1W6BA

Solution nmr structure of a long neurotoxin from the venom of the asian cobra, 20 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
ITCYKTPIPITSETCAPGQNLCYTKTWCDAWCGSRGKVIELGCAATCPTVESYQDIKCCSTDDCNPHPKQKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of long neurotoxin NTX-1 from the venom of Naja naja oxiana by 2D-NMR spectroscopy.
pubmed doi rcsb
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1w6bA00
1FFJA 1CODA 2N99A 4OM5A 2MJYA 1F94A 2HLQA 1LXHA 1CHVS 1L4WA 1ZADA 1BXPA 2CRTA 4EY8B 3KFDI 1TXBA 4OM4A 3HH7A 2H7ZA 1CTXA 3EBXA 1LSIA 1NTNA 1V6PA 1CXNA 3PLCA 1IDHA 2PJYB 1TGXA 4AEAA 4HQPF 1BTEA 5DO6A 1CB9A 3NH7A 1M9ZA 2H7ZB 2K3GA 1TFSA 1LJZA 1MAHF 1NYSA 2FD6U 2QJBC 4FAOC 1CDSA 1IQ9A 1KFHA 1KU6B 2H62C 1W6BA 1QKEA 2BHIA 2GOOC 1NXBA 2VLWA 4ZQYA 2LA1A 4BDTB 4P7UA 1IKCA 1CDTA 3NDSA 1ERAA 1ONJA 4RUDA 1NTXA 1KL8A 2ABXA 2HLRA 2MHYA 4BIKB 3BT1U 2X8BB 1YWHA 3FEVA 1MR6A 1XT3A 2UWRA 2CDXA 6EBXA 1RL5A 2OFSA 1I02A 2JVEA 1REWC 1UG4A 1IJCA 1CXOA 1JGKA 1DRSA 4DO8A 2L5SA 4LFTA 1HAJA 1HAAA 1CDQA 2H5FA 2UX2A 5IMYC 2PJYC 1ABTA 1S4YA 5EBXA 3VTSA 2I9BE 1TXAA 1KBTA 1HC9A 4QTIU 3ERAA 1NYUA 3LAQU 1CRFA 3U74U 1NORA 1NEAA 1QKDA 4UY2C 4FAOE 3KFDE 1KXIA 2QC1A 1LX5B 1HOYA 2LCRA 5IMTD 2MFAA 2H64B 2CTXA 2QJAC 2MJ4A 1F8UB 1FF4A 1KBAA 3NEQA 1IDLA 2GOOB 2MUPA 1KBSA 5DZ5A 1IDIA 1JBDA 1COEA 1KS6A 2CRSA 1IDGA 1VB0A 1HC9B 5DU1A 1CDRA 2H8UA 4IYEA 1QM7A 2MUOA 1KC4A 1ERGA 1FASA 2MJ0A 1IK8A 1PLOA 3EVSC 2NBTA 1FSCA 1KTZB 2QJ9C 2J8BA 2H62D 3BT2U 1H0JA 1CVOA 2CCXA 3U73U 1FSSB 1G6MA 2BTXA 2JQPA 4XJJA 2ERAA 1JE9A 1CCQA 2L03A 1RGJA 1B41B 1LXGA 1ES7B 1CREA 1FRAA 3QB4B 2H64C
chains in the Genus database with same CATH superfamily
