5IMTD

Toxin receptor complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
b'LQCYNCPNPTADCKTAVNCSSAFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Intermedilysin
publication title Structural Basis for Receptor Recognition by the Human CD59-Responsive Cholesterol-Dependent Cytolysins.
pubmed doi rcsb
source organism Streptococcus intermedius
molecule tags Toxin
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5imtD00
1H0JA 3BT1U 1IDIA 1KL8A 1NTNA 1RGJA 4IYEA 4FAOE 1HAAA 2MJ0A 1KBSA 3NH7A 3LAQU 3FEVA 1KC4A 1B41B 1KXIA 2MUOA 1CODA 1JGKA 2OFSA 1XT3A 1LJZA 1REWC 1NTXA 1KBAA 1ZADA 1CXOA 2JQPA 1CVOA 1L4WA 1FSCA 2LCRA 1TGXA 1S4YA 2PJYC 3PLCA 1QM7A 1CHVS 2H62D 1CRFA 1YWHA 4RUDA 4BDTB 2GOOB 1MAHF 1IQ9A 1NEAA 1F8UB 2CRTA 3NDSA 1FRAA 1KS6A 2BTXA 5DZ5A 1RL5A 1V6PA 4XJJA 1IDGA 1FSSB 1KU6B 1G6MA 2H64C 3BT2U 1HAJA 1JE9A 1CCQA 1LX5B 2UWRA 1M9ZA 1ONJA 1NXBA 1HOYA 1NORA 1LSIA 2N99A 4AEAA 1I02A 1QKEA 3QB4B 1ABTA 1IDHA 1CREA 1NYUA 1FFJA 4DO8A 3EBXA 4OM5A 2PJYB 2K3GA 4FAOC 2VLWA 1CB9A 1NYSA 4ZQYA 1IJCA 2I9BE 1HC9B 2QC1A 2QJ9C 3KFDI 1HC9A 4LFTA 2JVEA 4UY2C 2HLRA 1CDRA 2H64B 3U74U 2FD6U 1KTZB 2H8UA 1CDSA 2H7ZB 1W6BA 1ERGA 2X8BB 2H7ZA 1LXGA 5IMYC 1BTEA 1TXBA 1CDQA 2QJBC 1QKDA 2ABXA 2H5FA 1CDTA 4HQPF 1MR6A 2L5SA 3U73U 6EBXA 1F94A 2ERAA 3KFDE 5IMTD 1KBTA 2LA1A 1IKCA 2BHIA 4EY8B 4QTIU 1TFSA 1LXHA 3EVSC 1CTXA 2MHYA 2QJAC 1BXPA 2GOOC 4BIKB 1UG4A 2CRSA 2MUPA 2HLQA 2MJ4A 1KFHA 1DRSA 2L03A 1VB0A 2CDXA 3ERAA 4P7UA 5DU1A 1CXNA 5EBXA 1IK8A 2NBTA 3VTSA 1PLOA 2MFAA 1ES7B 3HH7A 1FASA 1TXAA 1ERAA 1IDLA 2J8BA 5DO6A 2CTXA 1FF4A 1COEA 4OM4A 1JBDA 2H62C 3NEQA 2CCXA 2UX2A 2MJYA
chains in the Genus database with same CATH superfamily
