1W6BA

Solution nmr structure of a long neurotoxin from the venom of the asian cobra, 20 structures
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
ITCYKTPIPITSETCAPGQNLCYTKTWCDAWCGSRGKVIELGCAATCPTVESYQDIKCCSTDDCNPHPKQKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LONG NEUROTOXIN 1
publication title Solution structure of long neurotoxin NTX-1 from the venom of Naja naja oxiana by 2D-NMR spectroscopy.
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2004-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1w6bA00
1IK8A 2VLWA 1JE9A 1IDGA 2H7ZA 4OM5A 1G6MA 1QKDA 2MUOA 1KU6B 1LJZA 2GOOB 1CB9A 3U74U 1TXAA 1I02A 2MJ0A 2BHIA 2H8UA 1NYSA 1IDLA 4EY8B 2PJYB 1VB0A 4IYEA 1LX5B 1FSSB 2ERAA 1H0JA 1FASA 1KBAA 3NH7A 1KXIA 1CTXA 1LSIA 2H64C 1KC4A 1FF4A 5EBXA 2K3GA 1M9ZA 1HC9B 1MAHF 1ES7B 2H62D 1TFSA 1ONJA 3KFDI 1V6PA 1BTEA 4RUDA 1KBSA 2JVEA 4XJJA 1JGKA 1NORA 1CDTA 1COEA 1KS6A 5DO6A 2OFSA 1ZADA 2HLQA 5IMYC 2L5SA 2BTXA 1XT3A 1IKCA 1ABTA 1PLOA 1HAAA 1HOYA 1MR6A 1KBTA 1HC9A 1L4WA 1IJCA 3BT1U 1RL5A 1CHVS 2UX2A 2HLRA 1YWHA 1CXOA 2X8BB 3KFDE 4BIKB 2LA1A 3EBXA 3NEQA 4OM4A 3EVSC 2FD6U 4P7UA 1LXGA 4BDTB 4DO8A 2CCXA 2MUPA 1FSCA 4HQPF 3LAQU 3VTSA 2MJ4A 2GOOC 1ERAA 1KL8A 2H5FA 1DRSA 3QB4B 1CDQA 1KFHA 1JBDA 4FAOC 1FRAA 1CCQA 1TGXA 1RGJA 2PJYC 1LXHA 5DZ5A 2QJAC 2UWRA 2J8BA 3ERAA 1QKEA 2H62C 5DU1A 2QC1A 1CVOA 1FFJA 1HAJA 3HH7A 3PLCA 2CTXA 3FEVA 1CODA 2CDXA 1CREA 1NYUA 1CRFA 5IMTD 4AEAA 2MJYA 4LFTA 2I9BE 4QTIU 2L03A 1BXPA 1W6BA 2N99A 1CXNA 2QJ9C 2CRTA 2ABXA 2LCRA 2NBTA 2H64B 6EBXA 2JQPA 1S4YA 3NDSA 1KTZB 4ZQYA 1UG4A 1CDRA 2CRSA 1IQ9A 3U73U 1IDIA 1F8UB 2MHYA 1B41B 3BT2U 1NXBA 1TXBA 2H7ZB 4FAOE 1NEAA 1F94A 4UY2C 1NTNA 1ERGA 1IDHA 1CDSA 1NTXA 1QM7A 2QJBC 1REWC 2MFAA
chains in the Genus database with same CATH superfamily
