1NXBA

Structure and function of snake venom curarimimetic neurotoxins
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
62
structure length
62
Chain Sequence
RICFNQHSSQPQTTKTCSPGESSCYHKQWSDFRGTIIERGCGCPTVKPGIKLSCCESEVCNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEUROTOXIN B
publication title Structure and function of snake venom curarimimetic neurotoxins.
pubmed rcsb
source organism Laticauda semifasciata
molecule tags Neurotoxin (post-synaptic)
total genus 10
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1980-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1nxbA00
1IDHA 1W6BA 4OM5A 2H8UA 2I9BE 1KFHA 1QM7A 1ONJA 1ERGA 4LFTA 4QTIU 1KL8A 3ERAA 2MFAA 3KFDE 2K3GA 3EBXA 5IMYC 1VB0A 1KC4A 1IJCA 2CTXA 2GOOC 3BT2U 1CB9A 5IMTD 1IDGA 3NH7A 1RL5A 2H62D 3VTSA 2QJBC 1CXOA 3PLCA 2MUPA 1CDTA 1JGKA 2FD6U 1CREA 4P7UA 1KTZB 1HC9B 1I02A 2MUOA 2H64C 1ABTA 4OM4A 1CDSA 1KXIA 2H7ZB 2QC1A 3FEVA 4BDTB 1BTEA 4RUDA 1FSSB 1TFSA 1ERAA 1PLOA 2JVEA 1NEAA 1NYUA 2MJ0A 1REWC 1NYSA 1KU6B 2CCXA 1ZADA 6EBXA 2VLWA 4EY8B 1B41B 1HAAA 1LSIA 1HAJA 1XT3A 1CXNA 1V6PA 1CRFA 1TXAA 1FASA 1FFJA 2BTXA 1KBTA 3U74U 1CTXA 4BIKB 1NTNA 1H0JA 5DU1A 2JQPA 2HLRA 4DO8A 1FSCA 1FF4A 1IK8A 1HC9A 1CVOA 1F94A 2X8BB 4FAOC 2QJAC 2GOOB 2CRSA 3HH7A 1YWHA 1KBAA 1QKEA 1RGJA 2BHIA 4IYEA 1IDLA 1LXGA 2HLQA 2CDXA 2MJ4A 3BT1U 3QB4B 1M9ZA 1COEA 4UY2C 2MHYA 1CHVS 2PJYB 1G6MA 3U73U 3EVSC 1CCQA 1NTXA 2L5SA 2NBTA 4AEAA 2QJ9C 4FAOE 1KS6A 1UG4A 2UWRA 1JE9A 4HQPF 5DZ5A 1FRAA 2ERAA 3LAQU 1BXPA 2H5FA 3NEQA 1CDQA 2MJYA 1ES7B 1IDIA 1IKCA 1NXBA 2N99A 1F8UB 1LXHA 1QKDA 2H7ZA 2LA1A 3KFDI 2L03A 1MR6A 2ABXA 2J8BA 1KBSA 1S4YA 2H62C 1TXBA 5EBXA 2CRTA 1HOYA 1NORA 1L4WA 1LJZA 2LCRA 1TGXA 2UX2A 4ZQYA 1CODA 1MAHF 2PJYC 1JBDA 2OFSA 1CDRA 4XJJA 1DRSA 1LX5B 3NDSA 2H64B 5DO6A 1IQ9A
chains in the Genus database with same CATH superfamily
