2JQPA

Nmr structure determination of bungatoxin from bungarus candidus (malayan krait)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
b'LTCLICPEKDCQKVHTCRNEEKICVKRFYDKNQLGWRAQRGCAVSCPKAKPNETVQCCSTDKCNK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Weak toxin 1
publication title NMR solution Structure of Bungatoxin from Bungarus Candidus (Malayan Krait)venom
rcsb
molecule tags Toxin
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2jqpA00
1ONJA 1CRFA 1CODA 2H8UA 1LXHA 2I9BE 2NBTA 1JGKA 1CXOA 1W6BA 1HOYA 1F94A 3QB4B 3HH7A 1KS6A 1TXBA 3BT2U 1MR6A 2QC1A 2CDXA 1NYSA 2K3GA 2VLWA 2H64B 1COEA 1JBDA 1HC9B 2JQPA 1BXPA 2ERAA 2PJYC 2MFAA 4HQPF 2L5SA 4IYEA 1IQ9A 1RGJA 2MUOA 2CRSA 2LA1A 1L4WA 4RUDA 1TFSA 2QJ9C 1DRSA 1HC9A 2MJ0A 1IDIA 4DO8A 2X8BB 4UY2C 2H5FA 1B41B 1BTEA 1KTZB 4ZQYA 2OFSA 1PLOA 1NEAA 2PJYB 2MUPA 1S4YA 3NEQA 1NYUA 1HAAA 6EBXA 1FF4A 1FSCA 1LJZA 2LCRA 3KFDI 4OM5A 4BDTB 1CREA 2QJBC 1KU6B 2H62D 1FRAA 2H7ZA 4XJJA 2BHIA 1F8UB 2MHYA 1KFHA 2CRTA 5DO6A 1YWHA 4BIKB 2BTXA 4EY8B 1CDSA 1QKDA 1ES7B 1CTXA 3NDSA 1CDTA 1CHVS 1CDRA 1MAHF 3FEVA 1IDGA 2H7ZB 1HAJA 3NH7A 4QTIU 1IDHA 1FASA 2L03A 5EBXA 1TXAA 1KXIA 5IMYC 3ERAA 1XT3A 1CB9A 1I02A 2CTXA 4OM4A 1FSSB 2CCXA 3PLCA 1QKEA 2QJAC 1TGXA 2UX2A 2JVEA 5DZ5A 1CDQA 2MJYA 5IMTD 1ERAA 2HLRA 3U74U 2FD6U 3EBXA 3KFDE 1ABTA 1ERGA 2HLQA 3LAQU 1V6PA 2UWRA 2J8BA 1RL5A 1IDLA 1M9ZA 2ABXA 2H62C 1G6MA 1REWC 1FFJA 2N99A 3EVSC 1KBAA 1IJCA 1KC4A 1KBTA 1QM7A 1KBSA 1UG4A 4FAOE 1IKCA 1JE9A 1NTNA 5DU1A 3U73U 1IK8A 1CXNA 2GOOC 3VTSA 1LSIA 2MJ4A 1NORA 4P7UA 1KL8A 1LXGA 4AEAA 1CCQA 3BT1U 1NTXA 1VB0A 4LFTA 1CVOA 4FAOC 1LX5B 1NXBA 1ZADA 2GOOB 2H64C 1H0JA
chains in the Genus database with same CATH superfamily
