1W6BA

Solution nmr structure of a long neurotoxin from the venom of the asian cobra, 20 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
ITCYKTPIPITSETCAPGQNLCYTKTWCDAWCGSRGKVIELGCAATCPTVESYQDIKCCSTDDCNPHPKQKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
publication title Solution structure of long neurotoxin NTX-1 from the venom of Naja naja oxiana by 2D-NMR spectroscopy.
pubmed doi rcsb
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1w6bA00
1HAJA 1IDGA 2H8UA 1CREA 4XJJA 3U74U 1DRSA 1IK8A 1KFHA 1JE9A 1TXAA 4EY8B 2H7ZB 2CRSA 1QKEA 1TGXA 3LAQU 5DZ5A 4P7UA 4BIKB 1YWHA 1CB9A 1KTZB 1LXGA 1F8UB 5DO6A 2L03A 2CDXA 1ZADA 2H5FA 2LA1A 3BT1U 1IJCA 4FAOC 1FSCA 2N99A 5EBXA 4BDTB 1RGJA 2MJ0A 2OFSA 1KC4A 2JQPA 1CRFA 1H0JA 2ABXA 2H64B 1TXBA 1ERAA 2QJAC 4RUDA 1L4WA 1S4YA 1BTEA 1REWC 1FFJA 2MUPA 1BXPA 5IMYC 3VTSA 3NH7A 2H7ZA 1KXIA 1B41B 1KBSA 5DU1A 1NTXA 1LJZA 6EBXA 1IDIA 2PJYC 1M9ZA 2MFAA 1I02A 1CCQA 1HC9B 2CTXA 2QJ9C 3EBXA 1CDTA 3ERAA 3NDSA 1CDQA 2NBTA 3KFDI 4UY2C 1KU6B 3NEQA 1IDHA 2CCXA 1COEA 1CXOA 2LCRA 1MAHF 2H62D 2X8BB 2CRTA 2MHYA 4LFTA 3EVSC 4ZQYA 2L5SA 2HLQA 2H62C 1JBDA 4FAOE 3U73U 1KBAA 4DO8A 2JVEA 1PLOA 1TFSA 2MUOA 2MJYA 4OM5A 1CTXA 1QM7A 3HH7A 2VLWA 1XT3A 1NYUA 1NEAA 1G6MA 2K3GA 2UWRA 1CHVS 1ERGA 1HC9A 3QB4B 4OM4A 2PJYB 1HAAA 2BHIA 1FASA 3BT2U 1CDSA 1KS6A 1HOYA 1CXNA 2BTXA 1IQ9A 2HLRA 1ONJA 1UG4A 2MJ4A 1IDLA 4QTIU 1QKDA 4HQPF 1NXBA 1V6PA 1LXHA 5IMTD 1CVOA 1MR6A 1RL5A 1VB0A 3FEVA 3PLCA 1F94A 2ERAA 2UX2A 1ABTA 2QJBC 1FSSB 1LX5B 1KL8A 4IYEA 1NYSA 2J8BA 1CODA 1KBTA 1IKCA 1CDRA 1ES7B 1JGKA 2I9BE 1FRAA 1NTNA 2GOOC 2GOOB 2H64C 4AEAA 1LSIA 1FF4A 2QC1A 1NORA 3KFDE 1W6BA 2FD6U
chains in the Genus database with same CATH superfamily
