4XJJA

Extracellular domain of type ii transforming growth factor beta receptor in complex with 2-(2-hydroxyethyl)ndsb-201
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
105
structure length
105
Chain Sequence
ALCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPTCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine receptor
molecule keywords TGF-beta receptor type-2
publication title Extracellular domain of type II Transforming Growth Factor Beta receptor in complex with 2-(2-Hydroxyethyl)NDSB-201
rcsb
source organism Homo sapiens
total genus 24
structure length 105
sequence length 105
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2015-01-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4xjjA00
4OM5A 2H62D 2H5FA 1JBDA 3KFDI 1YWHA 1KBSA 1NYSA 1ERAA 1KBTA 1QM7A 1FFJA 1JE9A 2BTXA 2GOOB 2CCXA 2H62C 2PJYB 2UX2A 1BTEA 2H64C 4HQPF 1IQ9A 1B41B 1IDLA 5DZ5A 2QJAC 1H0JA 2J8BA 2JQPA 4UY2C 1CXOA 1LXGA 1IDIA 2QJ9C 4BIKB 1NTNA 1ERGA 2ABXA 2ERAA 4BDTB 1NORA 3U73U 1MAHF 3FEVA 1NXBA 2CRSA 1FASA 1CTXA 1VB0A 2MHYA 1REWC 1IDHA 2CDXA 3NDSA 2OFSA 1CDTA 1IKCA 1JGKA 4EY8B 3HH7A 1RL5A 1FRAA 2QC1A 1KFHA 2UWRA 1CDQA 2X8BB 2GOOC 4AEAA 3BT2U 4RUDA 1NTXA 1QKDA 3NEQA 2CTXA 1HAAA 2H7ZB 1HC9B 2N99A 6EBXA 3KFDE 3QB4B 5DU1A 5IMTD 3LAQU 4XJJA 1ABTA 1NYUA 1V6PA 1FSSB 2JVEA 2MFAA 1ES7B 1TXBA 4IYEA 2MUPA 1FSCA 1KBAA 2L03A 1HOYA 2LA1A 3VTSA 2I9BE 1L4WA 2MUOA 1LX5B 1RGJA 3BT1U 4ZQYA 2MJ0A 1XT3A 1G6MA 1IDGA 1KXIA 2H64B 1COEA 4OM4A 1LJZA 1UG4A 1IJCA 1CODA 4DO8A 1CVOA 2PJYC 1TXAA 2BHIA 1KS6A 2LCRA 1CB9A 1ZADA 1S4YA 1W6BA 2MJYA 1CXNA 5DO6A 2H7ZA 2FD6U 1LXHA 1HC9A 1KL8A 4FAOE 1KU6B 2QJBC 1M9ZA 4FAOC 1BXPA 2HLRA 1LSIA 1PLOA 1I02A 1CDRA 2NBTA 1NEAA 1MR6A 2HLQA 3ERAA 3U74U 5EBXA 1CREA 1KTZB 3NH7A 2K3GA 1CHVS 1F94A 4QTIU 1ONJA 3EBXA 2CRTA 1HAJA 1CCQA 3PLCA 5IMYC 2H8UA 2VLWA 2MJ4A 1DRSA 1IK8A 1QKEA 1KC4A 4LFTA 1TGXA 1CDSA 1CRFA 1TFSA 2L5SA 4P7UA 3EVSC 1FF4A 1F8UB
chains in the Genus database with same CATH superfamily
