2GOOC

Ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
92
structure length
92
Chain Sequence
TQECLFFNANWERDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCIEKKDSPEVYFCCCEGNMCNEKFSYFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Bone morphogenetic protein 2
publication title Structure of the ternary signaling complex of a TGF-beta superfamily member.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 92
sequence length 92
chains with identical sequence F
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2gooC00
1W6BA 1MR6A 2MJYA 1F8UB 4AEAA 2UX2A 2CRTA 2MHYA 1V6PA 3QB4B 1FASA 2MUOA 1HAJA 1ERGA 1FSSB 1G6MA 1KFHA 1TXAA 1ES7B 1CCQA 1QM7A 2K3GA 4BIKB 1KC4A 2GOOC 2BHIA 2CRSA 2MJ0A 2JQPA 1M9ZA 1BXPA 1NTXA 1HOYA 1CDSA 5IMTD 2QJ9C 1IDGA 1YWHA 1QKEA 4P7UA 2HLRA 2BTXA 1DRSA 1CODA 1NYSA 2LCRA 1CXOA 2ERAA 2H64B 1KTZB 1KBTA 2L03A 1ZADA 1TGXA 2FD6U 2JVEA 2VLWA 5DO6A 2ABXA 1LXHA 2H62C 2H5FA 3EVSC 3NEQA 4OM5A 3KFDE 2CTXA 1FRAA 5DZ5A 1RGJA 1LSIA 1HAAA 3PLCA 1TXBA 3HH7A 1TFSA 3LAQU 1ERAA 3ERAA 1IDHA 4UY2C 1B41B 1KL8A 1NYUA 1F94A 1IDLA 6EBXA 1QKDA 1KBAA 1JE9A 1IQ9A 3BT2U 2H64C 1CB9A 2UWRA 2MFAA 4FAOE 5EBXA 1FF4A 1FSCA 1VB0A 3NH7A 1LJZA 1COEA 2LA1A 1I02A 1H0JA 2NBTA 4ZQYA 2H7ZB 2CCXA 1MAHF 1KU6B 1CXNA 1IDIA 1CDQA 1BTEA 1CDRA 3U73U 2L5SA 1IK8A 2N99A 4DO8A 4QTIU 1REWC 4HQPF 2MUPA 1CHVS 1PLOA 2I9BE 1CREA 1S4YA 1CTXA 3FEVA 5IMYC 2MJ4A 3BT1U 1JGKA 1ABTA 1KBSA 2J8BA 2QJBC 1HC9B 1ONJA 4IYEA 2H8UA 5DU1A 2H62D 3U74U 2X8BB 1KS6A 2OFSA 2PJYC 1CDTA 2PJYB 1NEAA 1JBDA 3EBXA 1NTNA 3NDSA 1LXGA 2GOOB 1NORA 3KFDI 4LFTA 1FFJA 1NXBA 4RUDA 1KXIA 3VTSA 4FAOC 1UG4A 2HLQA 4EY8B 2QJAC 1L4WA 1IJCA 4BDTB 2CDXA 2QC1A 1HC9A 1IKCA 1RL5A 4OM4A 1CRFA 1LX5B 4XJJA 1CVOA 1XT3A 2H7ZA
chains in the Genus database with same CATH superfamily