1HAJA 1IDGA 2H8UA 1CREA 4XJJA 3U74U 1DRSA 1IK8A 1KFHA 1JE9A 1TXAA 4EY8B 2H7ZB 2CRSA 1QKEA 1TGXA 3LAQU 5DZ5A 4P7UA 4BIKB 1YWHA 1CB9A 1KTZB 1LXGA 1F8UB 5DO6A 2L03A 2CDXA 1ZADA 2H5FA 2LA1A 3BT1U 1IJCA 4FAOC 1FSCA 2N99A 5EBXA 4BDTB 1RGJA 2MJ0A 2OFSA 1KC4A 2JQPA 1CRFA 1H0JA 2ABXA 2H64B 1TXBA 1ERAA 2QJAC 4RUDA 1L4WA 1S4YA 1BTEA 1REWC 1FFJA 2MUPA 1BXPA 5IMYC 3VTSA 3NH7A 2H7ZA 1KXIA 1B41B 1KBSA 5DU1A 1NTXA 1LJZA 6EBXA 1IDIA 2PJYC 1M9ZA 2MFAA 1I02A 1CCQA 1HC9B 2CTXA 2QJ9C 3EBXA 1CDTA 3ERAA 3NDSA 1CDQA 2NBTA 3KFDI 4UY2C 1KU6B 3NEQA 1IDHA 2CCXA 1COEA 1CXOA 2LCRA 1MAHF 2H62D 2X8BB 2CRTA 2MHYA 4LFTA 3EVSC 4ZQYA 2L5SA 2HLQA 2H62C 4KSNA 1JBDA 4FAOE 3U73U 1KBAA 4DO8A 2JVEA 1PLOA 1TFSA 2MUOA 2MJYA 4OM5A 1CTXA 1QM7A 3HH7A 2VLWA 1XT3A 1NYUA 1NEAA 1G6MA 2K3GA 2UWRA 1CHVS 1ERGA 1HC9A 3QB4B 4OM4A 2PJYB 1HAAA 2BHIA 1FASA 3BT2U 1CDSA 1KS6A 1HOYA 1CXNA 2BTXA 1IQ9A 2HLRA 1ONJA 1UG4A 2MJ4A 1IDLA 4QTIU 1QKDA 4HQPF 1NXBA 1V6PA 1LXHA 5IMTD 1CVOA 1MR6A 1RL5A 1VB0A 3FEVA 3PLCA 1F94A 2ERAA 2UX2A 1ABTA 2QJBC 1FSSB 1LX5B 1KL8A 4IYEA 1NYSA 2J8BA 1CODA 1KBTA 1IKCA 1CDRA 1ES7B 1JGKA 2I9BE 1FRAA 1NTNA 2GOOC 2GOOB 2H64C 4AEAA 1LSIA 1FF4A 2QC1A 1NORA 3KFDE 1W6BA 2FD6U
chains in the Genus database with same CATH topology
1HAJA 1IDGA 2H8UA 1CREA 4XJJA 3U74U 1DRSA 1IK8A 1KFHA 1JE9A 1TXAA 4EY8B 2H7ZB 2CRSA 1QKEA 1TGXA 3LAQU 5DZ5A 4P7UA 4BIKB 1YWHA 1CB9A 1KTZB 1LXGA 1F8UB 5DO6A 2L03A 2CDXA 1ZADA 2H5FA 2LA1A 3BT1U 1IJCA 4FAOC 1FSCA 2N99A 5EBXA 4BDTB 1RGJA 2MJ0A 2OFSA 1KC4A 2JQPA 1CRFA 1H0JA 2ABXA 2H64B 1TXBA 1ERAA 2QJAC 4RUDA 1L4WA 1S4YA 1BTEA 1REWC 1FFJA 2MUPA 1BXPA 5IMYC 3VTSA 3NH7A 2H7ZA 1KXIA 1B41B 1KBSA 5DU1A 1NTXA 1LJZA 6EBXA 1IDIA 2PJYC 1M9ZA 2MFAA 1I02A 1CCQA 1HC9B 2CTXA 2QJ9C 3EBXA 1CDTA 3ERAA 3NDSA 1CDQA 2NBTA 3KFDI 4UY2C 1KU6B 3NEQA 1IDHA 2CCXA 1COEA 1CXOA 2LCRA 1MAHF 2H62D 2X8BB 2CRTA 2MHYA 4LFTA 3EVSC 4ZQYA 2L5SA 2HLQA 2H62C 4KSNA 1JBDA 4FAOE 3U73U 1KBAA 4DO8A 2JVEA 1PLOA 1TFSA 2MUOA 2MJYA 4OM5A 1CTXA 1QM7A 3HH7A 2VLWA 1XT3A 1NYUA 1NEAA 1G6MA 2K3GA 2UWRA 1CHVS 1ERGA 1HC9A 3QB4B 4OM4A 2PJYB 1HAAA 2BHIA 1FASA 3BT2U 1CDSA 1KS6A 1HOYA 1CXNA 2BTXA 1IQ9A 2HLRA 1ONJA 1UG4A 2MJ4A 1IDLA 4QTIU 1QKDA 4HQPF 1NXBA 1V6PA 1LXHA 5IMTD 1CVOA 1MR6A 1RL5A 1VB0A 3FEVA 3PLCA 1F94A 2ERAA 2UX2A 1ABTA 2QJBC 1FSSB 1LX5B 1KL8A 4IYEA 1NYSA 2J8BA 1CODA 1KBTA 1IKCA 1CDRA 1ES7B 1JGKA 2I9BE 1FRAA 1NTNA 2GOOC 2GOOB 2H64C 4AEAA 1LSIA 1FF4A 2QC1A 1NORA 3KFDE 1W6BA 2FD6U