1IDHA 1W6BA 4OM5A 2H8UA 2I9BE 1KFHA 1QM7A 1ONJA 1ERGA 4LFTA 4QTIU 1KL8A 3ERAA 2MFAA 3KFDE 2K3GA 3EBXA 5IMYC 1VB0A 1KC4A 1IJCA 2CTXA 2GOOC 3BT2U 1CB9A 5IMTD 1IDGA 3NH7A 1RL5A 2H62D 3VTSA 2QJBC 1CXOA 3PLCA 2MUPA 1CDTA 1JGKA 2FD6U 1CREA 4P7UA 1KTZB 1HC9B 1I02A 2MUOA 2H64C 1ABTA 4OM4A 1CDSA 1KXIA 2H7ZB 2QC1A 3FEVA 4BDTB 1BTEA 4RUDA 1FSSB 1TFSA 1ERAA 1PLOA 2JVEA 1NEAA 1NYUA 2MJ0A 1REWC 1NYSA 1KU6B 2CCXA 1ZADA 6EBXA 2VLWA 4EY8B 1B41B 4KSNA 1HAAA 1LSIA 1HAJA 1XT3A 1CXNA 1V6PA 1CRFA 1TXAA 1FASA 1FFJA 2BTXA 1KBTA 3U74U 1CTXA 4BIKB 1NTNA 1H0JA 5DU1A 2JQPA 2HLRA 4DO8A 1FSCA 1FF4A 1IK8A 1HC9A 1CVOA 1F94A 2X8BB 4FAOC 2QJAC 2GOOB 2CRSA 3HH7A 1YWHA 1KBAA 1QKEA 1RGJA 2BHIA 4IYEA 1IDLA 1LXGA 2HLQA 2CDXA 2MJ4A 3BT1U 3QB4B 1M9ZA 1COEA 4UY2C 2MHYA 1CHVS 2PJYB 1G6MA 3U73U 3EVSC 1CCQA 1NTXA 2L5SA 2NBTA 4AEAA 2QJ9C 4FAOE 1KS6A 1UG4A 2UWRA 1JE9A 4HQPF 5DZ5A 1FRAA 2ERAA 3LAQU 1BXPA 2H5FA 3NEQA 1CDQA 2MJYA 1ES7B 1IDIA 1IKCA 1NXBA 2N99A 1F8UB 1LXHA 1QKDA 2H7ZA 2LA1A 3KFDI 2L03A 1MR6A 2ABXA 2J8BA 1KBSA 1S4YA 2H62C 1TXBA 5EBXA 2CRTA 1HOYA 1NORA 1L4WA 1LJZA 2LCRA 1TGXA 2UX2A 4ZQYA 1CODA 1MAHF 2PJYC 1JBDA 2OFSA 1CDRA 4XJJA 1DRSA 1LX5B 3NDSA 2H64B 5DO6A 1IQ9A
chains in the Genus database with same CATH topology
1IDHA 1W6BA 4OM5A 2H8UA 2I9BE 1KFHA 1QM7A 1ONJA 1ERGA 4LFTA 4QTIU 1KL8A 3ERAA 2MFAA 3KFDE 2K3GA 3EBXA 5IMYC 1VB0A 1KC4A 1IJCA 2CTXA 2GOOC 3BT2U 1CB9A 5IMTD 1IDGA 3NH7A 1RL5A 2H62D 3VTSA 2QJBC 1CXOA 3PLCA 2MUPA 1CDTA 1JGKA 2FD6U 1CREA 4P7UA 1KTZB 1HC9B 1I02A 2MUOA 2H64C 1ABTA 4OM4A 1CDSA 1KXIA 2H7ZB 2QC1A 3FEVA 4BDTB 1BTEA 4RUDA 1FSSB 1TFSA 1ERAA 1PLOA 2JVEA 1NEAA 1NYUA 2MJ0A 1REWC 1NYSA 1KU6B 2CCXA 1ZADA 6EBXA 2VLWA 4EY8B 1B41B 4KSNA 1HAAA 1LSIA 1HAJA 1XT3A 1CXNA 1V6PA 1CRFA 1TXAA 1FASA 1FFJA 2BTXA 1KBTA 3U74U 1CTXA 4BIKB 1NTNA 1H0JA 5DU1A 2JQPA 2HLRA 4DO8A 1FSCA 1FF4A 1IK8A 1HC9A 1CVOA 1F94A 2X8BB 4FAOC 2QJAC 2GOOB 2CRSA 3HH7A 1YWHA 1KBAA 1QKEA 1RGJA 2BHIA 4IYEA 1IDLA 1LXGA 2HLQA 2CDXA 2MJ4A 3BT1U 3QB4B 1M9ZA 1COEA 4UY2C 2MHYA 1CHVS 2PJYB 1G6MA 3U73U 3EVSC 1CCQA 1NTXA 2L5SA 2NBTA 4AEAA 2QJ9C 