5IMTD

Toxin receptor complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
77
structure length
77
Chain Sequence
LQCYNCPNPTADCKTAVNCSSAFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Intermedilysin
publication title Structural Basis for Receptor Recognition by the Human CD59-Responsive Cholesterol-Dependent Cytolysins.
pubmed doi rcsb
source organism Streptococcus intermedius
total genus 18
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2016-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 5imtD00
4LFTA 1L4WA 1DRSA 4BDTB 2CCXA 4FAOC 1IJCA 1IKCA 3ERAA 1LXGA 3NDSA 2J8BA 1RGJA 2GOOB 1HC9B 1CDSA 4BIKB 3LAQU 3QB4B 1LJZA 2H7ZA 1BTEA 1KS6A 1CDQA 1LSIA 4OM4A 1G6MA 2L03A 2MUOA 1FF4A 1CTXA 1V6PA 1KL8A 1CDTA 2FD6U 1CXNA 3VTSA 1S4YA 2LA1A 1CDRA 3NEQA 1IDIA 2BTXA 2K3GA 1TXBA 4EY8B 2QJBC 2NBTA 1YWHA 2CRTA 2H62C 1LXHA 2QC1A 2MFAA 2UWRA 3EVSC 1ONJA 4QTIU 1ERGA 3NH7A 5DZ5A 1BXPA 3U73U 3BT1U 2H64B 2ABXA 1NORA 1NTXA 2UX2A 1B41B 1IDLA 1MAHF 2QJ9C 1FSCA 1H0JA 4RUDA 1M9ZA 1CVOA 1UG4A 1TFSA 4UY2C 2H62D 1VB0A 2ERAA 1W6BA 1JE9A 3U74U 1ABTA 2PJYC 1QKEA 1ES7B 1CODA 1PLOA 1IK8A 4IYEA 6EBXA 1ZADA 1KC4A 1FRAA 1IDGA 1HC9A 1KBSA 1FSSB 1NYSA 5DO6A 1COEA 3PLCA 1NTNA 1JBDA 2H5FA 1QKDA 1CB9A 4ZQYA 2BHIA 2HLRA 2H7ZB 5IMYC 1KXIA 2X8BB 4XJJA 1ERAA 1NXBA 1F8UB 1F94A 1MR6A 4P7UA 1CCQA 2GOOC 3EBXA 1IQ9A 2OFSA 1HAAA 2LCRA 1KFHA 3FEVA 4FAOE 1TXAA 1TGXA 2N99A 1I02A 1IDHA 1QM7A 2JVEA 2MHYA 4DO8A 2MJ0A 3KFDI 5IMTD 1HOYA 2CDXA 1REWC 1LX5B 2I9BE 1CXOA 4OM5A 1XT3A 1CREA 3HH7A 2MJYA 1KBAA 1KTZB 2MUPA 2L5SA 1JGKA 1CRFA 5EBXA 1FASA 2QJAC 3KFDE 2PJYB 4HQPF 1KBTA 2JQPA 2MJ4A 2VLWA 1KU6B 3BT2U 5DU1A 1NEAA 1RL5A 2CTXA 2H64C 2H8UA 1FFJA 1NYUA 1HAJA 4AEAA 1CHVS 2CRSA 2HLQA
chains in the Genus database with same CATH superfamily
4LFTA 1L4WA 1DRSA 4BDTB 2CCXA 4FAOC 1IJCA 1IKCA 3ERAA 1LXGA 3NDSA 2J8BA 1RGJA 2GOOB 1HC9B 1CDSA 4BIKB 3LAQU 3QB4B 1LJZA 2H7ZA 1BTEA 1KS6A 1CDQA 1LSIA 4OM4A 1G6MA 2L03A 2MUOA 1FF4A 1CTXA 1V6PA 1KL8A 1CDTA 2FD6U 1CXNA 3VTSA 1S4YA 2LA1A 1CDRA 3NEQA 1IDIA 2BTXA 2K3GA 1TXBA 4EY8B 2QJBC 2NBTA 1YWHA 2CRTA 2H62C 1LXHA 2QC1A 2MFAA 2UWRA 