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HAJ A;  1IDG A;  2H8U A;  1CRE A;  4XJJ A;  3U74 U;  1DRS A;  1IK8 A;  1KFH A;  1JE9 A;  1TXA A;  4EY8 B;  2H7Z B;  2CRS A;  1QKE A;  1TGX A;  3LAQ U;  5DZ5 A;  4P7U A;  4BIK B;  1YWH A;  1CB9 A;  1KTZ B;  1LXG A;  1F8U B;  5DO6 A;  2L03 A;  2CDX A;  1ZAD A;  2H5F A;  2LA1 A;  3BT1 U;  1IJC A;  4FAO C;  1FSC A;  2N99 A;  5EBX A;  4BDT B;  1RGJ A;  2MJ0 A;  2OFS A;  1KC4 A;  2JQP A;  1CRF A;  1H0J A;  2ABX A;  2H64 B;  1TXB A;  1ERA A;  2QJA C;  4RUD A;  1L4W A;  1S4Y A;  1BTE A;  1REW C;  1FFJ A;  2MUP A;  1BXP A;  5IMY C;  3VTS A;  3NH7 A;  2H7Z A;  1KXI A;  1B41 B;  1KBS A;  5DU1 A;  1NTX A;  1LJZ A;  6EBX A;  1IDI A;  2PJY C;  1M9Z A;  2MFA A;  1I02 A;  1CCQ A;  1HC9 B;  2CTX A;  2QJ9 C;  3EBX A;  1CDT A;  3ERA A;  3NDS A;  1CDQ A;  2NBT A;  3KFD I;  4UY2 C;  1KU6 B;  3NEQ A;  1IDH A;  2CCX A;  1COE A;  1CXO A;  2LCR A;  1MAH F;  2H62 D;  2X8B B;  2CRT A;  2MHY A;  4LFT A;  3EVS C;  4ZQY A;  2L5S A;  2HLQ A;  2H62 C;  1JBD A;  4FAO E;  3U73 U;  1KBA A;  4DO8 A;  2JVE A;  1PLO A;  1TFS A;  2MUO A;  2MJY A;  4OM5 A;  1CTX A;  1QM7 A;  3HH7 A;  2VLW A;  1XT3 A;  1NYU A;  1NEA A;  1G6M A;  2K3G A;  2UWR A;  1CHV S;  1ERG A;  1HC9 A;  3QB4 B;  4OM4 A;  2PJY B;  1HAA A;  2BHI A;  1FAS A;  3BT2 U;  1CDS A;  1KS6 A;  1HOY A;  1CXN A;  2BTX A;  1IQ9 A;  2HLR A;  1ONJ A;  1UG4 A;  2MJ4 A;  1IDL A;  4QTI U;  1QKD A;  4HQP F;  1NXB A;  1V6P A;  1LXH A;  5IMT D;  1CVO A;  1MR6 A;  1RL5 A;  1VB0 A;  3FEV A;  3PLC A;  1F94 A;  2ERA A;  2UX2 A;  1ABT A;  2QJB C;  1FSS B;  1LX5 B;  1KL8 A;  4IYE A;  1NYS A;  2J8B A;  1COD A;  1KBT A;  1IKC A;  1CDR A;  1ES7 B;  1JGK A;  2I9B E;  1FRA A;  1NTN A;  2GOO C;  2GOO B;  2H64 C;  4AEA A;  1LSI A;  1FF4 A;  2QC1 A;  1NOR A;  3KFD E;  1W6B A;  2FD6 U; 
