BHI A;  2OFS A;  2CTX A;  5DU1 A;  1NXB A;  2X8B B;  1JBD A;  4OM4 A;  1KC4 A;  4P7U A;  1KU6 B;  2PJY C;  1NYU A;  4IYE A;  1QM7 A;  2HLR A;  5IMY C;  1CRE A;  3EVS C;  3VTS A;  1NEA A;  1LXG A;  1S4Y A;  1V6P A;  1W6B A;  2K3G A;  2CDX A;  3U74 U;  3ERA A;  4FAO C;  2PJY B;  3KFD E;  1I02 A;  4HQP F;  2MFA A;  4BDT B;  1LJZ A;  1CDS A;  4FAO E;  1CVO A;  1H0J A;  3BT1 U;  5DO6 A;  2CCX A;  2CRT A;  2L5S A;  3EBX A;  1ONJ A;  2HLQ A;  3NDS A;  4BIK B;  1HAJ A;  1JE9 A;  1IDH A;  1FSC A;  1QKD A;  1IDL A;  5IMT D;  2MUP A;  2H62 D;  1VB0 A;  4RUD A;  5EBX A;  4KSN A;  2JQP A;  1IQ9 A;  1LXH A;  1COD A;  1NTN A;  2VLW A;  1KXI A;  1LX5 B;  1NYS A;  1CXO A;  1ERG A;  1TXA A;  4QTI U;  1IDG A;  1XT3 A;  1REW C;  3FEV A;  4AEA A;  2BTX A;  1F8U B;  2MUO A;  2NBT A;  1TFS A;  2L03 A;  1FRA A;  1RL5 A;  1LSI A;  3QB4 B;  1JGK A;  1ABT A;  2UX2 A;  2QC1 A;  4LFT A;  2MJY A;  2LA1 A;  2MJ4 A;  1DRS A;  2H62 C;  1HOY A;  1CXN A;  5DZ5 A;  1TXB A;  1B41 B;  2H7Z A;  1YWH A;  2MJ0 A;  1UG4 A;  1L4W A;  2J8B A;  2QJB C;  4UY2 C;  3U73 U;  1IKC A;  1CDQ A;  1BTE A;  1IDI A;  1HC9 B;  1KBT A;  3NH7 A;  1FSS B;  1FFJ A;  2ERA A;  1FAS A;  2MHY A;  2H5F A;  2ABX A;  2I9B E;  1CHV S;  1KS6 A;  3KFD I;  4XJJ A;  1FF4 A;  2H7Z B;  2UWR A;  3PLC A;  6EBX A;  2GOO C;  1G6M A;  2FD6 U;  1HC9 A;  1F94 A;  1CDR A;  1PLO A;  1ZAD A;  1KL8 A;  4EY8 B;  4DO8 A;  1CCQ A;  1KTZ B;  1HAA A;  2H8U A;  1CDT A;  2H64 C;  1COE A; 
#chains in the Genus database with same CATH homology
 1QKE A;  1KFH A;  1NOR A;  1CB9 A;  1IK8 A;  1CTX A;  1RGJ A;  1TGX A;  3LAQ U;  3HH7 A;  4OM5 A;  1KBS A;  2JVE A;  2GOO B;  2LCR A;  1MR6 A;  2N99 A;  3BT2 U;  1NTX A;  1CRF A;  4ZQY A;  1M9Z A;  1BXP A;  1IJC A;  1ERA A;  2QJ9 C;  2H64 B;  2QJA C;  1ES7 B;  1MAH F;  3NEQ A;  2CRS A;  1KBA A;  2BHI A;  2OFS A;  2CTX A;  5DU1 A;  1NXB A;  2X8B B;  1JBD A;  4OM4 A;  1KC4 A;  4P7U A;  1KU6 B;  2PJY C;  1NYU A;  4IYE A;  1QM7 A;  2HLR A;  5IMY C;  1CRE A;  3EVS C;  3VTS A;  1NEA A;  1LXG A;  1S4Y A;  1V6P A;  1W6B A;  2K3G A;  2CDX A;  3U74 U;  3ERA A;  4FAO C;  2PJY B;  3KFD E;  1I02 A;  4HQP F;  2MFA A;  4BDT B;  1LJZ A;  1CDS A;  4FAO E;  1CVO A;  1H0J A;  3BT1 U;  5DO6 A;  2CCX A;  2CRT A;  2L5S A;  3EBX A;  1ONJ A;  2HLQ A;  3NDS A;  4BIK B;  1HAJ A;  1JE9 A;  1IDH A;  1FSC A;  1QKD A;  1IDL A;  5IMT D;  2MUP A;  2H62 D;  1VB0 A;  4RUD A;  5EBX A;  4KSN A;  2JQP A;  1IQ9 A;  1LXH A;  1COD A;  1NTN A;  2VLW A;  1KXI A;  1LX5 B;  1NYS A;  1CXO A;  1ERG A;  1TXA A;  4QTI U;  1IDG A;  1XT3 A;  1REW C;  3FEV A;  4AEA A;  2BTX A;  1F8U B;  2MUO A;  2NBT A;  1TFS A;  2L03 A;  1FRA A;  1RL5 A;  1LSI A;  3QB4 B;  1JGK A;  1ABT A;  2UX2 A;  2QC1 A;  4LFT A;  2MJY A;  2LA1 A;  2MJ4 A;  1DRS A;  2H62 C;  1HOY A;  1CXN A;  5DZ5 A;  1TXB A;  1B41 B;  2H7Z A;  1YWH A;  2MJ0 A;  1UG4 A;  1L4W A;  2J8B A;  2QJB C;  4UY2 C;  3U73 U;  1IKC A;  1CDQ A;  1BTE A;  1IDI A;  1HC9 B;  1KBT A;  3NH7 A;  1FSS B;  1FFJ A;  2ERA A;  1FAS A;  2MHY A;  2H5F A;  2ABX A;  2I9B E;  1CHV S;  1KS6 A;  3KFD I;  4XJJ A;  1FF4 A;  2H7Z B;  2UWR A;  3PLC A;  6EBX A;  2GOO C;  1G6M A;  2FD6 U;  1HC9 A;  1F94 A;  1CDR A;  1PLO A;  1ZAD A;  1KL8 A;  4EY8 B;  4DO8 A;  1CCQ A;  1KTZ B;  1HAA A;  2H8U A;  1CDT A;  2H64 C;  1COE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...