1FFJA 1CODA 2N99A 4OM5A 2MJYA 1F94A 2HLQA 1LXHA 1CHVS 1L4WA 1ZADA 1BXPA 2CRTA 4EY8B 3KFDI 1TXBA 4OM4A 3HH7A 2H7ZA 1CTXA 3EBXA 1LSIA 1NTNA 1V6PA 1CXNA 3PLCA 1IDHA 2PJYB 1TGXA 4AEAA 4HQPF 1BTEA 5DO6A 1CB9A 3NH7A 1M9ZA 2H7ZB 2K3GA 1TFSA 1LJZA 1MAHF 1NYSA 2FD6U 2QJBC 4FAOC 1CDSA 1IQ9A 1KFHA 1KU6B 2H62C 1W6BA 1QKEA 2BHIA 2GOOC 1NXBA 2VLWA 4ZQYA 2LA1A 4BDTB 4P7UA 1IKCA 1CDTA 3NDSA 1ERAA 1ONJA 4RUDA 1NTXA 1KL8A 2ABXA 2HLRA 2MHYA 4BIKB 3BT1U 2X8BB 1YWHA 3FEVA 1MR6A 1XT3A 2UWRA 2CDXA 6EBXA 1RL5A 2OFSA 1I02A 2JVEA 1REWC 1UG4A 1IJCA 1CXOA 1JGKA 1DRSA 4DO8A 2L5SA 4LFTA 1HAJA 1HAAA 1CDQA 2H5FA 2UX2A 5IMYC 2PJYC 1ABTA 1S4YA 5EBXA 3VTSA 2I9BE 1TXAA 1KBTA 1HC9A 4QTIU 3ERAA 1NYUA 3LAQU 1CRFA 3U74U 1NORA 1NEAA 1QKDA 4UY2C 4FAOE 3KFDE 1KXIA 2QC1A 1LX5B 1HOYA 2LCRA 5IMTD 2MFAA 2H64B 2CTXA 2QJAC 2MJ4A 1F8UB 1FF4A 1KBAA 3NEQA 1IDLA 2GOOB 2MUPA 1KBSA 5DZ5A 1IDIA 1JBDA 1COEA 1KS6A 2CRSA 1IDGA 1VB0A 1HC9B 5DU1A 1CDRA 2H8UA 4IYEA 1QM7A 2MUOA 1KC4A 1ERGA 1FASA 2MJ0A 1IK8A 1PLOA 3EVSC 2NBTA 1FSCA 1KTZB 2QJ9C 2J8BA 2H62D 3BT2U 1H0JA 1CVOA 2CCXA 3U73U 1FSSB 1G6MA 4KSNA 2BTXA 2JQPA 4XJJA 2ERAA 1JE9A 1CCQA 2L03A 1RGJA 1B41B 1LXGA 1ES7B 1CREA 1FRAA 3QB4B 2H64C
chains in the Genus database with same CATH topology
1FFJA 1CODA 2N99A 4OM5A 2MJYA 1F94A 2HLQA 1LXHA 1CHVS 1L4WA 1ZADA 1BXPA 2CRTA 4EY8B 3KFDI 1TXBA 4OM4A 3HH7A 2H7ZA 1CTXA 3EBXA 1LSIA 1NTNA 1V6PA 1CXNA 3PLCA 1IDHA 2PJYB 1TGXA 4AEAA 4HQPF 1BTEA 5DO6A 1CB9A 3NH7A 1M9ZA 2H7ZB 2K3GA 1TFSA 1LJZA 1MAHF 1NYSA 2FD6U 2QJBC 4FAOC 1CDSA 1IQ9A 1KFHA 1KU6B 2H62C 1W6BA 1QKEA 2BHIA 2GOOC 1NXBA 2VLWA 4ZQYA 2LA1A 4BDTB 4P7UA 1IKCA 1CDTA 3NDSA 1ERAA 1ONJA 4RUDA 1NTXA 1KL8A 2ABXA 2HLRA 2MHYA 4BIKB 3BT1U 2X8BB 1YWHA 3FEVA 1MR6A 1XT3A 2UWRA 2CDXA 6EBXA 1RL5A 2OFSA 1I02A 2JVEA 1REWC 1UG4A 1IJCA 1CXOA 1JGKA 1DRSA 4DO8A 2L5SA 4LFTA 1HAJA 1HAAA 1CDQA 2H5FA 2UX2A 5IMYC 2PJYC 1ABTA 1S4YA 5EBXA 3VTSA 2I9BE 1TXAA 1KBTA 1HC9A 4QTIU 3ERAA 1NYUA 3LAQU 1CRFA 3U74U 1NORA 1NEAA 1QKDA 4UY2C 4FAOE 3KFDE 1KXIA 2QC1A 1LX5B 1HOYA 2LCRA 5IMTD 2MFAA 2H64B 2CTXA 2QJAC 2MJ4A 1F8UB 1FF4A 1KBAA 3NEQA 1IDLA 2GOOB 2MUPA 1KBSA 5DZ5A 1IDIA 1JBDA 1COEA 1KS6A 2CRSA 1IDGA 1VB0A 1HC9B 5DU1A 1CDRA 