#chains in the Genus database with same CATH topology
 1HAJ A;  1IDG A;  2H8U A;  1CRE A;  4XJJ A;  3U74 U;  1DRS A;  1IK8 A;  1KFH A;  1JE9 A;  1TXA A;  4EY8 B;  2H7Z B;  2CRS A;  1QKE A;  1TGX A;  3LAQ U;  5DZ5 A;  4P7U A;  4BIK B;  1YWH A;  1CB9 A;  1KTZ B;  1LXG A;  1F8U B;  5DO6 A;  2L03 A;  2CDX A;  1ZAD A;  2H5F A;  2LA1 A;  3BT1 U;  1IJC A;  4FAO C;  1FSC A;  2N99 A;  5EBX A;  4BDT B;  1RGJ A;  2MJ0 A;  2OFS A;  1KC4 A;  2JQP A;  1CRF A;  1H0J A;  2ABX A;  2H64 B;  1TXB A;  1ERA A;  2QJA C;  4RUD A;  1L4W A;  1S4Y A;  1BTE A;  1REW C;  1FFJ A;  2MUP A;  1BXP A;  5IMY C;  3VTS A;  3NH7 A;  2H7Z A;  1KXI A;  1B41 B;  1KBS A;  5DU1 A;  1NTX A;  1LJZ A;  6EBX A;  1IDI A;  2PJY C;  1M9Z A;  2MFA A;  1I02 A;  1CCQ A;  1HC9 B;  2CTX A;  2QJ9 C;  3EBX A;  1CDT A;  3ERA A;  3NDS A;  1CDQ A;  2NBT A;  3KFD I;  4UY2 C;  1KU6 B;  3NEQ A;  1IDH A;  2CCX A;  1COE A;  1CXO A;  2LCR A;  1MAH F;  2H62 D;  2X8B B;  2CRT A;  2MHY A;  4LFT A;  3EVS C;  4ZQY A;  2L5S A;  2HLQ A;  2H62 C;  4KSN A;  1JBD A;  4FAO E;  3U73 U;  1KBA A;  4DO8 A;  2JVE A;  1PLO A;  1TFS A;  2MUO A;  2MJY A;  4OM5 A;  1CTX A;  1QM7 A;  3HH7 A;  2VLW A;  1XT3 A;  1NYU A;  1NEA A;  1G6M A;  2K3G A;  2UWR A;  1CHV S;  1ERG A;  1HC9 A;  3QB4 B;  4OM4 A;  2PJY B;  1HAA A;  2BHI A;  1FAS A;  3BT2 U;  1CDS A;  1KS6 A;  1HOY A;  1CXN A;  2BTX A;  1IQ9 A;  2HLR A;  1ONJ A;  1UG4 A;  2MJ4 A;  1IDL A;  4QTI U;  1QKD A;  4HQP F;  1NXB A;  1V6P A;  1LXH A;  5IMT D;  1CVO A;  1MR6 A;  1RL5 A;  1VB0 A;  3FEV A;  3PLC A;  1F94 A;  2ERA A;  2UX2 A;  1ABT A;  2QJB C;  1FSS B;  1LX5 B;  1KL8 A;  4IYE A;  1NYS A;  2J8B A;  1COD A;  1KBT A;  1IKC A;  1CDR A;  1ES7 B;  1JGK A;  2I9B E;  1FRA A;  1NTN A;  2GOO C;  2GOO B;  2H64 C;  4AEA A;  1LSI A;  1FF4 A;  2QC1 A;  1NOR A;  3KFD E;  1W6B A;  2FD6 U; 