4OM5A 2H62D 2H5FA 1JBDA 3KFDI 1YWHA 1KBSA 1NYSA 1ERAA 1KBTA 1QM7A 1FFJA 1JE9A 2BTXA 2GOOB 2CCXA 2H62C 2PJYB 2UX2A 1BTEA 2H64C 4HQPF 1IQ9A 1B41B 1IDLA 5DZ5A 2QJAC 1H0JA 2J8BA 2JQPA 4UY2C 4KSNA 1CXOA 1LXGA 1IDIA 2QJ9C 4BIKB 1NTNA 1ERGA 2ABXA 2ERAA 4BDTB 1NORA 3U73U 1MAHF 3FEVA 1NXBA 2CRSA 1FASA 1CTXA 1VB0A 2MHYA 1REWC 1IDHA 2CDXA 3NDSA 2OFSA 1CDTA 1IKCA 1JGKA 4EY8B 3HH7A 1RL5A 1FRAA 2QC1A 1KFHA 2UWRA 1CDQA 2X8BB 2GOOC 4AEAA 3BT2U 4RUDA 1NTXA 1QKDA 3NEQA 2CTXA 1HAAA 2H7ZB 1HC9B 2N99A 6EBXA 3KFDE 3QB4B 5DU1A 5IMTD 3LAQU 4XJJA 1ABTA 1NYUA 1V6PA 1FSSB 2JVEA 2MFAA 1ES7B 1TXBA 4IYEA 2MUPA 1FSCA 1KBAA 2L03A 1HOYA 2LA1A 3VTSA 2I9BE 1L4WA 2MUOA 1LX5B 1RGJA 3BT1U 4ZQYA 2MJ0A 1XT3A 1G6MA 1IDGA 1KXIA 2H64B 1COEA 4OM4A 1LJZA 1UG4A 1IJCA 1CODA 4DO8A 1CVOA 2PJYC 1TXAA 2BHIA 1KS6A 2LCRA 1CB9A 1ZADA 1S4YA 1W6BA 2MJYA 1CXNA 5DO6A 2H7ZA 2FD6U 1LXHA 1HC9A 1KL8A 4FAOE 1KU6B 2QJBC 1M9ZA 4FAOC 1BXPA 2HLRA 1LSIA 1PLOA 1I02A 1CDRA 2NBTA 1NEAA 1MR6A 2HLQA 3ERAA 3U74U 5EBXA 1CREA 1KTZB 3NH7A 2K3GA 1CHVS 1F94A 4QTIU 1ONJA 3EBXA 2CRTA 1HAJA 1CCQA 3PLCA 5IMYC 2H8UA 2VLWA 2MJ4A 1DRSA 1IK8A 1QKEA 1KC4A 4LFTA 1TGXA 1CDSA 1CRFA 1TFSA 2L5SA 4P7UA 3EVSC 1FF4A 1F8UB
chains in the Genus database with same CATH topology
4OM5A 2H62D 2H5FA 1JBDA 3KFDI 1YWHA 1KBSA 1NYSA 1ERAA 1KBTA 1QM7A 1FFJA 1JE9A 2BTXA 2GOOB 2CCXA 2H62C 2PJYB 2UX2A 1BTEA 2H64C 4HQPF 1IQ9A 1B41B 1IDLA 5DZ5A 2QJAC 1H0JA 2J8BA 2JQPA 4UY2C 4KSNA 1CXOA 1LXGA 1IDIA 2QJ9C 4BIKB 1NTNA 1ERGA 2ABXA 2ERAA 4BDTB 1NORA 3U73U 1MAHF 3FEVA 1NXBA 2CRSA 1FASA 1CTXA 1VB0A 2MHYA 1REWC 1IDHA 2CDXA 3NDSA 2OFSA 1CDTA 1IKCA 1JGKA 4EY8B 3HH7A 1RL5A 1FRAA 2QC1A 1KFHA 2UWRA 1CDQA 2X8BB 2GOOC 4AEAA 3BT2U 4RUDA 1NTXA 1QKDA 3NEQA 2CTXA 1HAAA 2H7ZB 1HC9B 2N99A 6EBXA 3KFDE 3QB4B 5DU1A 5IMTD 3LAQU 4XJJA 1ABTA 1NYUA 1V6PA 1FSSB 2JVEA 2MFAA 1ES7B 1TXBA 4IYEA 2MUPA 1FSCA 1KBAA 2L03A 1HOYA 2LA1A 3VTSA 2I9BE 1L4WA 2MUOA 1LX5B 1RGJA 3BT1U 4ZQYA 2MJ0A 1XT3A 1G6MA 1IDGA 1KXIA 2H64B 1COEA 4OM4A 1LJZA 1UG4A 