2JQPA

Nmr structure determination of bungatoxin from bungarus candidus (malayan krait)
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
65
structure length
65
Chain Sequence
LTCLICPEKDCQKVHTCRNEEKICVKRFYDKNQLGWRAQRGCAVSCPKAKPNETVQCCSTDKCNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Weak toxin 1
publication title NMR solution Structure of Bungatoxin from Bungarus Candidus (Malayan Krait)venom
rcsb
molecule tags Toxin
total genus 5
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2007-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2jqpA00
2H62D 2PJYC 3BT2U 1V6PA 1ABTA 1IKCA 1CREA 2H62C 2OFSA 2JQPA 1ERAA 2LA1A 2MHYA 1KBTA 4FAOE 3VTSA 2UWRA 3QB4B 4BDTB 1NYSA 4IYEA 1TXAA 1CDRA 1IQ9A 1W6BA 2H7ZA 1NTXA 1H0JA 1KC4A 4QTIU 4RUDA 2MFAA 1KBAA 1NEAA 1BTEA 4OM5A 1RL5A 1CDSA 1CODA 1QM7A 1HAAA 2X8BB 4DO8A 1RGJA 2H64C 2CRTA 4UY2C 1L4WA 1FFJA 2H8UA 3U74U 3LAQU 3EVSC 1MAHF 2L03A 1HC9B 1IDGA 2GOOB 1NXBA 4OM4A 1S4YA 1IJCA 1IK8A 1VB0A 2MJYA 1M9ZA 2QJ9C 2CTXA 2NBTA 2J8BA 3HH7A 2I9BE 2H5FA 6EBXA 4EY8B 1CHVS 2PJYB 2JVEA 1KL8A 3KFDI 1ES7B 2MUPA 1HC9A 1KXIA 2VLWA 1KBSA 2UX2A 1ZADA 1G6MA 3NEQA 1LSIA 2K3GA 1F94A 4XJJA 4AEAA 4FAOC 2ABXA 2BTXA 1CVOA 1PLOA 4HQPF 1CDQA 1IDLA 1CTXA 1NORA 1F8UB 2CCXA 3FEVA 1NTNA 1JE9A 5EBXA 1FF4A 1CCQA 1KFHA 1KS6A 1FSSB 2HLRA 1CXNA 1LXHA 1LJZA 2MUOA 2FD6U 2BHIA 2H64B 3PLCA 2H7ZB 2L5SA 3KFDE 3NDSA 2CDXA 1ONJA 4P7UA 1CB9A 1QKEA 2LCRA 5DZ5A 1COEA 3ERAA 5IMYC 1IDHA 2QC1A 1XT3A 2QJAC 3BT1U 2MJ4A 1QKDA 1FASA 1IDIA 1KU6B 4ZQYA 5IMTD 2N99A 1MR6A 1YWHA 1LXGA 4LFTA 1HOYA 2MJ0A 1KTZB 2GOOC 1LX5B 1ERGA 3U73U 3NH7A 1TGXA 1B41B 1CXOA 1DRSA 2HLQA 5DO6A 1NYUA 1TXBA 3EBXA 5DU1A 1HAJA 2CRSA 1FSCA 1REWC 2QJBC 1BXPA 1CRFA 1UG4A 2ERAA 1JBDA 4BIKB 1JGKA 1FRAA 1I02A 1CDTA 1TFSA
chains in the Genus database with same CATH superfamily