1H0JA 3BT1U 1IDIA 4KSNA 1KL8A 1NTNA 1RGJA 4IYEA 4FAOE 1HAAA 2MJ0A 1KBSA 3NH7A 3LAQU 3FEVA 1KC4A 1B41B 1KXIA 2MUOA 1CODA 1JGKA 2OFSA 1XT3A 1LJZA 1REWC 1NTXA 1KBAA 1ZADA 1CXOA 2JQPA 1CVOA 1L4WA 1FSCA 2LCRA 1TGXA 1S4YA 2PJYC 3PLCA 1QM7A 1CHVS 2H62D 1CRFA 1YWHA 4RUDA 4BDTB 2GOOB 1MAHF 1IQ9A 1NEAA 1F8UB 2CRTA 3NDSA 1FRAA 1KS6A 2BTXA 5DZ5A 1RL5A 1V6PA 4XJJA 1IDGA 1FSSB 1KU6B 1G6MA 2H64C 3BT2U 1HAJA 1JE9A 1CCQA 1LX5B 2UWRA 1M9ZA 1ONJA 1NXBA 1HOYA 1NORA 1LSIA 2N99A 4AEAA 1I02A 1QKEA 3QB4B 1ABTA 1IDHA 1CREA 1NYUA 1FFJA 4DO8A 3EBXA 4OM5A 2PJYB 2K3GA 4FAOC 2VLWA 1CB9A 1NYSA 4ZQYA 1IJCA 2I9BE 1HC9B 2QC1A 2QJ9C 3KFDI 1HC9A 4LFTA 2JVEA 4UY2C 2HLRA 1CDRA 2H64B 3U74U 2FD6U 1KTZB 2H8UA 1CDSA 2H7ZB 1W6BA 1ERGA 2X8BB 2H7ZA 1LXGA 5IMYC 1BTEA 1TXBA 1CDQA 2QJBC 1QKDA 2ABXA 2H5FA 1CDTA 4HQPF 1MR6A 2L5SA 3U73U 6EBXA 1F94A 2ERAA 3KFDE 5IMTD 1KBTA 2LA1A 1IKCA 2BHIA 4EY8B 4QTIU 1TFSA 1LXHA 3EVSC 1CTXA 2MHYA 2QJAC 1BXPA 2GOOC 4BIKB 1UG4A 2CRSA 2MUPA 2HLQA 2MJ4A 1KFHA 1DRSA 2L03A 1VB0A 2CDXA 3ERAA 4P7UA 5DU1A 1CXNA 5EBXA 1IK8A 2NBTA 3VTSA 1PLOA 2MFAA 1ES7B 3HH7A 1FASA 1TXAA 1ERAA 1IDLA 2J8BA 5DO6A 2CTXA 1FF4A 1COEA 4OM4A 1JBDA 2H62C 3NEQA 2CCXA 2UX2A 2MJYA
chains in the Genus database with same CATH topology
1H0JA 3BT1U 1IDIA 4KSNA 1KL8A 1NTNA 1RGJA 4IYEA 4FAOE 1HAAA 2MJ0A 1KBSA 3NH7A 3LAQU 3FEVA 1KC4A 1B41B 1KXIA 2MUOA 1CODA 1JGKA 2OFSA 1XT3A 1LJZA 1REWC 1NTXA 1KBAA 1ZADA 1CXOA 2JQPA 1CVOA 1L4WA 1FSCA 2LCRA 1TGXA 1S4YA 2PJYC 3PLCA 1QM7A 1CHVS 2H62D 1CRFA 1YWHA 4RUDA 4BDTB 2GOOB 1MAHF 1IQ9A 1NEAA 1F8UB 2CRTA 3NDSA 1FRAA 1KS6A 2BTXA 5DZ5A 1RL5A 1V6PA 4XJJA 1IDGA 1FSSB 1KU6B 1G6MA 2H64C 3BT2U 1HAJA 1JE9A 1CCQA 1LX5B 2UWRA 1M9ZA 1ONJA 1NXBA 1HOYA 1NORA 1LSIA 2N99A 4AEAA 1I02A 1QKEA 3QB4B 1ABTA 1IDHA 1CREA 1NYUA 1FFJA 4DO8A 3EBXA 4OM5A 2PJYB 2K3GA 4FAOC 2VLWA 1CB9A 1NYSA 4ZQYA 1IJCA 2I9BE 1HC9B 2QC1A 2QJ9C 3KFDI 1HC9A 4LFTA 2JVEA 4UY2C 2HLRA 1CDRA 2H64B 3U74U 2FD6U 1KTZB 2H8UA 1CDSA 2H7ZB 1W6BA 1ERGA 2X8BB 2H7ZA 1LXGA 5IMYC 1BTEA 1TXBA 1CDQA 2QJBC 1QKDA 2ABXA 2H5FA 1CDTA 4HQPF 1MR6A 2L5SA 3U73U 6EBXA 1F94A 2ERAA 3KFDE 5IMTD 1KBTA 2LA1A 1IKCA 2BHIA 4EY8B 4QTIU 1TFSA 1LXHA 3EVSC 1CTXA 2MHYA 2QJAC 