1IJCA 1CODA 4DO8A 1CVOA 2PJYC 1TXAA 2BHIA 1KS6A 2LCRA 1CB9A 1ZADA 1S4YA 1W6BA 2MJYA 1CXNA 5DO6A 2H7ZA 2FD6U 1LXHA 1HC9A 1KL8A 4FAOE 1KU6B 2QJBC 1M9ZA 4FAOC 1BXPA 2HLRA 1LSIA 1PLOA 1I02A 1CDRA 2NBTA 1NEAA 1MR6A 2HLQA 3ERAA 3U74U 5EBXA 1CREA 1KTZB 3NH7A 2K3GA 1CHVS 1F94A 4QTIU 1ONJA 3EBXA 2CRTA 1HAJA 1CCQA 3PLCA 5IMYC 2H8UA 2VLWA 2MJ4A 1DRSA 1IK8A 1QKEA 1KC4A 4LFTA 1TGXA 1CDSA 1CRFA 1TFSA 2L5SA 4P7UA 3EVSC 1FF4A 1F8UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OM5 A;  2H62 D;  2H5F A;  1JBD A;  3KFD I;  1YWH A;  1KBS A;  1NYS A;  1ERA A;  1KBT A;  1QM7 A;  1FFJ A;  1JE9 A;  2BTX A;  2GOO B;  2CCX A;  2H62 C;  2PJY B;  2UX2 A;  1BTE A;  2H64 C;  4HQP F;  1IQ9 A;  1B41 B;  1IDL A;  5DZ5 A;  2QJA C;  1H0J A;  2J8B A;  2JQP A;  4UY2 C;  1CXO A;  1LXG A;  1IDI A;  2QJ9 C;  4BIK B;  1NTN A;  1ERG A;  2ABX A;  2ERA A;  4BDT B;  1NOR A;  3U73 U;  1MAH F;  3FEV A;  1NXB A;  2CRS A;  1FAS A;  1CTX A;  1VB0 A;  2MHY A;  1REW C;  1IDH A;  2CDX A;  3NDS A;  2OFS A;  1CDT A;  1IKC A;  1JGK A;  4EY8 B;  3HH7 A;  1RL5 A;  1FRA A;  2QC1 A;  1KFH A;  2UWR A;  1CDQ A;  2X8B B;  2GOO C;  4AEA A;  3BT2 U;  4RUD A;  1NTX A;  1QKD A;  3NEQ A;  2CTX A;  1HAA A;  2H7Z B;  1HC9 B;  2N99 A;  6EBX A;  3KFD E;  3QB4 B;  5DU1 A;  5IMT D;  3LAQ U;  4XJJ A;  1ABT A;  1NYU A;  1V6P A;  1FSS B;  2JVE A;  2MFA A;  1ES7 B;  1TXB A;  4IYE A;  2MUP A;  1FSC A;  1KBA A;  2L03 A;  1HOY A;  2LA1 A;  3VTS A;  2I9B E;  1L4W A;  2MUO A;  1LX5 B;  1RGJ A;  3BT1 U;  4ZQY A;  2MJ0 A;  1XT3 A;  1G6M A;  1IDG A;  1KXI A;  2H64 B;  1COE A;  4OM4 A;  1LJZ A;  1UG4 A;  1IJC A;  1COD A;  4DO8 A;  1CVO A;  2PJY C;  1TXA A;  2BHI A;  1KS6 A;  2LCR A;  1CB9 A;  1ZAD A;  1S4Y A;  1W6B A;  2MJY A;  1CXN A;  5DO6 A;  2H7Z A;  2FD6 U;  1LXH A;  1HC9 A;  1KL8 A;  4FAO E;  1KU6 B;  2QJB C;  1M9Z A;  4FAO C;  1BXP A;  2HLR A;  1LSI A;  1PLO A;  1I02 A;  1CDR A;  2NBT A;  1NEA A;  1MR6 A;  2HLQ A;  3ERA A;  3U74 U;  5EBX A;  1CRE A;  1KTZ B;  3NH7 A;  2K3G A;  1CHV S;  1F94 A;  4QTI U;  1ONJ A;  3EBX A;  2CRT A;  1HAJ A;  1CCQ A;  3PLC A;  5IMY C;  2H8U A;  2VLW A;  2MJ4 A;  1DRS A;  1IK8 A;  1QKE A;  1KC4 A;  4LFT A;  1TGX A;  1CDS A;  1CRF A;  1TFS A;  2L5S A;  4P7U A;  3EVS C;  1FF4 A;  1F8U B; 