1W6BA 1MR6A 2MJYA 1F8UB 4AEAA 2UX2A 2CRTA 2MHYA 1V6PA 3QB4B 1FASA 2MUOA 1HAJA 1ERGA 1FSSB 1G6MA 1KFHA 1TXAA 1ES7B 1CCQA 1QM7A 2K3GA 4BIKB 1KC4A 2GOOC 2BHIA 2CRSA 2MJ0A 2JQPA 1M9ZA 1BXPA 1NTXA 1HOYA 1CDSA 5IMTD 2QJ9C 1IDGA 1YWHA 1QKEA 4P7UA 2HLRA 2BTXA 1DRSA 1CODA 1NYSA 2LCRA 1CXOA 2ERAA 2H64B 1KTZB 1KBTA 2L03A 1ZADA 1TGXA 2FD6U 2JVEA 2VLWA 5DO6A 2ABXA 1LXHA 2H62C 2H5FA 3EVSC 3NEQA 4OM5A 3KFDE 2CTXA 1FRAA 5DZ5A 1RGJA 1LSIA 1HAAA 3PLCA 1TXBA 3HH7A 1TFSA 3LAQU 1ERAA 3ERAA 1IDHA 4UY2C 1B41B 1KL8A 1NYUA 1F94A 1IDLA 6EBXA 1QKDA 1KBAA 1JE9A 1IQ9A 3BT2U 2H64C 1CB9A 2UWRA 2MFAA 4FAOE 5EBXA 1FF4A 1FSCA 1VB0A 3NH7A 1LJZA 1COEA 2LA1A 1I02A 1H0JA 2NBTA 4ZQYA 2H7ZB 2CCXA 1MAHF 1KU6B 1CXNA 1IDIA 1CDQA 1BTEA 1CDRA 3U73U 2L5SA 1IK8A 2N99A 4DO8A 4QTIU 1REWC 4HQPF 2MUPA 1CHVS 1PLOA 2I9BE 1CREA 1S4YA 1CTXA 3FEVA 5IMYC 2MJ4A 3BT1U 1JGKA 1ABTA 1KBSA 2J8BA 2QJBC 1HC9B 1ONJA 4IYEA 2H8UA 5DU1A 2H62D 3U74U 2X8BB 1KS6A 2OFSA 2PJYC 1CDTA 2PJYB 1NEAA 1JBDA 3EBXA 1NTNA 3NDSA 1LXGA 2GOOB 1NORA 3KFDI 4LFTA 1FFJA 1NXBA 4RUDA 1KXIA 3VTSA 4FAOC 1UG4A 2HLQA 4EY8B 2QJAC 1L4WA 1IJCA 4BDTB 2CDXA 2QC1A 1HC9A 1IKCA 1RL5A 4OM4A 1CRFA 4KSNA 1LX5B 4XJJA 1CVOA 1XT3A 2H7ZA
chains in the Genus database with same CATH topology
1W6BA 1MR6A 2MJYA 1F8UB 4AEAA 2UX2A 2CRTA 2MHYA 1V6PA 3QB4B 1FASA 2MUOA 1HAJA 1ERGA 1FSSB 1G6MA 1KFHA 1TXAA 1ES7B 1CCQA 1QM7A 2K3GA 4BIKB 1KC4A 2GOOC 2BHIA 2CRSA 2MJ0A 2JQPA 1M9ZA 1BXPA 1NTXA 1HOYA 1CDSA 5IMTD 2QJ9C 1IDGA 1YWHA 1QKEA 4P7UA 2HLRA 2BTXA 1DRSA 1CODA 1NYSA 2LCRA 1CXOA 2ERAA 2H64B 1KTZB 1KBTA 2L03A 1ZADA 1TGXA 2FD6U 2JVEA 2VLWA 5DO6A 2ABXA 1LXHA 2H62C 2H5FA 3EVSC 3NEQA 4OM5A 3KFDE 2CTXA 1FRAA 5DZ5A 1RGJA 1LSIA 1HAAA 3PLCA 1TXBA 3HH7A 1TFSA 3LAQU 1ERAA 3ERAA 1IDHA 4UY2C 1B41B 1KL8A 1NYUA 1F94A 1IDLA 6EBXA 1QKDA 1KBAA 1JE9A 1IQ9A 3BT2U 2H64C 1CB9A 2UWRA 2MFAA 4FAOE 5EBXA 1FF4A 1FSCA 1VB0A 3NH7A 1LJZA 1COEA 2LA1A 1I02A 1H0JA 2NBTA 4ZQYA 2H7ZB 2CCXA 1MAHF 1KU6B 1CXNA 1IDIA 1CDQA 1BTEA 1CDRA 3U73U 2L5SA 1IK8A 2N99A 4DO8A 4QTIU 1REWC 4HQPF 2MUPA 1CHVS 1PLOA 2I9BE 1CREA 1S4YA 1CTXA 3FEVA 5IMYC 2MJ4A 3BT1U 1JGKA 1ABTA 1KBSA 