1ONJA 1CRFA 1CODA 2H8UA 1LXHA 2I9BE 2NBTA 1JGKA 1CXOA 1W6BA 1HOYA 1F94A 3QB4B 3HH7A 1KS6A 1TXBA 3BT2U 1MR6A 2QC1A 2CDXA 1NYSA 2K3GA 2VLWA 2H64B 1COEA 1JBDA 1HC9B 2JQPA 1BXPA 2ERAA 2PJYC 2MFAA 4HQPF 2L5SA 4IYEA 1IQ9A 1RGJA 2MUOA 2CRSA 2LA1A 1L4WA 4RUDA 1TFSA 2QJ9C 1DRSA 1HC9A 2MJ0A 1IDIA 4DO8A 2X8BB 4UY2C 2H5FA 1B41B 1BTEA 1KTZB 4ZQYA 2OFSA 1PLOA 1NEAA 2PJYB 2MUPA 1S4YA 3NEQA 1NYUA 1HAAA 6EBXA 1FF4A 1FSCA 1LJZA 2LCRA 3KFDI 4OM5A 4BDTB 1CREA 2QJBC 1KU6B 2H62D 1FRAA 2H7ZA 4XJJA 2BHIA 1F8UB 2MHYA 1KFHA 2CRTA 5DO6A 1YWHA 4BIKB 2BTXA 4EY8B 1CDSA 1QKDA 1ES7B 1CTXA 3NDSA 1CDTA 1CHVS 1CDRA 1MAHF 3FEVA 1IDGA 2H7ZB 1HAJA 3NH7A 4QTIU 1IDHA 1FASA 2L03A 5EBXA 1TXAA 1KXIA 5IMYC 3ERAA 1XT3A 1CB9A 1I02A 2CTXA 4OM4A 1FSSB 2CCXA 3PLCA 1QKEA 2QJAC 1TGXA 2UX2A 2JVEA 5DZ5A 1CDQA 2MJYA 5IMTD 1ERAA 2HLRA 3U74U 2FD6U 3EBXA 3KFDE 1ABTA 1ERGA 2HLQA 3LAQU 1V6PA 2UWRA 2J8BA 1RL5A 1IDLA 1M9ZA 2ABXA 2H62C 1G6MA 1REWC 1FFJA 2N99A 3EVSC 1KBAA 4KSNA 1IJCA 1KC4A 1QM7A 1KBSA 1UG4A 4FAOE 1IKCA 1JE9A 1NTNA 5DU1A 3U73U 1IK8A 1CXNA 2GOOC 3VTSA 1LSIA 2MJ4A 1NORA 4P7UA 1KL8A 1LXGA 4AEAA 1CCQA 3BT1U 1NTXA 1VB0A 4LFTA 1CVOA 4FAOC 1LX5B 1NXBA 1KBTA 1ZADA 2GOOB 2H64C 1H0JA
chains in the Genus database with same CATH topology
1ONJA 1CRFA 1CODA 2H8UA 1LXHA 2I9BE 2NBTA 1JGKA 1CXOA 1W6BA 1HOYA 1F94A 3QB4B 3HH7A 1KS6A 1TXBA 3BT2U 1MR6A 2QC1A 2CDXA 1NYSA 2K3GA 2VLWA 2H64B 1COEA 1JBDA 1HC9B 2JQPA 1BXPA 2ERAA 2PJYC 2MFAA 4HQPF 2L5SA 4IYEA 1IQ9A 1RGJA 2MUOA 2CRSA 2LA1A 1L4WA 4RUDA 1TFSA 2QJ9C 1DRSA 1HC9A 2MJ0A 1IDIA 4DO8A 2X8BB 4UY2C 2H5FA 1B41B 1BTEA 1KTZB 4ZQYA 2OFSA 1PLOA 1NEAA 2PJYB 2MUPA 1S4YA 3NEQA 1NYUA 1HAAA 6EBXA 1FF4A 1FSCA 1LJZA 2LCRA 3KFDI 4OM5A 4BDTB 1CREA 2QJBC 1KU6B 2H62D 1FRAA 2H7ZA 4XJJA 2BHIA 1F8UB 2MHYA 1KFHA 2CRTA 5DO6A 1YWHA 4BIKB 2BTXA 4EY8B 1CDSA 1QKDA 1ES7B 1CTXA 3NDSA 1CDTA 1CHVS 1CDRA 1MAHF 3FEVA 1IDGA 2H7ZB 1HAJA 3NH7A 4QTIU 1IDHA 1FASA 2L03A 5EBXA 1TXAA 1KXIA 5IMYC 3ERAA 1XT3A 1CB9A 1I02A 2CTXA 4OM4A 1FSSB 2CCXA 3PLCA 1QKEA 2QJAC 1TGXA 2UX2A 2JVEA 5DZ5A 1CDQA 2MJYA 5IMTD 1ERAA 2HLRA 3U74U 2FD6U 3EBXA 3KFDE 1ABTA 1ERGA 2HLQA 3LAQU 1V6PA 2UWRA 2J8BA 1RL5A 1IDLA 1M9ZA 2ABXA 2H62C 