2H62D 2PJYC 3BT2U 1V6PA 1ABTA 1IKCA 1CREA 2H62C 2OFSA 2JQPA 1ERAA 2LA1A 2MHYA 1KBTA 4FAOE 3VTSA 2UWRA 3QB4B 4BDTB 1NYSA 4IYEA 1TXAA 1CDRA 1IQ9A 1W6BA 2H7ZA 1NTXA 1H0JA 1KC4A 4QTIU 4RUDA 2MFAA 1KBAA 1NEAA 1BTEA 4OM5A 1RL5A 1CDSA 1CODA 1QM7A 1HAAA 2X8BB 4DO8A 1RGJA 2H64C 2CRTA 4UY2C 1L4WA 1FFJA 2H8UA 3U74U 3LAQU 3EVSC 4KSNA 1MAHF 2L03A 1HC9B 1IDGA 2GOOB 1NXBA 4OM4A 1S4YA 1IJCA 1IK8A 1VB0A 2MJYA 1M9ZA 2QJ9C 2CTXA 2NBTA 2J8BA 3HH7A 2I9BE 2H5FA 6EBXA 4EY8B 1CHVS 2PJYB 2JVEA 1KL8A 3KFDI 1ES7B 2MUPA 1HC9A 1KXIA 2VLWA 1KBSA 2UX2A 1ZADA 1G6MA 3NEQA 1LSIA 2K3GA 1F94A 4XJJA 4AEAA 4FAOC 2ABXA 2BTXA 1CVOA 1PLOA 4HQPF 1CDQA 1IDLA 1CTXA 1NORA 1F8UB 2CCXA 3FEVA 1NTNA 1JE9A 5EBXA 1FF4A 1CCQA 1KFHA 1KS6A 1FSSB 2HLRA 1CXNA 1LXHA 1LJZA 2MUOA 2FD6U 2BHIA 2H64B 3PLCA 2H7ZB 2L5SA 3KFDE 3NDSA 2CDXA 1ONJA 4P7UA 1CB9A 1QKEA 2LCRA 5DZ5A 1COEA 3ERAA 5IMYC 1IDHA 2QC1A 1XT3A 2QJAC 3BT1U 2MJ4A 1QKDA 1FASA 1IDIA 1KU6B 4ZQYA 5IMTD 2N99A 1MR6A 1YWHA 1LXGA 4LFTA 1HOYA 2MJ0A 1KTZB 2GOOC 1LX5B 1ERGA 3U73U 3NH7A 1TGXA 1B41B 1CXOA 1DRSA 2HLQA 5DO6A 1NYUA 1TXBA 3EBXA 5DU1A 1HAJA 2CRSA 1FSCA 1REWC 2QJBC 1BXPA 1CRFA 1UG4A 2ERAA 1JBDA 4BIKB 1JGKA 1FRAA 1I02A 1CDTA 1TFSA
chains in the Genus database with same CATH topology
2H62D 2PJYC 3BT2U 1V6PA 1ABTA 1IKCA 1CREA 2H62C 2OFSA 2JQPA 1ERAA 2LA1A 2MHYA 1KBTA 4FAOE 3VTSA 2UWRA 3QB4B 4BDTB 1NYSA 4IYEA 1TXAA 1CDRA 1IQ9A 1W6BA 2H7ZA 1NTXA 1H0JA 1KC4A 4QTIU 4RUDA 2MFAA 1KBAA 1NEAA 1BTEA 4OM5A 1RL5A 1CDSA 1CODA 1QM7A 1HAAA 2X8BB 4DO8A 1RGJA 2H64C 2CRTA 4UY2C 1L4WA 1FFJA 2H8UA 3U74U 3LAQU 3EVSC 4KSNA 1MAHF 2L03A 1HC9B 1IDGA 2GOOB 1NXBA 4OM4A 1S4YA 1IJCA 1IK8A 1VB0A 2MJYA 1M9ZA 2QJ9C 2CTXA 2NBTA 2J8BA 3HH7A 2I9BE 2H5FA 6EBXA 4EY8B 1CHVS 2PJYB 2JVEA 1KL8A 3KFDI 1ES7B 2MUPA 1HC9A 1KXIA 2VLWA 1KBSA 2UX2A 1ZADA 1G6MA 3NEQA 1LSIA 2K3GA 1F94A 4XJJA 4AEAA 4FAOC 2ABXA 2BTXA 1CVOA 1PLOA 4HQPF 1CDQA 1IDLA 1CTXA 1NORA 1F8UB 2CCXA 3FEVA 1NTNA 1JE9A 5EBXA 1FF4A 1CCQA 1KFHA 1KS6A 1FSSB 2HLRA 1CXNA 1LXHA 1LJZA 2MUOA 2FD6U 2BHIA 2H64B 3PLCA 2H7ZB 2L5SA 3KFDE 3NDSA 2CDXA 1ONJA 4P7UA 1CB9A 1QKEA 2LCRA 5DZ5A 