2J8BA 2QJBC 1HC9B 1ONJA 4IYEA 2H8UA 5DU1A 2H62D 3U74U 2X8BB 1KS6A 2OFSA 2PJYC 1CDTA 2PJYB 1NEAA 1JBDA 3EBXA 1NTNA 3NDSA 1LXGA 2GOOB 1NORA 3KFDI 4LFTA 1FFJA 1NXBA 4RUDA 1KXIA 3VTSA 4FAOC 1UG4A 2HLQA 4EY8B 2QJAC 1L4WA 1IJCA 4BDTB 2CDXA 2QC1A 1HC9A 1IKCA 1RL5A 4OM4A 1CRFA 4KSNA 1LX5B 4XJJA 1CVOA 1XT3A 2H7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W6B A;  1MR6 A;  2MJY A;  1F8U B;  4AEA A;  2UX2 A;  2CRT A;  2MHY A;  1V6P A;  3QB4 B;  1FAS A;  2MUO A;  1HAJ A;  1ERG A;  1FSS B;  1G6M A;  1KFH A;  1TXA A;  1ES7 B;  1CCQ A;  1QM7 A;  2K3G A;  4BIK B;  1KC4 A;  2GOO C;  2BHI A;  2CRS A;  2MJ0 A;  2JQP A;  1M9Z A;  1BXP A;  1NTX A;  1HOY A;  1CDS A;  5IMT D;  2QJ9 C;  1IDG A;  1YWH A;  1QKE A;  4P7U A;  2HLR A;  2BTX A;  1DRS A;  1COD A;  1NYS A;  2LCR A;  1CXO A;  2ERA A;  2H64 B;  1KTZ B;  1KBT A;  2L03 A;  1ZAD A;  1TGX A;  2FD6 U;  2JVE A;  2VLW A;  5DO6 A;  2ABX A;  1LXH A;  2H62 C;  2H5F A;  3EVS C;  3NEQ A;  4OM5 A;  3KFD E;  2CTX A;  1FRA A;  5DZ5 A;  1RGJ A;  1LSI A;  1HAA A;  3PLC A;  1TXB A;  3HH7 A;  1TFS A;  3LAQ U;  1ERA A;  3ERA A;  1IDH A;  4UY2 C;  1B41 B;  1KL8 A;  1NYU A;  1F94 A;  1IDL A;  6EBX A;  1QKD A;  1KBA A;  1JE9 A;  1IQ9 A;  3BT2 U;  2H64 C;  1CB9 A;  2UWR A;  2MFA A;  4FAO E;  5EBX A;  1FF4 A;  1FSC A;  1VB0 A;  3NH7 A;  1LJZ A;  1COE A;  2LA1 A;  1I02 A;  1H0J A;  2NBT A;  4ZQY A;  2H7Z B;  2CCX A;  1MAH F;  1KU6 B;  1CXN A;  1IDI A;  1CDQ A;  1BTE A;  1CDR A;  3U73 U;  2L5S A;  1IK8 A;  2N99 A;  4DO8 A;  4QTI U;  1REW C;  4HQP F;  2MUP A;  1CHV S;  1PLO A;  2I9B E;  1CRE A;  1S4Y A;  1CTX A;  3FEV A;  5IMY C;  2MJ4 A;  3BT1 U;  1JGK A;  1ABT A;  1KBS A;  2J8B A;  2QJB C;  1HC9 B;  1ONJ A;  4IYE A;  2H8U A;  5DU1 A;  2H62 D;  3U74 U;  2X8B B;  1KS6 A;  2OFS A;  2PJY C;  1CDT A;  2PJY B;  1NEA A;  1JBD A;  3EBX A;  1NTN A;  3NDS A;  1LXG A;  2GOO B;  1NOR A;  3KFD I;  4LFT A;  1FFJ A;  1NXB A;  4RUD A;  1KXI A;  3VTS A;  4FAO C;  1UG4 A;  2HLQ A;  4EY8 B;  2QJA C;  1L4W A;  1IJC A;  4BDT B;  2CDX A;  2QC1 A;  1HC9 A;  1IKC A;  1RL5 A;  4OM4 A;  1CRF A;  1LX5 B;  4XJJ A;  1CVO A;  1XT3 A;  2H7Z A; 