2H8UA 4IYEA 1QM7A 2MUOA 1KC4A 1ERGA 1FASA 2MJ0A 1IK8A 1PLOA 3EVSC 2NBTA 1FSCA 1KTZB 2QJ9C 2J8BA 2H62D 3BT2U 1H0JA 1CVOA 2CCXA 3U73U 1FSSB 1G6MA 4KSNA 2BTXA 2JQPA 4XJJA 2ERAA 1JE9A 1CCQA 2L03A 1RGJA 1B41B 1LXGA 1ES7B 1CREA 1FRAA 3QB4B 2H64C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FFJ A;  1COD A;  2N99 A;  4OM5 A;  2MJY A;  1F94 A;  2HLQ A;  1LXH A;  1CHV S;  1L4W A;  1ZAD A;  1BXP A;  2CRT A;  4EY8 B;  3KFD I;  1TXB A;  4OM4 A;  3HH7 A;  2H7Z A;  1CTX A;  3EBX A;  1LSI A;  1NTN A;  1V6P A;  1CXN A;  3PLC A;  1IDH A;  2PJY B;  1TGX A;  4AEA A;  4HQP F;  1BTE A;  5DO6 A;  1CB9 A;  3NH7 A;  1M9Z A;  2H7Z B;  2K3G A;  1TFS A;  1LJZ A;  1MAH F;  1NYS A;  2FD6 U;  2QJB C;  4FAO C;  1CDS A;  1IQ9 A;  1KFH A;  1KU6 B;  2H62 C;  1W6B A;  1QKE A;  2BHI A;  2GOO C;  1NXB A;  2VLW A;  4ZQY A;  2LA1 A;  4BDT B;  4P7U A;  1IKC A;  1CDT A;  3NDS A;  1ERA A;  1ONJ A;  4RUD A;  1NTX A;  1KL8 A;  2ABX A;  2HLR A;  2MHY A;  4BIK B;  3BT1 U;  2X8B B;  1YWH A;  3FEV A;  1MR6 A;  1XT3 A;  2UWR A;  2CDX A;  6EBX A;  1RL5 A;  2OFS A;  1I02 A;  2JVE A;  1REW C;  1UG4 A;  1IJC A;  1CXO A;  1JGK A;  1DRS A;  4DO8 A;  2L5S A;  4LFT A;  1HAJ A;  1HAA A;  1CDQ A;  2H5F A;  2UX2 A;  5IMY C;  2PJY C;  1ABT A;  1S4Y A;  5EBX A;  3VTS A;  2I9B E;  1TXA A;  1KBT A;  1HC9 A;  4QTI U;  3ERA A;  1NYU A;  3LAQ U;  1CRF A;  3U74 U;  1NOR A;  1NEA A;  1QKD A;  4UY2 C;  4FAO E;  3KFD E;  1KXI A;  2QC1 A;  1LX5 B;  1HOY A;  2LCR A;  5IMT D;  2MFA A;  2H64 B;  2CTX A;  2QJA C;  2MJ4 A;  1F8U B;  1FF4 A;  1KBA A;  3NEQ A;  1IDL A;  2GOO B;  2MUP A;  1KBS A;  5DZ5 A;  1IDI A;  1JBD A;  1COE A;  1KS6 A;  2CRS A;  1IDG A;  1VB0 A;  1HC9 B;  5DU1 A;  1CDR A;  2H8U A;  4IYE A;  1QM7 A;  2MUO A;  1KC4 A;  1ERG A;  1FAS A;  2MJ0 A;  1IK8 A;  1PLO A;  3EVS C;  2NBT A;  1FSC A;  1KTZ B;  2QJ9 C;  2J8B A;  2H62 D;  3BT2 U;  1H0J A;  1CVO A;  2CCX A;  3U73 U;  1FSS B;  1G6M A;  2BTX A;  2JQP A;  4XJJ A;  2ERA A;  1JE9 A;  1CCQ A;  2L03 A;  1RGJ A;  1B41 B;  1LXG A;  1ES7 B;  1CRE A;  1FRA A;  3QB4 B;  2H64 C; 