1IK8A 2VLWA 1JE9A 1IDGA 2H7ZA 4OM5A 1G6MA 1QKDA 2MUOA 1KU6B 1LJZA 2GOOB 1CB9A 3U74U 1TXAA 1I02A 2MJ0A 2BHIA 2H8UA 1NYSA 1IDLA 4EY8B 2PJYB 1VB0A 4IYEA 1LX5B 1FSSB 2ERAA 1H0JA 1FASA 1KBAA 3NH7A 1KXIA 1CTXA 1LSIA 2H64C 1KC4A 1FF4A 5EBXA 2K3GA 1M9ZA 1HC9B 1MAHF 1ES7B 2H62D 1TFSA 1ONJA 3KFDI 1V6PA 1BTEA 4RUDA 1KBSA 2JVEA 4XJJA 1JGKA 1NORA 1CDTA 1COEA 1KS6A 5DO6A 2OFSA 1ZADA 2HLQA 5IMYC 2L5SA 2BTXA 1XT3A 1IKCA 1ABTA 1PLOA 1HAAA 1HOYA 1MR6A 1KBTA 1HC9A 1L4WA 1IJCA 3BT1U 1RL5A 1CHVS 2UX2A 4KSNA 2HLRA 1YWHA 1CXOA 2X8BB 3KFDE 4BIKB 2LA1A 3EBXA 3NEQA 4OM4A 3EVSC 2FD6U 4P7UA 1LXGA 4BDTB 4DO8A 2CCXA 2MUPA 1FSCA 4HQPF 3LAQU 3VTSA 2MJ4A 2GOOC 1ERAA 1KL8A 2H5FA 1DRSA 3QB4B 1CDQA 1KFHA 1JBDA 4FAOC 1FRAA 1CCQA 1TGXA 1RGJA 2PJYC 1LXHA 5DZ5A 2QJAC 2UWRA 2J8BA 3ERAA 1QKEA 2H62C 5DU1A 2QC1A 1CVOA 1FFJA 1HAJA 3HH7A 3PLCA 2CTXA 3FEVA 1CODA 2CDXA 1CREA 1NYUA 1CRFA 5IMTD 4AEAA 2MJYA 4LFTA 2I9BE 4QTIU 2L03A 1BXPA 1W6BA 2N99A 1CXNA 2QJ9C 2CRTA 2ABXA 2LCRA 2NBTA 2H64B 6EBXA 2JQPA 1S4YA 3NDSA 1KTZB 4ZQYA 1UG4A 1CDRA 2CRSA 1IQ9A 3U73U 1IDIA 1F8UB 2MHYA 1B41B 3BT2U 1NXBA 1TXBA 2H7ZB 4FAOE 1NEAA 1F94A 4UY2C 1NTNA 1ERGA 1IDHA 1CDSA 1NTXA 1QM7A 2QJBC 1REWC 2MFAA
chains in the Genus database with same CATH topology
1IK8A 2VLWA 1JE9A 1IDGA 2H7ZA 4OM5A 1G6MA 1QKDA 2MUOA 1KU6B 1LJZA 2GOOB 1CB9A 3U74U 1TXAA 1I02A 2MJ0A 2BHIA 2H8UA 1NYSA 1IDLA 4EY8B 2PJYB 1VB0A 4IYEA 1LX5B 1FSSB 2ERAA 1H0JA 1FASA 1KBAA 3NH7A 1KXIA 1CTXA 1LSIA 2H64C 1KC4A 1FF4A 5EBXA 2K3GA 1M9ZA 1HC9B 1MAHF 1ES7B 2H62D 1TFSA 1ONJA 3KFDI 1V6PA 1BTEA 4RUDA 1KBSA 2JVEA 4XJJA 1JGKA 1NORA 1CDTA 1COEA 1KS6A 5DO6A 2OFSA 1ZADA 2HLQA 5IMYC 2L5SA 2BTXA 1XT3A 1IKCA 1ABTA 1PLOA 1HAAA 1HOYA 1MR6A 1KBTA 1HC9A 1L4WA 1IJCA 3BT1U 1RL5A 1CHVS 2UX2A 4KSNA 2HLRA 1YWHA 1CXOA 2X8BB 3KFDE 4BIKB 2LA1A 3EBXA 3NEQA 4OM4A 3EVSC 2FD6U 4P7UA 1LXGA 4BDTB 4DO8A 2CCXA 2MUPA 1FSCA 4HQPF 3LAQU 3VTSA 2MJ4A 2GOOC 1ERAA 1KL8A 2H5FA 1DRSA 3QB4B 1CDQA 1KFHA 1JBDA 4FAOC 1FRAA 1CCQA 1TGXA 1RGJA 2PJYC 1LXHA 5DZ5A 2QJAC 2UWRA 2J8BA 3ERAA 1QKEA 2H62C 5DU1A 2QC1A 1CVOA 1FFJA 1HAJA 3HH7A 3PLCA 2CTXA 3FEVA 1CODA 2CDXA 1CREA 