4FAOE 1KS6A 1UG4A 2UWRA 1JE9A 4HQPF 5DZ5A 1FRAA 2ERAA 3LAQU 1BXPA 2H5FA 3NEQA 1CDQA 2MJYA 1ES7B 1IDIA 1IKCA 1NXBA 2N99A 1F8UB 1LXHA 1QKDA 2H7ZA 2LA1A 3KFDI 2L03A 1MR6A 2ABXA 2J8BA 1KBSA 1S4YA 2H62C 1TXBA 5EBXA 2CRTA 1HOYA 1NORA 1L4WA 1LJZA 2LCRA 1TGXA 2UX2A 4ZQYA 1CODA 1MAHF 2PJYC 1JBDA 2OFSA 1CDRA 4XJJA 1DRSA 1LX5B 3NDSA 2H64B 5DO6A 1IQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDH A;  1W6B A;  4OM5 A;  2H8U A;  2I9B E;  1KFH A;  1QM7 A;  1ONJ A;  1ERG A;  4LFT A;  4QTI U;  1KL8 A;  3ERA A;  2MFA A;  3KFD E;  2K3G A;  3EBX A;  5IMY C;  1VB0 A;  1KC4 A;  1IJC A;  2CTX A;  2GOO C;  3BT2 U;  1CB9 A;  5IMT D;  1IDG A;  3NH7 A;  1RL5 A;  2H62 D;  3VTS A;  2QJB C;  1CXO A;  3PLC A;  2MUP A;  1CDT A;  1JGK A;  2FD6 U;  1CRE A;  4P7U A;  1KTZ B;  1HC9 B;  1I02 A;  2MUO A;  2H64 C;  1ABT A;  4OM4 A;  1CDS A;  1KXI A;  2H7Z B;  2QC1 A;  3FEV A;  4BDT B;  1BTE A;  4RUD A;  1FSS B;  1TFS A;  1ERA A;  1PLO A;  2JVE A;  1NEA A;  1NYU A;  2MJ0 A;  1REW C;  1NYS A;  1KU6 B;  2CCX A;  1ZAD A;  6EBX A;  2VLW A;  4EY8 B;  1B41 B;  1HAA A;  1LSI A;  1HAJ A;  1XT3 A;  1CXN A;  1V6P A;  1CRF A;  1TXA A;  1FAS A;  1FFJ A;  2BTX A;  1KBT A;  3U74 U;  1CTX A;  4BIK B;  1NTN A;  1H0J A;  5DU1 A;  2JQP A;  2HLR A;  4DO8 A;  1FSC A;  1FF4 A;  1IK8 A;  1HC9 A;  1CVO A;  1F94 A;  2X8B B;  4FAO C;  2QJA C;  2GOO B;  2CRS A;  3HH7 A;  1YWH A;  1KBA A;  1QKE A;  1RGJ A;  2BHI A;  4IYE A;  1IDL A;  1LXG A;  2HLQ A;  2CDX A;  2MJ4 A;  3BT1 U;  3QB4 B;  1M9Z A;  1COE A;  4UY2 C;  2MHY A;  1CHV S;  2PJY B;  1G6M A;  3U73 U;  3EVS C;  1CCQ A;  1NTX A;  2L5S A;  2NBT A;  4AEA A;  2QJ9 C;  4FAO E;  1KS6 A;  1UG4 A;  2UWR A;  1JE9 A;  4HQP F;  5DZ5 A;  1FRA A;  2ERA A;  3LAQ U;  1BXP A;  2H5F A;  3NEQ A;  1CDQ A;  2MJY A;  1ES7 B;  1IDI A;  1IKC A;  1NXB A;  2N99 A;  1F8U B;  1LXH A;  1QKD A;  2H7Z A;  2LA1 A;  3KFD I;  2L03 A;  1MR6 A;  2ABX A;  2J8B A;  1KBS A;  1S4Y A;  2H62 C;  1TXB A;  5EBX A;  2CRT A;  1HOY A;  1NOR A;  1L4W A;  1LJZ A;  2LCR A;  1TGX A;  2UX2 A;  4ZQY A;  1COD A;  1MAH F;  2PJY C;  1JBD A;  2OFS A;  1CDR A;  4XJJ A;  1DRS A;  1LX5 B;  3NDS A;  2H64 B;  5DO6 A;  1IQ9 A; 