1COEA 3ERAA 5IMYC 1IDHA 2QC1A 1XT3A 2QJAC 3BT1U 2MJ4A 1QKDA 1FASA 1IDIA 1KU6B 4ZQYA 5IMTD 2N99A 1MR6A 1YWHA 1LXGA 4LFTA 1HOYA 2MJ0A 1KTZB 2GOOC 1LX5B 1ERGA 3U73U 3NH7A 1TGXA 1B41B 1CXOA 1DRSA 2HLQA 5DO6A 1NYUA 1TXBA 3EBXA 5DU1A 1HAJA 2CRSA 1FSCA 1REWC 2QJBC 1BXPA 1CRFA 1UG4A 2ERAA 1JBDA 4BIKB 1JGKA 1FRAA 1I02A 1CDTA 1TFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H62 D;  2PJY C;  3BT2 U;  1V6P A;  1ABT A;  1IKC A;  1CRE A;  2H62 C;  2OFS A;  2JQP A;  1ERA A;  2LA1 A;  2MHY A;  1KBT A;  4FAO E;  3VTS A;  2UWR A;  3QB4 B;  4BDT B;  1NYS A;  4IYE A;  1TXA A;  1CDR A;  1IQ9 A;  1W6B A;  2H7Z A;  1NTX A;  1H0J A;  1KC4 A;  4QTI U;  4RUD A;  2MFA A;  1KBA A;  1NEA A;  1BTE A;  4OM5 A;  1RL5 A;  1CDS A;  1COD A;  1QM7 A;  1HAA A;  2X8B B;  4DO8 A;  1RGJ A;  2H64 C;  2CRT A;  4UY2 C;  1L4W A;  1FFJ A;  2H8U A;  3U74 U;  3LAQ U;  3EVS C;  1MAH F;  2L03 A;  1HC9 B;  1IDG A;  2GOO B;  1NXB A;  4OM4 A;  1S4Y A;  1IJC A;  1IK8 A;  1VB0 A;  2MJY A;  1M9Z A;  2QJ9 C;  2CTX A;  2NBT A;  2J8B A;  3HH7 A;  2I9B E;  2H5F A;  6EBX A;  4EY8 B;  1CHV S;  2PJY B;  2JVE A;  1KL8 A;  3KFD I;  1ES7 B;  2MUP A;  1HC9 A;  1KXI A;  2VLW A;  1KBS A;  2UX2 A;  1ZAD A;  1G6M A;  3NEQ A;  1LSI A;  2K3G A;  1F94 A;  4XJJ A;  4AEA A;  4FAO C;  2ABX A;  2BTX A;  1CVO A;  1PLO A;  4HQP F;  1CDQ A;  1IDL A;  1CTX A;  1NOR A;  1F8U B;  2CCX A;  3FEV A;  1NTN A;  1JE9 A;  5EBX A;  1FF4 A;  1CCQ A;  1KFH A;  1KS6 A;  1FSS B;  2HLR A;  1CXN A;  1LXH A;  1LJZ A;  2MUO A;  2FD6 U;  2BHI A;  2H64 B;  3PLC A;  2H7Z B;  2L5S A;  3KFD E;  3NDS A;  2CDX A;  1ONJ A;  4P7U A;  1CB9 A;  1QKE A;  2LCR A;  5DZ5 A;  1COE A;  3ERA A;  5IMY C;  1IDH A;  2QC1 A;  1XT3 A;  2QJA C;  3BT1 U;  2MJ4 A;  1QKD A;  1FAS A;  1IDI A;  1KU6 B;  4ZQY A;  5IMT D;  2N99 A;  1MR6 A;  1YWH A;  1LXG A;  4LFT A;  1HOY A;  2MJ0 A;  1KTZ B;  2GOO C;  1LX5 B;  1ERG A;  3U73 U;  3NH7 A;  1TGX A;  1B41 B;  1CXO A;  1DRS A;  2HLQ A;  5DO6 A;  1NYU A;  1TXB A;  3EBX A;  5DU1 A;  1HAJ A;  2CRS A;  1FSC A;  1REW C;  2QJB C;  1BXP A;  1CRF A;  1UG4 A;  2ERA A;  1JBD A;  4BIK B;  1JGK A;  1FRA A;  1I02 A;  1CDT A;  1TFS A; 