1BXPA 2GOOC 4BIKB 1UG4A 2CRSA 2MUPA 2HLQA 2MJ4A 1KFHA 1DRSA 2L03A 1VB0A 2CDXA 3ERAA 4P7UA 5DU1A 1CXNA 5EBXA 1IK8A 2NBTA 3VTSA 1PLOA 2MFAA 1ES7B 3HH7A 1FASA 1TXAA 1ERAA 1IDLA 2J8BA 5DO6A 2CTXA 1FF4A 1COEA 4OM4A 1JBDA 2H62C 3NEQA 2CCXA 2UX2A 2MJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H0J A;  3BT1 U;  1IDI A;  1KL8 A;  1NTN A;  1RGJ A;  4IYE A;  4FAO E;  1HAA A;  2MJ0 A;  1KBS A;  3NH7 A;  3LAQ U;  3FEV A;  1KC4 A;  1B41 B;  1KXI A;  2MUO A;  1COD A;  1JGK A;  2OFS A;  1XT3 A;  1LJZ A;  1REW C;  1NTX A;  1KBA A;  1ZAD A;  1CXO A;  2JQP A;  1CVO A;  1L4W A;  1FSC A;  2LCR A;  1TGX A;  1S4Y A;  2PJY C;  3PLC A;  1QM7 A;  1CHV S;  2H62 D;  1CRF A;  1YWH A;  4RUD A;  4BDT B;  2GOO B;  1MAH F;  1IQ9 A;  1NEA A;  1F8U B;  2CRT A;  3NDS A;  1FRA A;  1KS6 A;  2BTX A;  5DZ5 A;  1RL5 A;  1V6P A;  4XJJ A;  1IDG A;  1FSS B;  1KU6 B;  1G6M A;  2H64 C;  3BT2 U;  1HAJ A;  1JE9 A;  1CCQ A;  1LX5 B;  2UWR A;  1M9Z A;  1ONJ A;  1NXB A;  1HOY A;  1NOR A;  1LSI A;  2N99 A;  4AEA A;  1I02 A;  1QKE A;  3QB4 B;  1ABT A;  1IDH A;  1CRE A;  1NYU A;  1FFJ A;  4DO8 A;  3EBX A;  4OM5 A;  2PJY B;  2K3G A;  4FAO C;  2VLW A;  1CB9 A;  1NYS A;  4ZQY A;  1IJC A;  2I9B E;  1HC9 B;  2QC1 A;  2QJ9 C;  3KFD I;  1HC9 A;  4LFT A;  2JVE A;  4UY2 C;  2HLR A;  1CDR A;  2H64 B;  3U74 U;  2FD6 U;  1KTZ B;  2H8U A;  1CDS A;  2H7Z B;  1W6B A;  1ERG A;  2X8B B;  2H7Z A;  1LXG A;  5IMY C;  1BTE A;  1TXB A;  1CDQ A;  2QJB C;  1QKD A;  2ABX A;  2H5F A;  1CDT A;  4HQP F;  1MR6 A;  2L5S A;  3U73 U;  6EBX A;  1F94 A;  2ERA A;  3KFD E;  5IMT D;  1KBT A;  2LA1 A;  1IKC A;  2BHI A;  4EY8 B;  4QTI U;  1TFS A;  1LXH A;  3EVS C;  1CTX A;  2MHY A;  2QJA C;  1BXP A;  2GOO C;  4BIK B;  1UG4 A;  2CRS A;  2MUP A;  2HLQ A;  2MJ4 A;  1KFH A;  1DRS A;  2L03 A;  1VB0 A;  2CDX A;  3ERA A;  4P7U A;  5DU1 A;  1CXN A;  5EBX A;  1IK8 A;  2NBT A;  3VTS A;  1PLO A;  2MFA A;  1ES7 B;  3HH7 A;  1FAS A;  1TXA A;  1ERA A;  1IDL A;  2J8B A;  5DO6 A;  2CTX A;  1FF4 A;  1COE A;  4OM4 A;  1JBD A;  2H62 C;  3NEQ A;  2CCX A;  2UX2 A;  2MJY A; 