#chains in the Genus database with same CATH topology
 1IDH A;  1W6B A;  4OM5 A;  2H8U A;  2I9B E;  1KFH A;  1QM7 A;  1ONJ A;  1ERG A;  4LFT A;  4QTI U;  1KL8 A;  3ERA A;  2MFA A;  3KFD E;  2K3G A;  3EBX A;  5IMY C;  1VB0 A;  1KC4 A;  1IJC A;  2CTX A;  2GOO C;  3BT2 U;  1CB9 A;  5IMT D;  1IDG A;  3NH7 A;  1RL5 A;  2H62 D;  3VTS A;  2QJB C;  1CXO A;  3PLC A;  2MUP A;  1CDT A;  1JGK A;  2FD6 U;  1CRE A;  4P7U A;  1KTZ B;  1HC9 B;  1I02 A;  2MUO A;  2H64 C;  1ABT A;  4OM4 A;  1CDS A;  1KXI A;  2H7Z B;  2QC1 A;  3FEV A;  4BDT B;  1BTE A;  4RUD A;  1FSS B;  1TFS A;  1ERA A;  1PLO A;  2JVE A;  1NEA A;  1NYU A;  2MJ0 A;  1REW C;  1NYS A;  1KU6 B;  2CCX A;  1ZAD A;  6EBX A;  2VLW A;  4EY8 B;  1B41 B;  4KSN A;  1HAA A;  1LSI A;  1HAJ A;  1XT3 A;  1CXN A;  1V6P A;  1CRF A;  1TXA A;  1FAS A;  1FFJ A;  2BTX A;  1KBT A;  3U74 U;  1CTX A;  4BIK B;  1NTN A;  1H0J A;  5DU1 A;  2JQP A;  2HLR A;  4DO8 A;  1FSC A;  1FF4 A;  1IK8 A;  1HC9 A;  1CVO A;  1F94 A;  2X8B B;  4FAO C;  2QJA C;  2GOO B;  2CRS A;  3HH7 A;  1YWH A;  1KBA A;  1QKE A;  1RGJ A;  2BHI A;  4IYE A;  1IDL A;  1LXG A;  2HLQ A;  2CDX A;  2MJ4 A;  3BT1 U;  3QB4 B;  1M9Z A;  1COE A;  4UY2 C;  2MHY A;  1CHV S;  2PJY B;  1G6M A;  3U73 U;  3EVS C;  1CCQ A;  1NTX A;  2L5S A;  2NBT A;  4AEA A;  2QJ9 C;  4FAO E;  1KS6 A;  1UG4 A;  2UWR A;  1JE9 A;  4HQP F;  5DZ5 A;  1FRA A;  2ERA A;  3LAQ U;  1BXP A;  2H5F A;  3NEQ A;  1CDQ A;  2MJY A;  1ES7 B;  1IDI A;  1IKC A;  1NXB A;  2N99 A;  1F8U B;  1LXH A;  1QKD A;  2H7Z A;  2LA1 A;  3KFD I;  2L03 A;  1MR6 A;  2ABX A;  2J8B A;  1KBS A;  1S4Y A;  2H62 C;  1TXB A;  5EBX A;  2CRT A;  1HOY A;  1NOR A;  1L4W A;  1LJZ A;  2LCR A;  1TGX A;  2UX2 A;  4ZQY A;  1COD A;  1MAH F;  2PJY C;  1JBD A;  2OFS A;  1CDR A;  4XJJ A;  1DRS A;  1LX5 B;  3NDS A;  2H64 B;  5DO6 A;  1IQ9 A; 