#chains in the Genus database with same CATH topology
 2H62 D;  2PJY C;  3BT2 U;  1V6P A;  1ABT A;  1IKC A;  1CRE A;  2H62 C;  2OFS A;  2JQP A;  1ERA A;  2LA1 A;  2MHY A;  1KBT A;  4FAO E;  3VTS A;  2UWR A;  3QB4 B;  4BDT B;  1NYS A;  4IYE A;  1TXA A;  1CDR A;  1IQ9 A;  1W6B A;  2H7Z A;  1NTX A;  1H0J A;  1KC4 A;  4QTI U;  4RUD A;  2MFA A;  1KBA A;  1NEA A;  1BTE A;  4OM5 A;  1RL5 A;  1CDS A;  1COD A;  1QM7 A;  1HAA A;  2X8B B;  4DO8 A;  1RGJ A;  2H64 C;  2CRT A;  4UY2 C;  1L4W A;  1FFJ A;  2H8U A;  3U74 U;  3LAQ U;  3EVS C;  4KSN A;  1MAH F;  2L03 A;  1HC9 B;  1IDG A;  2GOO B;  1NXB A;  4OM4 A;  1S4Y A;  1IJC A;  1IK8 A;  1VB0 A;  2MJY A;  1M9Z A;  2QJ9 C;  2CTX A;  2NBT A;  2J8B A;  3HH7 A;  2I9B E;  2H5F A;  6EBX A;  4EY8 B;  1CHV S;  2PJY B;  2JVE A;  1KL8 A;  3KFD I;  1ES7 B;  2MUP A;  1HC9 A;  1KXI A;  2VLW A;  1KBS A;  2UX2 A;  1ZAD A;  1G6M A;  3NEQ A;  1LSI A;  2K3G A;  1F94 A;  4XJJ A;  4AEA A;  4FAO C;  2ABX A;  2BTX A;  1CVO A;  1PLO A;  4HQP F;  1CDQ A;  1IDL A;  1CTX A;  1NOR A;  1F8U B;  2CCX A;  3FEV A;  1NTN A;  1JE9 A;  5EBX A;  1FF4 A;  1CCQ A;  1KFH A;  1KS6 A;  1FSS B;  2HLR A;  1CXN A;  1LXH A;  1LJZ A;  2MUO A;  2FD6 U;  2BHI A;  2H64 B;  3PLC A;  2H7Z B;  2L5S A;  3KFD E;  3NDS A;  2CDX A;  1ONJ A;  4P7U A;  1CB9 A;  1QKE A;  2LCR A;  5DZ5 A;  1COE A;  3ERA A;  5IMY C;  1IDH A;  2QC1 A;  1XT3 A;  2QJA C;  3BT1 U;  2MJ4 A;  1QKD A;  1FAS A;  1IDI A;  1KU6 B;  4ZQY A;  5IMT D;  2N99 A;  1MR6 A;  1YWH A;  1LXG A;  4LFT A;  1HOY A;  2MJ0 A;  1KTZ B;  2GOO C;  1LX5 B;  1ERG A;  3U73 U;  3NH7 A;  1TGX A;  1B41 B;  1CXO A;  1DRS A;  2HLQ A;  5DO6 A;  1NYU A;  1TXB A;  3EBX A;  5DU1 A;  1HAJ A;  2CRS A;  1FSC A;  1REW C;  2QJB C;  1BXP A;  1CRF A;  1UG4 A;  2ERA A;  1JBD A;  4BIK B;  1JGK A;  1FRA A;  1I02 A;  1CDT A;  1TFS A; 