1NYUA 1CRFA 5IMTD 4AEAA 2MJYA 4LFTA 2I9BE 4QTIU 2L03A 1BXPA 1W6BA 2N99A 1CXNA 2QJ9C 2CRTA 2ABXA 2LCRA 2NBTA 2H64B 6EBXA 2JQPA 1S4YA 3NDSA 1KTZB 4ZQYA 1UG4A 1CDRA 2CRSA 1IQ9A 3U73U 1IDIA 1F8UB 2MHYA 1B41B 3BT2U 1NXBA 1TXBA 2H7ZB 4FAOE 1NEAA 1F94A 4UY2C 1NTNA 1ERGA 1IDHA 1CDSA 1NTXA 1QM7A 2QJBC 1REWC 2MFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IK8 A;  2VLW A;  1JE9 A;  1IDG A;  2H7Z A;  4OM5 A;  1G6M A;  1QKD A;  2MUO A;  1KU6 B;  1LJZ A;  2GOO B;  1CB9 A;  3U74 U;  1TXA A;  1I02 A;  2MJ0 A;  2BHI A;  2H8U A;  1NYS A;  1IDL A;  4EY8 B;  2PJY B;  1VB0 A;  4IYE A;  1LX5 B;  1FSS B;  2ERA A;  1H0J A;  1FAS A;  1KBA A;  3NH7 A;  1KXI A;  1CTX A;  1LSI A;  2H64 C;  1KC4 A;  1FF4 A;  5EBX A;  2K3G A;  1M9Z A;  1HC9 B;  1MAH F;  1ES7 B;  2H62 D;  1TFS A;  1ONJ A;  3KFD I;  1V6P A;  1BTE A;  4RUD A;  1KBS A;  2JVE A;  4XJJ A;  1JGK A;  1NOR A;  1CDT A;  1COE A;  1KS6 A;  5DO6 A;  2OFS A;  1ZAD A;  2HLQ A;  5IMY C;  2L5S A;  2BTX A;  1XT3 A;  1IKC A;  1ABT A;  1PLO A;  1HAA A;  1HOY A;  1MR6 A;  1KBT A;  1HC9 A;  1L4W A;  1IJC A;  3BT1 U;  1RL5 A;  1CHV S;  2UX2 A;  2HLR A;  1YWH A;  1CXO A;  2X8B B;  3KFD E;  4BIK B;  2LA1 A;  3EBX A;  3NEQ A;  4OM4 A;  3EVS C;  2FD6 U;  4P7U A;  1LXG A;  4BDT B;  4DO8 A;  2CCX A;  2MUP A;  1FSC A;  4HQP F;  3LAQ U;  3VTS A;  2MJ4 A;  2GOO C;  1ERA A;  1KL8 A;  2H5F A;  1DRS A;  3QB4 B;  1CDQ A;  1KFH A;  1JBD A;  4FAO C;  1FRA A;  1CCQ A;  1TGX A;  1RGJ A;  2PJY C;  1LXH A;  5DZ5 A;  2QJA C;  2UWR A;  2J8B A;  3ERA A;  1QKE A;  2H62 C;  5DU1 A;  2QC1 A;  1CVO A;  1FFJ A;  1HAJ A;  3HH7 A;  3PLC A;  2CTX A;  3FEV A;  1COD A;  2CDX A;  1CRE A;  1NYU A;  1CRF A;  5IMT D;  4AEA A;  2MJY A;  4LFT A;  2I9B E;  4QTI U;  2L03 A;  1BXP A;  1W6B A;  2N99 A;  1CXN A;  2QJ9 C;  2CRT A;  2ABX A;  2LCR A;  2NBT A;  2H64 B;  6EBX A;  2JQP A;  1S4Y A;  3NDS A;  1KTZ B;  4ZQY A;  1UG4 A;  1CDR A;  2CRS A;  1IQ9 A;  3U73 U;  1IDI A;  1F8U B;  2MHY A;  1B41 B;  3BT2 U;  1NXB A;  1TXB A;  2H7Z B;  4FAO E;  1NEA A;  1F94 A;  4UY2 C;  1NTN A;  1ERG A;  1IDH A;  1CDS A;  1NTX A;  1QM7 A;  2QJB C;  1REW C;  2MFA A; 