#chains in the Genus database with same CATH topology
 1FFJ A;  1COD A;  2N99 A;  4OM5 A;  2MJY A;  1F94 A;  2HLQ A;  1LXH A;  1CHV S;  1L4W A;  1ZAD A;  1BXP A;  2CRT A;  4EY8 B;  3KFD I;  1TXB A;  4OM4 A;  3HH7 A;  2H7Z A;  1CTX A;  3EBX A;  1LSI A;  1NTN A;  1V6P A;  1CXN A;  3PLC A;  1IDH A;  2PJY B;  1TGX A;  4AEA A;  4HQP F;  1BTE A;  5DO6 A;  1CB9 A;  3NH7 A;  1M9Z A;  2H7Z B;  2K3G A;  1TFS A;  1LJZ A;  1MAH F;  1NYS A;  2FD6 U;  2QJB C;  4FAO C;  1CDS A;  1IQ9 A;  1KFH A;  1KU6 B;  2H62 C;  1W6B A;  1QKE A;  2BHI A;  2GOO C;  1NXB A;  2VLW A;  4ZQY A;  2LA1 A;  4BDT B;  4P7U A;  1IKC A;  1CDT A;  3NDS A;  1ERA A;  1ONJ A;  4RUD A;  1NTX A;  1KL8 A;  2ABX A;  2HLR A;  2MHY A;  4BIK B;  3BT1 U;  2X8B B;  1YWH A;  3FEV A;  1MR6 A;  1XT3 A;  2UWR A;  2CDX A;  6EBX A;  1RL5 A;  2OFS A;  1I02 A;  2JVE A;  1REW C;  1UG4 A;  1IJC A;  1CXO A;  1JGK A;  1DRS A;  4DO8 A;  2L5S A;  4LFT A;  1HAJ A;  1HAA A;  1CDQ A;  2H5F A;  2UX2 A;  5IMY C;  2PJY C;  1ABT A;  1S4Y A;  5EBX A;  3VTS A;  2I9B E;  1TXA A;  1KBT A;  1HC9 A;  4QTI U;  3ERA A;  1NYU A;  3LAQ U;  1CRF A;  3U74 U;  1NOR A;  1NEA A;  1QKD A;  4UY2 C;  4FAO E;  3KFD E;  1KXI A;  2QC1 A;  1LX5 B;  1HOY A;  2LCR A;  5IMT D;  2MFA A;  2H64 B;  2CTX A;  2QJA C;  2MJ4 A;  1F8U B;  1FF4 A;  1KBA A;  3NEQ A;  1IDL A;  2GOO B;  2MUP A;  1KBS A;  5DZ5 A;  1IDI A;  1JBD A;  1COE A;  1KS6 A;  2CRS A;  1IDG A;  1VB0 A;  1HC9 B;  5DU1 A;  1CDR A;  2H8U A;  4IYE A;  1QM7 A;  2MUO A;  1KC4 A;  1ERG A;  1FAS A;  2MJ0 A;  1IK8 A;  1PLO A;  3EVS C;  2NBT A;  1FSC A;  1KTZ B;  2QJ9 C;  2J8B A;  2H62 D;  3BT2 U;  1H0J A;  1CVO A;  2CCX A;  3U73 U;  1FSS B;  1G6M A;  4KSN A;  2BTX A;  2JQP A;  4XJJ A;  2ERA A;  1JE9 A;  1CCQ A;  2L03 A;  1RGJ A;  1B41 B;  1LXG A;  1ES7 B;  1CRE A;  1FRA A;  3QB4 B;  2H64 C; 