#chains in the Genus database with same CATH homology
 1IDH A;  1W6B A;  4OM5 A;  2H8U A;  2I9B E;  1KFH A;  1QM7 A;  1ONJ A;  1ERG A;  4LFT A;  4QTI U;  1KL8 A;  3ERA A;  2MFA A;  3KFD E;  2K3G A;  3EBX A;  5IMY C;  1VB0 A;  1KC4 A;  1IJC A;  2CTX A;  2GOO C;  3BT2 U;  1CB9 A;  5IMT D;  1IDG A;  3NH7 A;  1RL5 A;  2H62 D;  3VTS A;  2QJB C;  1CXO A;  3PLC A;  2MUP A;  1CDT A;  1JGK A;  2FD6 U;  1CRE A;  4P7U A;  1KTZ B;  1HC9 B;  1I02 A;  2MUO A;  2H64 C;  1ABT A;  4OM4 A;  1CDS A;  1KXI A;  2H7Z B;  2QC1 A;  3FEV A;  4BDT B;  1BTE A;  4RUD A;  1FSS B;  1TFS A;  1ERA A;  1PLO A;  2JVE A;  1NEA A;  1NYU A;  2MJ0 A;  1REW C;  1NYS A;  1KU6 B;  2CCX A;  1ZAD A;  6EBX A;  2VLW A;  4EY8 B;  1B41 B;  4KSN A;  1HAA A;  1LSI A;  1HAJ A;  1XT3 A;  1CXN A;  1V6P A;  1CRF A;  1TXA A;  1FAS A;  1FFJ A;  2BTX A;  1KBT A;  3U74 U;  1CTX A;  4BIK B;  1NTN A;  1H0J A;  5DU1 A;  2JQP A;  2HLR A;  4DO8 A;  1FSC A;  1FF4 A;  1IK8 A;  1HC9 A;  1CVO A;  1F94 A;  2X8B B;  4FAO C;  2QJA C;  2GOO B;  2CRS A;  3HH7 A;  1YWH A;  1KBA A;  1QKE A;  1RGJ A;  2BHI A;  4IYE A;  1IDL A;  1LXG A;  2HLQ A;  2CDX A;  2MJ4 A;  3BT1 U;  3QB4 B;  1M9Z A;  1COE A;  4UY2 C;  2MHY A;  1CHV S;  2PJY B;  1G6M A;  3U73 U;  3EVS C;  1CCQ A;  1NTX A;  2L5S A;  2NBT A;  4AEA A;  2QJ9 C;  4FAO E;  1KS6 A;  1UG4 A;  2UWR A;  1JE9 A;  4HQP F;  5DZ5 A;  1FRA A;  2ERA A;  3LAQ U;  1BXP A;  2H5F A;  3NEQ A;  1CDQ A;  2MJY A;  1ES7 B;  1IDI A;  1IKC A;  1NXB A;  2N99 A;  1F8U B;  1LXH A;  1QKD A;  2H7Z A;  2LA1 A;  3KFD I;  2L03 A;  1MR6 A;  2ABX A;  2J8B A;  1KBS A;  1S4Y A;  2H62 C;  1TXB A;  5EBX A;  2CRT A;  1HOY A;  1NOR A;  1L4W A;  1LJZ A;  2LCR A;  1TGX A;  2UX2 A;  4ZQY A;  1COD A;  1MAH F;  2PJY C;  1JBD A;  2OFS A;  1CDR A;  4XJJ A;  1DRS A;  1LX5 B;  3NDS A;  2H64 B;  5DO6 A;  1IQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...