1G6MA 1REWC 1FFJA 2N99A 3EVSC 1KBAA 4KSNA 1IJCA 1KC4A 1QM7A 1KBSA 1UG4A 4FAOE 1IKCA 1JE9A 1NTNA 5DU1A 3U73U 1IK8A 1CXNA 2GOOC 3VTSA 1LSIA 2MJ4A 1NORA 4P7UA 1KL8A 1LXGA 4AEAA 1CCQA 3BT1U 1NTXA 1VB0A 4LFTA 1CVOA 4FAOC 1LX5B 1NXBA 1KBTA 1ZADA 2GOOB 2H64C 1H0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONJ A;  1CRF A;  1COD A;  2H8U A;  1LXH A;  2I9B E;  2NBT A;  1JGK A;  1CXO A;  1W6B A;  1HOY A;  1F94 A;  3QB4 B;  3HH7 A;  1KS6 A;  1TXB A;  3BT2 U;  1MR6 A;  2QC1 A;  2CDX A;  1NYS A;  2K3G A;  2VLW A;  2H64 B;  1COE A;  1JBD A;  1HC9 B;  2JQP A;  1BXP A;  2ERA A;  2PJY C;  2MFA A;  4HQP F;  2L5S A;  4IYE A;  1IQ9 A;  1RGJ A;  2MUO A;  2CRS A;  2LA1 A;  1L4W A;  4RUD A;  1TFS A;  2QJ9 C;  1DRS A;  1HC9 A;  2MJ0 A;  1IDI A;  4DO8 A;  2X8B B;  4UY2 C;  2H5F A;  1B41 B;  1BTE A;  1KTZ B;  4ZQY A;  2OFS A;  1PLO A;  1NEA A;  2PJY B;  2MUP A;  1S4Y A;  3NEQ A;  1NYU A;  1HAA A;  6EBX A;  1FF4 A;  1FSC A;  1LJZ A;  2LCR A;  3KFD I;  4OM5 A;  4BDT B;  1CRE A;  2QJB C;  1KU6 B;  2H62 D;  1FRA A;  2H7Z A;  4XJJ A;  2BHI A;  1F8U B;  2MHY A;  1KFH A;  2CRT A;  5DO6 A;  1YWH A;  4BIK B;  2BTX A;  4EY8 B;  1CDS A;  1QKD A;  1ES7 B;  1CTX A;  3NDS A;  1CDT A;  1CHV S;  1CDR A;  1MAH F;  3FEV A;  1IDG A;  2H7Z B;  1HAJ A;  3NH7 A;  4QTI U;  1IDH A;  1FAS A;  2L03 A;  5EBX A;  1TXA A;  1KXI A;  5IMY C;  3ERA A;  1XT3 A;  1CB9 A;  1I02 A;  2CTX A;  4OM4 A;  1FSS B;  2CCX A;  3PLC A;  1QKE A;  2QJA C;  1TGX A;  2UX2 A;  2JVE A;  5DZ5 A;  1CDQ A;  2MJY A;  5IMT D;  1ERA A;  2HLR A;  3U74 U;  2FD6 U;  3EBX A;  3KFD E;  1ABT A;  1ERG A;  2HLQ A;  3LAQ U;  1V6P A;  2UWR A;  2J8B A;  1RL5 A;  1IDL A;  1M9Z A;  2ABX A;  2H62 C;  1G6M A;  1REW C;  1FFJ A;  2N99 A;  3EVS C;  1KBA A;  1IJC A;  1KC4 A;  1KBT A;  1QM7 A;  1KBS A;  1UG4 A;  4FAO E;  1IKC A;  1JE9 A;  1NTN A;  5DU1 A;  3U73 U;  1IK8 A;  1CXN A;  2GOO C;  3VTS A;  1LSI A;  2MJ4 A;  1NOR A;  4P7U A;  1KL8 A;  1LXG A;  4AEA A;  1CCQ A;  3BT1 U;  1NTX A;  1VB0 A;  4LFT A;  1CVO A;  4FAO C;  1LX5 B;  1NXB A;  1ZAD A;  2GOO B;  2H64 C;  1H0J A; 