#chains in the Genus database with same CATH homology
 1FFJ A;  1COD A;  2N99 A;  4OM5 A;  2MJY A;  1F94 A;  2HLQ A;  1LXH A;  1CHV S;  1L4W A;  1ZAD A;  1BXP A;  2CRT A;  4EY8 B;  3KFD I;  1TXB A;  4OM4 A;  3HH7 A;  2H7Z A;  1CTX A;  3EBX A;  1LSI A;  1NTN A;  1V6P A;  1CXN A;  3PLC A;  1IDH A;  2PJY B;  1TGX A;  4AEA A;  4HQP F;  1BTE A;  5DO6 A;  1CB9 A;  3NH7 A;  1M9Z A;  2H7Z B;  2K3G A;  1TFS A;  1LJZ A;  1MAH F;  1NYS A;  2FD6 U;  2QJB C;  4FAO C;  1CDS A;  1IQ9 A;  1KFH A;  1KU6 B;  2H62 C;  1W6B A;  1QKE A;  2BHI A;  2GOO C;  1NXB A;  2VLW A;  4ZQY A;  2LA1 A;  4BDT B;  4P7U A;  1IKC A;  1CDT A;  3NDS A;  1ERA A;  1ONJ A;  4RUD A;  1NTX A;  1KL8 A;  2ABX A;  2HLR A;  2MHY A;  4BIK B;  3BT1 U;  2X8B B;  1YWH A;  3FEV A;  1MR6 A;  1XT3 A;  2UWR A;  2CDX A;  6EBX A;  1RL5 A;  2OFS A;  1I02 A;  2JVE A;  1REW C;  1UG4 A;  1IJC A;  1CXO A;  1JGK A;  1DRS A;  4DO8 A;  2L5S A;  4LFT A;  1HAJ A;  1HAA A;  1CDQ A;  2H5F A;  2UX2 A;  5IMY C;  2PJY C;  1ABT A;  1S4Y A;  5EBX A;  3VTS A;  2I9B E;  1TXA A;  1KBT A;  1HC9 A;  4QTI U;  3ERA A;  1NYU A;  3LAQ U;  1CRF A;  3U74 U;  1NOR A;  1NEA A;  1QKD A;  4UY2 C;  4FAO E;  3KFD E;  1KXI A;  2QC1 A;  1LX5 B;  1HOY A;  2LCR A;  5IMT D;  2MFA A;  2H64 B;  2CTX A;  2QJA C;  2MJ4 A;  1F8U B;  1FF4 A;  1KBA A;  3NEQ A;  1IDL A;  2GOO B;  2MUP A;  1KBS A;  5DZ5 A;  1IDI A;  1JBD A;  1COE A;  1KS6 A;  2CRS A;  1IDG A;  1VB0 A;  1HC9 B;  5DU1 A;  1CDR A;  2H8U A;  4IYE A;  1QM7 A;  2MUO A;  1KC4 A;  1ERG A;  1FAS A;  2MJ0 A;  1IK8 A;  1PLO A;  3EVS C;  2NBT A;  1FSC A;  1KTZ B;  2QJ9 C;  2J8B A;  2H62 D;  3BT2 U;  1H0J A;  1CVO A;  2CCX A;  3U73 U;  1FSS B;  1G6M A;  4KSN A;  2BTX A;  2JQP A;  4XJJ A;  2ERA A;  1JE9 A;  1CCQ A;  2L03 A;  1RGJ A;  1B41 B;  1LXG A;  1ES7 B;  1CRE A;  1FRA A;  3QB4 B;  2H64 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...