#chains in the Genus database with same CATH topology
 1H0J A;  3BT1 U;  1IDI A;  4KSN A;  1KL8 A;  1NTN A;  1RGJ A;  4IYE A;  4FAO E;  1HAA A;  2MJ0 A;  1KBS A;  3NH7 A;  3LAQ U;  3FEV A;  1KC4 A;  1B41 B;  1KXI A;  2MUO A;  1COD A;  1JGK A;  2OFS A;  1XT3 A;  1LJZ A;  1REW C;  1NTX A;  1KBA A;  1ZAD A;  1CXO A;  2JQP A;  1CVO A;  1L4W A;  1FSC A;  2LCR A;  1TGX A;  1S4Y A;  2PJY C;  3PLC A;  1QM7 A;  1CHV S;  2H62 D;  1CRF A;  1YWH A;  4RUD A;  4BDT B;  2GOO B;  1MAH F;  1IQ9 A;  1NEA A;  1F8U B;  2CRT A;  3NDS A;  1FRA A;  1KS6 A;  2BTX A;  5DZ5 A;  1RL5 A;  1V6P A;  4XJJ A;  1IDG A;  1FSS B;  1KU6 B;  1G6M A;  2H64 C;  3BT2 U;  1HAJ A;  1JE9 A;  1CCQ A;  1LX5 B;  2UWR A;  1M9Z A;  1ONJ A;  1NXB A;  1HOY A;  1NOR A;  1LSI A;  2N99 A;  4AEA A;  1I02 A;  1QKE A;  3QB4 B;  1ABT A;  1IDH A;  1CRE A;  1NYU A;  1FFJ A;  4DO8 A;  3EBX A;  4OM5 A;  2PJY B;  2K3G A;  4FAO C;  2VLW A;  1CB9 A;  1NYS A;  4ZQY A;  1IJC A;  2I9B E;  1HC9 B;  2QC1 A;  2QJ9 C;  3KFD I;  1HC9 A;  4LFT A;  2JVE A;  4UY2 C;  2HLR A;  1CDR A;  2H64 B;  3U74 U;  2FD6 U;  1KTZ B;  2H8U A;  1CDS A;  2H7Z B;  1W6B A;  1ERG A;  2X8B B;  2H7Z A;  1LXG A;  5IMY C;  1BTE A;  1TXB A;  1CDQ A;  2QJB C;  1QKD A;  2ABX A;  2H5F A;  1CDT A;  4HQP F;  1MR6 A;  2L5S A;  3U73 U;  6EBX A;  1F94 A;  2ERA A;  3KFD E;  5IMT D;  1KBT A;  2LA1 A;  1IKC A;  2BHI A;  4EY8 B;  4QTI U;  1TFS A;  1LXH A;  3EVS C;  1CTX A;  2MHY A;  2QJA C;  1BXP A;  2GOO C;  4BIK B;  1UG4 A;  2CRS A;  2MUP A;  2HLQ A;  2MJ4 A;  1KFH A;  1DRS A;  2L03 A;  1VB0 A;  2CDX A;  3ERA A;  4P7U A;  5DU1 A;  1CXN A;  5EBX A;  1IK8 A;  2NBT A;  3VTS A;  1PLO A;  2MFA A;  1ES7 B;  3HH7 A;  1FAS A;  1TXA A;  1ERA A;  1IDL A;  2J8B A;  5DO6 A;  2CTX A;  1FF4 A;  1COE A;  4OM4 A;  1JBD A;  2H62 C;  3NEQ A;  2CCX A;  2UX2 A;  2MJY A; 