#chains in the Genus database with same CATH topology
 1ONJ A;  1CRF A;  1COD A;  2H8U A;  1LXH A;  2I9B E;  2NBT A;  1JGK A;  1CXO A;  1W6B A;  1HOY A;  1F94 A;  3QB4 B;  3HH7 A;  1KS6 A;  1TXB A;  3BT2 U;  1MR6 A;  2QC1 A;  2CDX A;  1NYS A;  2K3G A;  2VLW A;  2H64 B;  1COE A;  1JBD A;  1HC9 B;  2JQP A;  1BXP A;  2ERA A;  2PJY C;  2MFA A;  4HQP F;  2L5S A;  4IYE A;  1IQ9 A;  1RGJ A;  2MUO A;  2CRS A;  2LA1 A;  1L4W A;  4RUD A;  1TFS A;  2QJ9 C;  1DRS A;  1HC9 A;  2MJ0 A;  1IDI A;  4DO8 A;  2X8B B;  4UY2 C;  2H5F A;  1B41 B;  1BTE A;  1KTZ B;  4ZQY A;  2OFS A;  1PLO A;  1NEA A;  2PJY B;  2MUP A;  1S4Y A;  3NEQ A;  1NYU A;  1HAA A;  6EBX A;  1FF4 A;  1FSC A;  1LJZ A;  2LCR A;  3KFD I;  4OM5 A;  4BDT B;  1CRE A;  2QJB C;  1KU6 B;  2H62 D;  1FRA A;  2H7Z A;  4XJJ A;  2BHI A;  1F8U B;  2MHY A;  1KFH A;  2CRT A;  5DO6 A;  1YWH A;  4BIK B;  2BTX A;  4EY8 B;  1CDS A;  1QKD A;  1ES7 B;  1CTX A;  3NDS A;  1CDT A;  1CHV S;  1CDR A;  1MAH F;  3FEV A;  1IDG A;  2H7Z B;  1HAJ A;  3NH7 A;  4QTI U;  1IDH A;  1FAS A;  2L03 A;  5EBX A;  1TXA A;  1KXI A;  5IMY C;  3ERA A;  1XT3 A;  1CB9 A;  1I02 A;  2CTX A;  4OM4 A;  1FSS B;  2CCX A;  3PLC A;  1QKE A;  2QJA C;  1TGX A;  2UX2 A;  2JVE A;  5DZ5 A;  1CDQ A;  2MJY A;  5IMT D;  1ERA A;  2HLR A;  3U74 U;  2FD6 U;  3EBX A;  3KFD E;  1ABT A;  1ERG A;  2HLQ A;  3LAQ U;  1V6P A;  2UWR A;  2J8B A;  1RL5 A;  1IDL A;  1M9Z A;  2ABX A;  2H62 C;  1G6M A;  1REW C;  1FFJ A;  2N99 A;  3EVS C;  1KBA A;  4KSN A;  1IJC A;  1KC4 A;  1QM7 A;  1KBS A;  1UG4 A;  4FAO E;  1IKC A;  1JE9 A;  1NTN A;  5DU1 A;  3U73 U;  1IK8 A;  1CXN A;  2GOO C;  3VTS A;  1LSI A;  2MJ4 A;  1NOR A;  4P7U A;  1KL8 A;  1LXG A;  4AEA A;  1CCQ A;  3BT1 U;  1NTX A;  1VB0 A;  4LFT A;  1CVO A;  4FAO C;  1LX5 B;  1NXB A;  1KBT A;  1ZAD A;  2GOO B;  2H64 C;  1H0J A; 