#chains in the Genus database with same CATH topology
 4OM5 A;  2H62 D;  2H5F A;  1JBD A;  3KFD I;  1YWH A;  1KBS A;  1NYS A;  1ERA A;  1KBT A;  1QM7 A;  1FFJ A;  1JE9 A;  2BTX A;  2GOO B;  2CCX A;  2H62 C;  2PJY B;  2UX2 A;  1BTE A;  2H64 C;  4HQP F;  1IQ9 A;  1B41 B;  1IDL A;  5DZ5 A;  2QJA C;  1H0J A;  2J8B A;  2JQP A;  4UY2 C;  4KSN A;  1CXO A;  1LXG A;  1IDI A;  2QJ9 C;  4BIK B;  1NTN A;  1ERG A;  2ABX A;  2ERA A;  4BDT B;  1NOR A;  3U73 U;  1MAH F;  3FEV A;  1NXB A;  2CRS A;  1FAS A;  1CTX A;  1VB0 A;  2MHY A;  1REW C;  1IDH A;  2CDX A;  3NDS A;  2OFS A;  1CDT A;  1IKC A;  1JGK A;  4EY8 B;  3HH7 A;  1RL5 A;  1FRA A;  2QC1 A;  1KFH A;  2UWR A;  1CDQ A;  2X8B B;  2GOO C;  4AEA A;  3BT2 U;  4RUD A;  1NTX A;  1QKD A;  3NEQ A;  2CTX A;  1HAA A;  2H7Z B;  1HC9 B;  2N99 A;  6EBX A;  3KFD E;  3QB4 B;  5DU1 A;  5IMT D;  3LAQ U;  4XJJ A;  1ABT A;  1NYU A;  1V6P A;  1FSS B;  2JVE A;  2MFA A;  1ES7 B;  1TXB A;  4IYE A;  2MUP A;  1FSC A;  1KBA A;  2L03 A;  1HOY A;  2LA1 A;  3VTS A;  2I9B E;  1L4W A;  2MUO A;  1LX5 B;  1RGJ A;  3BT1 U;  4ZQY A;  2MJ0 A;  1XT3 A;  1G6M A;  1IDG A;  1KXI A;  2H64 B;  1COE A;  4OM4 A;  1LJZ A;  1UG4 A;  1IJC A;  1COD A;  4DO8 A;  1CVO A;  2PJY C;  1TXA A;  2BHI A;  1KS6 A;  2LCR A;  1CB9 A;  1ZAD A;  1S4Y A;  1W6B A;  2MJY A;  1CXN A;  5DO6 A;  2H7Z A;  2FD6 U;  1LXH A;  1HC9 A;  1KL8 A;  4FAO E;  1KU6 B;  2QJB C;  1M9Z A;  4FAO C;  1BXP A;  2HLR A;  1LSI A;  1PLO A;  1I02 A;  1CDR A;  2NBT A;  1NEA A;  1MR6 A;  2HLQ A;  3ERA A;  3U74 U;  5EBX A;  1CRE A;  1KTZ B;  3NH7 A;  2K3G A;  1CHV S;  1F94 A;  4QTI U;  1ONJ A;  3EBX A;  2CRT A;  1HAJ A;  1CCQ A;  3PLC A;  5IMY C;  2H8U A;  2VLW A;  2MJ4 A;  1DRS A;  1IK8 A;  1QKE A;  1KC4 A;  4LFT A;  1TGX A;  1CDS A;  1CRF A;  1TFS A;  2L5S A;  4P7U A;  3EVS C;  1FF4 A;  1F8U B; 