#chains in the Genus database with same CATH topology
 1W6B A;  1MR6 A;  2MJY A;  1F8U B;  4AEA A;  2UX2 A;  2CRT A;  2MHY A;  1V6P A;  3QB4 B;  1FAS A;  2MUO A;  1HAJ A;  1ERG A;  1FSS B;  1G6M A;  1KFH A;  1TXA A;  1ES7 B;  1CCQ A;  1QM7 A;  2K3G A;  4BIK B;  1KC4 A;  2GOO C;  2BHI A;  2CRS A;  2MJ0 A;  2JQP A;  1M9Z A;  1BXP A;  1NTX A;  1HOY A;  1CDS A;  5IMT D;  2QJ9 C;  1IDG A;  1YWH A;  1QKE A;  4P7U A;  2HLR A;  2BTX A;  1DRS A;  1COD A;  1NYS A;  2LCR A;  1CXO A;  2ERA A;  2H64 B;  1KTZ B;  1KBT A;  2L03 A;  1ZAD A;  1TGX A;  2FD6 U;  2JVE A;  2VLW A;  5DO6 A;  2ABX A;  1LXH A;  2H62 C;  2H5F A;  3EVS C;  3NEQ A;  4OM5 A;  3KFD E;  2CTX A;  1FRA A;  5DZ5 A;  1RGJ A;  1LSI A;  1HAA A;  3PLC A;  1TXB A;  3HH7 A;  1TFS A;  3LAQ U;  1ERA A;  3ERA A;  1IDH A;  4UY2 C;  1B41 B;  1KL8 A;  1NYU A;  1F94 A;  1IDL A;  6EBX A;  1QKD A;  1KBA A;  1JE9 A;  1IQ9 A;  3BT2 U;  2H64 C;  1CB9 A;  2UWR A;  2MFA A;  4FAO E;  5EBX A;  1FF4 A;  1FSC A;  1VB0 A;  3NH7 A;  1LJZ A;  1COE A;  2LA1 A;  1I02 A;  1H0J A;  2NBT A;  4ZQY A;  2H7Z B;  2CCX A;  1MAH F;  1KU6 B;  1CXN A;  1IDI A;  1CDQ A;  1BTE A;  1CDR A;  3U73 U;  2L5S A;  1IK8 A;  2N99 A;  4DO8 A;  4QTI U;  1REW C;  4HQP F;  2MUP A;  1CHV S;  1PLO A;  2I9B E;  1CRE A;  1S4Y A;  1CTX A;  3FEV A;  5IMY C;  2MJ4 A;  3BT1 U;  1JGK A;  1ABT A;  1KBS A;  2J8B A;  2QJB C;  1HC9 B;  1ONJ A;  4IYE A;  2H8U A;  5DU1 A;  2H62 D;  3U74 U;  2X8B B;  1KS6 A;  2OFS A;  2PJY C;  1CDT A;  2PJY B;  1NEA A;  1JBD A;  3EBX A;  1NTN A;  3NDS A;  1LXG A;  2GOO B;  1NOR A;  3KFD I;  4LFT A;  1FFJ A;  1NXB A;  4RUD A;  1KXI A;  3VTS A;  4FAO C;  1UG4 A;  2HLQ A;  4EY8 B;  2QJA C;  1L4W A;  1IJC A;  4BDT B;  2CDX A;  2QC1 A;  1HC9 A;  1IKC A;  1RL5 A;  4OM4 A;  1CRF A;  4KSN A;  1LX5 B;  4XJJ A;  1CVO A;  1XT3 A;  2H7Z A; 