#chains in the Genus database with same CATH homology
 1ONJ A;  1CRF A;  1COD A;  2H8U A;  1LXH A;  2I9B E;  2NBT A;  1JGK A;  1CXO A;  1W6B A;  1HOY A;  1F94 A;  3QB4 B;  3HH7 A;  1KS6 A;  1TXB A;  3BT2 U;  1MR6 A;  2QC1 A;  2CDX A;  1NYS A;  2K3G A;  2VLW A;  2H64 B;  1COE A;  1JBD A;  1HC9 B;  2JQP A;  1BXP A;  2ERA A;  2PJY C;  2MFA A;  4HQP F;  2L5S A;  4IYE A;  1IQ9 A;  1RGJ A;  2MUO A;  2CRS A;  2LA1 A;  1L4W A;  4RUD A;  1TFS A;  2QJ9 C;  1DRS A;  1HC9 A;  2MJ0 A;  1IDI A;  4DO8 A;  2X8B B;  4UY2 C;  2H5F A;  1B41 B;  1BTE A;  1KTZ B;  4ZQY A;  2OFS A;  1PLO A;  1NEA A;  2PJY B;  2MUP A;  1S4Y A;  3NEQ A;  1NYU A;  1HAA A;  6EBX A;  1FF4 A;  1FSC A;  1LJZ A;  2LCR A;  3KFD I;  4OM5 A;  4BDT B;  1CRE A;  2QJB C;  1KU6 B;  2H62 D;  1FRA A;  2H7Z A;  4XJJ A;  2BHI A;  1F8U B;  2MHY A;  1KFH A;  2CRT A;  5DO6 A;  1YWH A;  4BIK B;  2BTX A;  4EY8 B;  1CDS A;  1QKD A;  1ES7 B;  1CTX A;  3NDS A;  1CDT A;  1CHV S;  1CDR A;  1MAH F;  3FEV A;  1IDG A;  2H7Z B;  1HAJ A;  3NH7 A;  4QTI U;  1IDH A;  1FAS A;  2L03 A;  5EBX A;  1TXA A;  1KXI A;  5IMY C;  3ERA A;  1XT3 A;  1CB9 A;  1I02 A;  2CTX A;  4OM4 A;  1FSS B;  2CCX A;  3PLC A;  1QKE A;  2QJA C;  1TGX A;  2UX2 A;  2JVE A;  5DZ5 A;  1CDQ A;  2MJY A;  5IMT D;  1ERA A;  2HLR A;  3U74 U;  2FD6 U;  3EBX A;  3KFD E;  1ABT A;  1ERG A;  2HLQ A;  3LAQ U;  1V6P A;  2UWR A;  2J8B A;  1RL5 A;  1IDL A;  1M9Z A;  2ABX A;  2H62 C;  1G6M A;  1REW C;  1FFJ A;  2N99 A;  3EVS C;  1KBA A;  4KSN A;  1IJC A;  1KC4 A;  1QM7 A;  1KBS A;  1UG4 A;  4FAO E;  1IKC A;  1JE9 A;  1NTN A;  5DU1 A;  3U73 U;  1IK8 A;  1CXN A;  2GOO C;  3VTS A;  1LSI A;  2MJ4 A;  1NOR A;  4P7U A;  1KL8 A;  1LXG A;  4AEA A;  1CCQ A;  3BT1 U;  1NTX A;  1VB0 A;  4LFT A;  1CVO A;  4FAO C;  1LX5 B;  1NXB A;  1KBT A;  1ZAD A;  2GOO B;  2H64 C;  1H0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...