#chains in the Genus database with same CATH homology
 4OM5 A;  2H62 D;  2H5F A;  1JBD A;  3KFD I;  1YWH A;  1KBS A;  1NYS A;  1ERA A;  1KBT A;  1QM7 A;  1FFJ A;  1JE9 A;  2BTX A;  2GOO B;  2CCX A;  2H62 C;  2PJY B;  2UX2 A;  1BTE A;  2H64 C;  4HQP F;  1IQ9 A;  1B41 B;  1IDL A;  5DZ5 A;  2QJA C;  1H0J A;  2J8B A;  2JQP A;  4UY2 C;  4KSN A;  1CXO A;  1LXG A;  1IDI A;  2QJ9 C;  4BIK B;  1NTN A;  1ERG A;  2ABX A;  2ERA A;  4BDT B;  1NOR A;  3U73 U;  1MAH F;  3FEV A;  1NXB A;  2CRS A;  1FAS A;  1CTX A;  1VB0 A;  2MHY A;  1REW C;  1IDH A;  2CDX A;  3NDS A;  2OFS A;  1CDT A;  1IKC A;  1JGK A;  4EY8 B;  3HH7 A;  1RL5 A;  1FRA A;  2QC1 A;  1KFH A;  2UWR A;  1CDQ A;  2X8B B;  2GOO C;  4AEA A;  3BT2 U;  4RUD A;  1NTX A;  1QKD A;  3NEQ A;  2CTX A;  1HAA A;  2H7Z B;  1HC9 B;  2N99 A;  6EBX A;  3KFD E;  3QB4 B;  5DU1 A;  5IMT D;  3LAQ U;  4XJJ A;  1ABT A;  1NYU A;  1V6P A;  1FSS B;  2JVE A;  2MFA A;  1ES7 B;  1TXB A;  4IYE A;  2MUP A;  1FSC A;  1KBA A;  2L03 A;  1HOY A;  2LA1 A;  3VTS A;  2I9B E;  1L4W A;  2MUO A;  1LX5 B;  1RGJ A;  3BT1 U;  4ZQY A;  2MJ0 A;  1XT3 A;  1G6M A;  1IDG A;  1KXI A;  2H64 B;  1COE A;  4OM4 A;  1LJZ A;  1UG4 A;  1IJC A;  1COD A;  4DO8 A;  1CVO A;  2PJY C;  1TXA A;  2BHI A;  1KS6 A;  2LCR A;  1CB9 A;  1ZAD A;  1S4Y A;  1W6B A;  2MJY A;  1CXN A;  5DO6 A;  2H7Z A;  2FD6 U;  1LXH A;  1HC9 A;  1KL8 A;  4FAO E;  1KU6 B;  2QJB C;  1M9Z A;  4FAO C;  1BXP A;  2HLR A;  1LSI A;  1PLO A;  1I02 A;  1CDR A;  2NBT A;  1NEA A;  1MR6 A;  2HLQ A;  3ERA A;  3U74 U;  5EBX A;  1CRE A;  1KTZ B;  3NH7 A;  2K3G A;  1CHV S;  1F94 A;  4QTI U;  1ONJ A;  3EBX A;  2CRT A;  1HAJ A;  1CCQ A;  3PLC A;  5IMY C;  2H8U A;  2VLW A;  2MJ4 A;  1DRS A;  1IK8 A;  1QKE A;  1KC4 A;  4LFT A;  1TGX A;  1CDS A;  1CRF A;  1TFS A;  2L5S A;  4P7U A;  3EVS C;  1FF4 A;  1F8U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...