#chains in the Genus database with same CATH topology
 1IK8 A;  2VLW A;  1JE9 A;  1IDG A;  2H7Z A;  4OM5 A;  1G6M A;  1QKD A;  2MUO A;  1KU6 B;  1LJZ A;  2GOO B;  1CB9 A;  3U74 U;  1TXA A;  1I02 A;  2MJ0 A;  2BHI A;  2H8U A;  1NYS A;  1IDL A;  4EY8 B;  2PJY B;  1VB0 A;  4IYE A;  1LX5 B;  1FSS B;  2ERA A;  1H0J A;  1FAS A;  1KBA A;  3NH7 A;  1KXI A;  1CTX A;  1LSI A;  2H64 C;  1KC4 A;  1FF4 A;  5EBX A;  2K3G A;  1M9Z A;  1HC9 B;  1MAH F;  1ES7 B;  2H62 D;  1TFS A;  1ONJ A;  3KFD I;  1V6P A;  1BTE A;  4RUD A;  1KBS A;  2JVE A;  4XJJ A;  1JGK A;  1NOR A;  1CDT A;  1COE A;  1KS6 A;  5DO6 A;  2OFS A;  1ZAD A;  2HLQ A;  5IMY C;  2L5S A;  2BTX A;  1XT3 A;  1IKC A;  1ABT A;  1PLO A;  1HAA A;  1HOY A;  1MR6 A;  1KBT A;  1HC9 A;  1L4W A;  1IJC A;  3BT1 U;  1RL5 A;  1CHV S;  2UX2 A;  4KSN A;  2HLR A;  1YWH A;  1CXO A;  2X8B B;  3KFD E;  4BIK B;  2LA1 A;  3EBX A;  3NEQ A;  4OM4 A;  3EVS C;  2FD6 U;  4P7U A;  1LXG A;  4BDT B;  4DO8 A;  2CCX A;  2MUP A;  1FSC A;  4HQP F;  3LAQ U;  3VTS A;  2MJ4 A;  2GOO C;  1ERA A;  1KL8 A;  2H5F A;  1DRS A;  3QB4 B;  1CDQ A;  1KFH A;  1JBD A;  4FAO C;  1FRA A;  1CCQ A;  1TGX A;  1RGJ A;  2PJY C;  1LXH A;  5DZ5 A;  2QJA C;  2UWR A;  2J8B A;  3ERA A;  1QKE A;  2H62 C;  5DU1 A;  2QC1 A;  1CVO A;  1FFJ A;  1HAJ A;  3HH7 A;  3PLC A;  2CTX A;  3FEV A;  1COD A;  2CDX A;  1CRE A;  1NYU A;  1CRF A;  5IMT D;  4AEA A;  2MJY A;  4LFT A;  2I9B E;  4QTI U;  2L03 A;  1BXP A;  1W6B A;  2N99 A;  1CXN A;  2QJ9 C;  2CRT A;  2ABX A;  2LCR A;  2NBT A;  2H64 B;  6EBX A;  2JQP A;  1S4Y A;  3NDS A;  1KTZ B;  4ZQY A;  1UG4 A;  1CDR A;  2CRS A;  1IQ9 A;  3U73 U;  1IDI A;  1F8U B;  2MHY A;  1B41 B;  3BT2 U;  1NXB A;  1TXB A;  2H7Z B;  4FAO E;  1NEA A;  1F94 A;  4UY2 C;  1NTN A;  1ERG A;  1IDH A;  1CDS A;  1NTX A;  1QM7 A;  2QJB C;  1REW C;  2MFA A; 