#chains in the Genus database with same CATH homology
 1H0J A;  3BT1 U;  1IDI A;  4KSN A;  1KL8 A;  1NTN A;  1RGJ A;  4IYE A;  4FAO E;  1HAA A;  2MJ0 A;  1KBS A;  3NH7 A;  3LAQ U;  3FEV A;  1KC4 A;  1B41 B;  1KXI A;  2MUO A;  1COD A;  1JGK A;  2OFS A;  1XT3 A;  1LJZ A;  1REW C;  1NTX A;  1KBA A;  1ZAD A;  1CXO A;  2JQP A;  1CVO A;  1L4W A;  1FSC A;  2LCR A;  1TGX A;  1S4Y A;  2PJY C;  3PLC A;  1QM7 A;  1CHV S;  2H62 D;  1CRF A;  1YWH A;  4RUD A;  4BDT B;  2GOO B;  1MAH F;  1IQ9 A;  1NEA A;  1F8U B;  2CRT A;  3NDS A;  1FRA A;  1KS6 A;  2BTX A;  5DZ5 A;  1RL5 A;  1V6P A;  4XJJ A;  1IDG A;  1FSS B;  1KU6 B;  1G6M A;  2H64 C;  3BT2 U;  1HAJ A;  1JE9 A;  1CCQ A;  1LX5 B;  2UWR A;  1M9Z A;  1ONJ A;  1NXB A;  1HOY A;  1NOR A;  1LSI A;  2N99 A;  4AEA A;  1I02 A;  1QKE A;  3QB4 B;  1ABT A;  1IDH A;  1CRE A;  1NYU A;  1FFJ A;  4DO8 A;  3EBX A;  4OM5 A;  2PJY B;  2K3G A;  4FAO C;  2VLW A;  1CB9 A;  1NYS A;  4ZQY A;  1IJC A;  2I9B E;  1HC9 B;  2QC1 A;  2QJ9 C;  3KFD I;  1HC9 A;  4LFT A;  2JVE A;  4UY2 C;  2HLR A;  1CDR A;  2H64 B;  3U74 U;  2FD6 U;  1KTZ B;  2H8U A;  1CDS A;  2H7Z B;  1W6B A;  1ERG A;  2X8B B;  2H7Z A;  1LXG A;  5IMY C;  1BTE A;  1TXB A;  1CDQ A;  2QJB C;  1QKD A;  2ABX A;  2H5F A;  1CDT A;  4HQP F;  1MR6 A;  2L5S A;  3U73 U;  6EBX A;  1F94 A;  2ERA A;  3KFD E;  5IMT D;  1KBT A;  2LA1 A;  1IKC A;  2BHI A;  4EY8 B;  4QTI U;  1TFS A;  1LXH A;  3EVS C;  1CTX A;  2MHY A;  2QJA C;  1BXP A;  2GOO C;  4BIK B;  1UG4 A;  2CRS A;  2MUP A;  2HLQ A;  2MJ4 A;  1KFH A;  1DRS A;  2L03 A;  1VB0 A;  2CDX A;  3ERA A;  4P7U A;  5DU1 A;  1CXN A;  5EBX A;  1IK8 A;  2NBT A;  3VTS A;  1PLO A;  2MFA A;  1ES7 B;  3HH7 A;  1FAS A;  1TXA A;  1ERA A;  1IDL A;  2J8B A;  5DO6 A;  2CTX A;  1FF4 A;  1COE A;  4OM4 A;  1JBD A;  2H62 C;  3NEQ A;  2CCX A;  2UX2 A;  2MJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...