#chains in the Genus database with same CATH homology
 2H62 D;  2PJY C;  3BT2 U;  1V6P A;  1ABT A;  1IKC A;  1CRE A;  2H62 C;  2OFS A;  2JQP A;  1ERA A;  2LA1 A;  2MHY A;  1KBT A;  4FAO E;  3VTS A;  2UWR A;  3QB4 B;  4BDT B;  1NYS A;  4IYE A;  1TXA A;  1CDR A;  1IQ9 A;  1W6B A;  2H7Z A;  1NTX A;  1H0J A;  1KC4 A;  4QTI U;  4RUD A;  2MFA A;  1KBA A;  1NEA A;  1BTE A;  4OM5 A;  1RL5 A;  1CDS A;  1COD A;  1QM7 A;  1HAA A;  2X8B B;  4DO8 A;  1RGJ A;  2H64 C;  2CRT A;  4UY2 C;  1L4W A;  1FFJ A;  2H8U A;  3U74 U;  3LAQ U;  3EVS C;  4KSN A;  1MAH F;  2L03 A;  1HC9 B;  1IDG A;  2GOO B;  1NXB A;  4OM4 A;  1S4Y A;  1IJC A;  1IK8 A;  1VB0 A;  2MJY A;  1M9Z A;  2QJ9 C;  2CTX A;  2NBT A;  2J8B A;  3HH7 A;  2I9B E;  2H5F A;  6EBX A;  4EY8 B;  1CHV S;  2PJY B;  2JVE A;  1KL8 A;  3KFD I;  1ES7 B;  2MUP A;  1HC9 A;  1KXI A;  2VLW A;  1KBS A;  2UX2 A;  1ZAD A;  1G6M A;  3NEQ A;  1LSI A;  2K3G A;  1F94 A;  4XJJ A;  4AEA A;  4FAO C;  2ABX A;  2BTX A;  1CVO A;  1PLO A;  4HQP F;  1CDQ A;  1IDL A;  1CTX A;  1NOR A;  1F8U B;  2CCX A;  3FEV A;  1NTN A;  1JE9 A;  5EBX A;  1FF4 A;  1CCQ A;  1KFH A;  1KS6 A;  1FSS B;  2HLR A;  1CXN A;  1LXH A;  1LJZ A;  2MUO A;  2FD6 U;  2BHI A;  2H64 B;  3PLC A;  2H7Z B;  2L5S A;  3KFD E;  3NDS A;  2CDX A;  1ONJ A;  4P7U A;  1CB9 A;  1QKE A;  2LCR A;  5DZ5 A;  1COE A;  3ERA A;  5IMY C;  1IDH A;  2QC1 A;  1XT3 A;  2QJA C;  3BT1 U;  2MJ4 A;  1QKD A;  1FAS A;  1IDI A;  1KU6 B;  4ZQY A;  5IMT D;  2N99 A;  1MR6 A;  1YWH A;  1LXG A;  4LFT A;  1HOY A;  2MJ0 A;  1KTZ B;  2GOO C;  1LX5 B;  1ERG A;  3U73 U;  3NH7 A;  1TGX A;  1B41 B;  1CXO A;  1DRS A;  2HLQ A;  5DO6 A;  1NYU A;  1TXB A;  3EBX A;  5DU1 A;  1HAJ A;  2CRS A;  1FSC A;  1REW C;  2QJB C;  1BXP A;  1CRF A;  1UG4 A;  2ERA A;  1JBD A;  4BIK B;  1JGK A;  1FRA A;  1I02 A;  1CDT A;  1TFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...