#chains in the Genus database with same CATH homology
 1W6B A;  1MR6 A;  2MJY A;  1F8U B;  4AEA A;  2UX2 A;  2CRT A;  2MHY A;  1V6P A;  3QB4 B;  1FAS A;  2MUO A;  1HAJ A;  1ERG A;  1FSS B;  1G6M A;  1KFH A;  1TXA A;  1ES7 B;  1CCQ A;  1QM7 A;  2K3G A;  4BIK B;  1KC4 A;  2GOO C;  2BHI A;  2CRS A;  2MJ0 A;  2JQP A;  1M9Z A;  1BXP A;  1NTX A;  1HOY A;  1CDS A;  5IMT D;  2QJ9 C;  1IDG A;  1YWH A;  1QKE A;  4P7U A;  2HLR A;  2BTX A;  1DRS A;  1COD A;  1NYS A;  2LCR A;  1CXO A;  2ERA A;  2H64 B;  1KTZ B;  1KBT A;  2L03 A;  1ZAD A;  1TGX A;  2FD6 U;  2JVE A;  2VLW A;  5DO6 A;  2ABX A;  1LXH A;  2H62 C;  2H5F A;  3EVS C;  3NEQ A;  4OM5 A;  3KFD E;  2CTX A;  1FRA A;  5DZ5 A;  1RGJ A;  1LSI A;  1HAA A;  3PLC A;  1TXB A;  3HH7 A;  1TFS A;  3LAQ U;  1ERA A;  3ERA A;  1IDH A;  4UY2 C;  1B41 B;  1KL8 A;  1NYU A;  1F94 A;  1IDL A;  6EBX A;  1QKD A;  1KBA A;  1JE9 A;  1IQ9 A;  3BT2 U;  2H64 C;  1CB9 A;  2UWR A;  2MFA A;  4FAO E;  5EBX A;  1FF4 A;  1FSC A;  1VB0 A;  3NH7 A;  1LJZ A;  1COE A;  2LA1 A;  1I02 A;  1H0J A;  2NBT A;  4ZQY A;  2H7Z B;  2CCX A;  1MAH F;  1KU6 B;  1CXN A;  1IDI A;  1CDQ A;  1BTE A;  1CDR A;  3U73 U;  2L5S A;  1IK8 A;  2N99 A;  4DO8 A;  4QTI U;  1REW C;  4HQP F;  2MUP A;  1CHV S;  1PLO A;  2I9B E;  1CRE A;  1S4Y A;  1CTX A;  3FEV A;  5IMY C;  2MJ4 A;  3BT1 U;  1JGK A;  1ABT A;  1KBS A;  2J8B A;  2QJB C;  1HC9 B;  1ONJ A;  4IYE A;  2H8U A;  5DU1 A;  2H62 D;  3U74 U;  2X8B B;  1KS6 A;  2OFS A;  2PJY C;  1CDT A;  2PJY B;  1NEA A;  1JBD A;  3EBX A;  1NTN A;  3NDS A;  1LXG A;  2GOO B;  1NOR A;  3KFD I;  4LFT A;  1FFJ A;  1NXB A;  4RUD A;  1KXI A;  3VTS A;  4FAO C;  1UG4 A;  2HLQ A;  4EY8 B;  2QJA C;  1L4W A;  1IJC A;  4BDT B;  2CDX A;  2QC1 A;  1HC9 A;  1IKC A;  1RL5 A;  4OM4 A;  1CRF A;  4KSN A;  1LX5 B;  4XJJ A;  1CVO A;  1XT3 A;  2H7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...