#chains in the Genus database with same CATH homology
 1IK8 A;  2VLW A;  1JE9 A;  1IDG A;  2H7Z A;  4OM5 A;  1G6M A;  1QKD A;  2MUO A;  1KU6 B;  1LJZ A;  2GOO B;  1CB9 A;  3U74 U;  1TXA A;  1I02 A;  2MJ0 A;  2BHI A;  2H8U A;  1NYS A;  1IDL A;  4EY8 B;  2PJY B;  1VB0 A;  4IYE A;  1LX5 B;  1FSS B;  2ERA A;  1H0J A;  1FAS A;  1KBA A;  3NH7 A;  1KXI A;  1CTX A;  1LSI A;  2H64 C;  1KC4 A;  1FF4 A;  5EBX A;  2K3G A;  1M9Z A;  1HC9 B;  1MAH F;  1ES7 B;  2H62 D;  1TFS A;  1ONJ A;  3KFD I;  1V6P A;  1BTE A;  4RUD A;  1KBS A;  2JVE A;  4XJJ A;  1JGK A;  1NOR A;  1CDT A;  1COE A;  1KS6 A;  5DO6 A;  2OFS A;  1ZAD A;  2HLQ A;  5IMY C;  2L5S A;  2BTX A;  1XT3 A;  1IKC A;  1ABT A;  1PLO A;  1HAA A;  1HOY A;  1MR6 A;  1KBT A;  1HC9 A;  1L4W A;  1IJC A;  3BT1 U;  1RL5 A;  1CHV S;  2UX2 A;  4KSN A;  2HLR A;  1YWH A;  1CXO A;  2X8B B;  3KFD E;  4BIK B;  2LA1 A;  3EBX A;  3NEQ A;  4OM4 A;  3EVS C;  2FD6 U;  4P7U A;  1LXG A;  4BDT B;  4DO8 A;  2CCX A;  2MUP A;  1FSC A;  4HQP F;  3LAQ U;  3VTS A;  2MJ4 A;  2GOO C;  1ERA A;  1KL8 A;  2H5F A;  1DRS A;  3QB4 B;  1CDQ A;  1KFH A;  1JBD A;  4FAO C;  1FRA A;  1CCQ A;  1TGX A;  1RGJ A;  2PJY C;  1LXH A;  5DZ5 A;  2QJA C;  2UWR A;  2J8B A;  3ERA A;  1QKE A;  2H62 C;  5DU1 A;  2QC1 A;  1CVO A;  1FFJ A;  1HAJ A;  3HH7 A;  3PLC A;  2CTX A;  3FEV A;  1COD A;  2CDX A;  1CRE A;  1NYU A;  1CRF A;  5IMT D;  4AEA A;  2MJY A;  4LFT A;  2I9B E;  4QTI U;  2L03 A;  1BXP A;  1W6B A;  2N99 A;  1CXN A;  2QJ9 C;  2CRT A;  2ABX A;  2LCR A;  2NBT A;  2H64 B;  6EBX A;  2JQP A;  1S4Y A;  3NDS A;  1KTZ B;  4ZQY A;  1UG4 A;  1CDR A;  2CRS A;  1IQ9 A;  3U73 U;  1IDI A;  1F8U B;  2MHY A;  1B41 B;  3BT2 U;  1NXB A;  1TXB A;  2H7Z B;  4FAO E;  1NEA A;  1F94 A;  4UY2 C;  1NTN A;  1ERG A;  1IDH A;  1CDS A;  1NTX A;  1QM7 A;  2QJB C;  1REW C;  2MFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...