#chains in the Genus database with same CATH homology
 1HAJ A;  1IDG A;  2H8U A;  1CRE A;  4XJJ A;  3U74 U;  1DRS A;  1IK8 A;  1KFH A;  1JE9 A;  1TXA A;  4EY8 B;  2H7Z B;  2CRS A;  1QKE A;  1TGX A;  3LAQ U;  5DZ5 A;  4P7U A;  4BIK B;  1YWH A;  1CB9 A;  1KTZ B;  1LXG A;  1F8U B;  5DO6 A;  2L03 A;  2CDX A;  1ZAD A;  2H5F A;  2LA1 A;  3BT1 U;  1IJC A;  4FAO C;  1FSC A;  2N99 A;  5EBX A;  4BDT B;  1RGJ A;  2MJ0 A;  2OFS A;  1KC4 A;  2JQP A;  1CRF A;  1H0J A;  2ABX A;  2H64 B;  1TXB A;  1ERA A;  2QJA C;  4RUD A;  1L4W A;  1S4Y A;  1BTE A;  1REW C;  1FFJ A;  2MUP A;  1BXP A;  5IMY C;  3VTS A;  3NH7 A;  2H7Z A;  1KXI A;  1B41 B;  1KBS A;  5DU1 A;  1NTX A;  1LJZ A;  6EBX A;  1IDI A;  2PJY C;  1M9Z A;  2MFA A;  1I02 A;  1CCQ A;  1HC9 B;  2CTX A;  2QJ9 C;  3EBX A;  1CDT A;  3ERA A;  3NDS A;  1CDQ A;  2NBT A;  3KFD I;  4UY2 C;  1KU6 B;  3NEQ A;  1IDH A;  2CCX A;  1COE A;  1CXO A;  2LCR A;  1MAH F;  2H62 D;  2X8B B;  2CRT A;  2MHY A;  4LFT A;  3EVS C;  4ZQY A;  2L5S A;  2HLQ A;  2H62 C;  4KSN A;  1JBD A;  4FAO E;  3U73 U;  1KBA A;  4DO8 A;  2JVE A;  1PLO A;  1TFS A;  2MUO A;  2MJY A;  4OM5 A;  1CTX A;  1QM7 A;  3HH7 A;  2VLW A;  1XT3 A;  1NYU A;  1NEA A;  1G6M A;  2K3G A;  2UWR A;  1CHV S;  1ERG A;  1HC9 A;  3QB4 B;  4OM4 A;  2PJY B;  1HAA A;  2BHI A;  1FAS A;  3BT2 U;  1CDS A;  1KS6 A;  1HOY A;  1CXN A;  2BTX A;  1IQ9 A;  2HLR A;  1ONJ A;  1UG4 A;  2MJ4 A;  1IDL A;  4QTI U;  1QKD A;  4HQP F;  1NXB A;  1V6P A;  1LXH A;  5IMT D;  1CVO A;  1MR6 A;  1RL5 A;  1VB0 A;  3FEV A;  3PLC A;  1F94 A;  2ERA A;  2UX2 A;  1ABT A;  2QJB C;  1FSS B;  1LX5 B;  1KL8 A;  4IYE A;  1NYS A;  2J8B A;  1COD A;  1KBT A;  1IKC A;  1CDR A;  1ES7 B;  1JGK A;  2I9B E;  1FRA A;  1NTN A;  2GOO C;  2GOO B;  2H64 C;  4AEA A;  1LSI A;  1FF4 A;  2QC1 A;  1NOR A;  3KFD E;  1W6B A;  2FD6 U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...