3EVSC 1ONJA 4QTIU 1ERGA 3NH7A 5DZ5A 1BXPA 3U73U 3BT1U 2H64B 2ABXA 1NORA 1NTXA 2UX2A 1B41B 1IDLA 1MAHF 2QJ9C 1FSCA 1H0JA 4RUDA 4KSNA 1M9ZA 1CVOA 1UG4A 1TFSA 4UY2C 2H62D 1VB0A 2ERAA 1W6BA 1JE9A 3U74U 1ABTA 2PJYC 1QKEA 1ES7B 1CODA 1PLOA 1IK8A 4IYEA 6EBXA 1ZADA 1KC4A 1FRAA 1IDGA 1HC9A 1KBSA 1FSSB 1NYSA 5DO6A 1COEA 3PLCA 1NTNA 1JBDA 2H5FA 1QKDA 1CB9A 4ZQYA 2BHIA 2HLRA 2H7ZB 5IMYC 1KXIA 2X8BB 4XJJA 1ERAA 1NXBA 1F8UB 1F94A 1MR6A 4P7UA 1CCQA 2GOOC 3EBXA 1IQ9A 2OFSA 1HAAA 2LCRA 1KFHA 3FEVA 4FAOE 1TXAA 1TGXA 2N99A 1I02A 1IDHA 1QM7A 2JVEA 2MHYA 4DO8A 2MJ0A 3KFDI 5IMTD 1HOYA 2CDXA 1REWC 1LX5B 2I9BE 1CXOA 4OM5A 1XT3A 1CREA 3HH7A 2MJYA 1KBAA 1KTZB 2MUPA 2L5SA 1JGKA 1CRFA 5EBXA 1FASA 2QJAC 3KFDE 2PJYB 4HQPF 1KBTA 2JQPA 2MJ4A 2VLWA 1KU6B 3BT2U 5DU1A 1NEAA 1RL5A 2CTXA 2H64C 2H8UA 1FFJA 1NYUA 1HAJA 4AEAA 1CHVS 2CRSA 2HLQA
chains in the Genus database with same CATH topology
4LFTA 1L4WA 1DRSA 4BDTB 2CCXA 4FAOC 1IJCA 1IKCA 3ERAA 1LXGA 3NDSA 2J8BA 1RGJA 2GOOB 1HC9B 1CDSA 4BIKB 3LAQU 3QB4B 1LJZA 2H7ZA 1BTEA 1KS6A 1CDQA 1LSIA 4OM4A 1G6MA 2L03A 2MUOA 1FF4A 1CTXA 1V6PA 1KL8A 1CDTA 2FD6U 1CXNA 3VTSA 1S4YA 2LA1A 1CDRA 3NEQA 1IDIA 2BTXA 2K3GA 1TXBA 4EY8B 2QJBC 2NBTA 1YWHA 2CRTA 2H62C 1LXHA 2QC1A 2MFAA 2UWRA 3EVSC 1ONJA 4QTIU 1ERGA 3NH7A 5DZ5A 1BXPA 3U73U 3BT1U 2H64B 2ABXA 1NORA 1NTXA 2UX2A 1B41B 1IDLA 1MAHF 2QJ9C 1FSCA 1H0JA 4RUDA 4KSNA 1M9ZA 1CVOA 1UG4A 1TFSA 4UY2C 2H62D 1VB0A 2ERAA 1W6BA 1JE9A 3U74U 1ABTA 2PJYC 1QKEA 1ES7B 1CODA 1PLOA 1IK8A 4IYEA 6EBXA 1ZADA 1KC4A 1FRAA 1IDGA 1HC9A 1KBSA 1FSSB 1NYSA 5DO6A 1COEA 3PLCA 1NTNA 1JBDA 2H5FA 1QKDA 1CB9A 4ZQYA 2BHIA 2HLRA 2H7ZB 5IMYC 1KXIA 2X8BB 4XJJA 1ERAA 1NXBA 1F8UB 1F94A 1MR6A 4P7UA 1CCQA 2GOOC 3EBXA 1IQ9A 2OFSA 1HAAA 2LCRA 1KFHA 3FEVA 4FAOE 1TXAA 1TGXA 2N99A 1I02A 1IDHA 1QM7A 2JVEA 2MHYA 4DO8A 2MJ0A 3KFDI 5IMTD 1HOYA 2CDXA 1REWC 1LX5B 2I9BE 1CXOA 4OM5A 1XT3A 1CREA 3HH7A 2MJYA 1KBAA 1KTZB 2MUPA 2L5SA 1JGKA 1CRFA 5EBXA 1FASA 2QJAC 3KFDE 2PJYB 4HQPF 1KBTA 2JQPA 2MJ4A 2VLWA 1KU6B 3BT2U 5DU1A 1NEAA 1RL5A 2CTXA 2H64C 2H8UA 1FFJA 1NYUA 1HAJA 4AEAA 1CHVS 2CRSA 2HLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFT A;  1L4W A;  1DRS A;  4BDT B;  2CCX A;  4FAO C;  1IJC A;  1IKC A;  3ERA A;  1LXG A;  3NDS A;  2J8B A;  1RGJ A;  2GOO B;  1HC9 B;  1CDS A;  4BIK B;  3LAQ U;  3QB4 B;  1LJZ A;  2H7Z A;  1BTE A;  1KS6 A;  1CDQ A;  1LSI A;  4OM4 A;  1G6M A;  2L03 A;  2MUO A;  1FF4 A;  1CTX A;  1V6P A;  1KL8 A;  1CDT A;  2FD6 U;  1CXN A;  3VTS A;  1S4Y A;  2LA1 A;  1CDR A;  3NEQ A;  1IDI A;  2BTX A;  2K3G A;  1TXB A;  4EY8 B;  2QJB C;  2NBT A;  1YWH A;  2CRT A;  2H62 C;  1LXH A;  2QC1 A;  2MFA A;  2UWR A;  3EVS C;  1ONJ A;  4QTI U;  1ERG A;  3NH7 A;  5DZ5 A;  1BXP A;  3U73 U;  3BT1 U;  2H64 B;  2ABX A;  1NOR A;  1NTX A;  2UX2 A;  1B41 B;  1IDL A;  1MAH F;  2QJ9 C;  1FSC A;  1H0J A;  4RUD A;  1M9Z A;  1CVO A;  1UG4 A;  1TFS A;  4UY2 C;  2H62 D;  1VB0 A;  2ERA A;  1W6B A;  1JE9 A;  3U74 U;  1ABT A;  2PJY C;  1QKE A;  1ES7 B;  1COD A;  1PLO A;  1IK8 A;  4IYE A;  6EBX A;  1ZAD A;  1KC4 A;  1FRA A;  1IDG A;  1HC9 A;  1KBS A;  1FSS B;  1NYS A;  5DO6 A;  1COE A;  3PLC A;  1NTN A;  1JBD A;  2H5F A;  1QKD A;  1CB9 A;  4ZQY A;  2BHI A;  2HLR A;  2H7Z B;  5IMY C;  1KXI A;  2X8B B;  4XJJ A;  1ERA A;  1NXB A;  1F8U B;  1F94 A;  1MR6 A;  4P7U A;  1CCQ A;  2GOO C;  3EBX A;  1IQ9 A;  2OFS A;  1HAA A;  2LCR A;  1KFH A;  3FEV A;  4FAO E;  1TXA A;  1TGX A;  2N99 A;  1I02 A;  1IDH A;  1QM7 A;  2JVE A;  2MHY A;  4DO8 A;  2MJ0 A;  3KFD I;  5IMT D;  1HOY A;  2CDX A;  1REW C;  1LX5 B;  2I9B E;  1CXO A;  4OM5 A;  1XT3 A;  1CRE A;  3HH7 A;  2MJY A;  1KBA A;  1KTZ B;  2MUP A;  2L5S A;  1JGK A;  1CRF A;  5EBX A;  1FAS A;  2QJA C;  3KFD E;  2PJY B;  4HQP F;  1KBT A;  2JQP A;  2MJ4 A;  2VLW A;  1KU6 B;  3BT2 U;  5DU1 A;  1NEA A;  1RL5 A;  2CTX A;  2H64 C;  2H8U A;  1FFJ A;  1NYU A;  1HAJ A;  4AEA A;  1CHV S;  2CRS A;  2HLQ A; 
#chains in the Genus database with same CATH topology
 4LFT A;  1L4W A;  1DRS A;  4BDT B;  2CCX A;  4FAO C;  1IJC A;  1IKC A;  3ERA A;  1LXG A;  3NDS A;  2J8B A;  1RGJ A;  2GOO B;  1HC9 B;  1CDS A;  4BIK B;  3LAQ U;  3QB4 B;  1LJZ A;  2H7Z A;  1BTE A;  1KS6 A;  1CDQ A;  1LSI A;  4OM4 A;  1G6M A;  2L03 A;  2MUO A;  1FF4 A;  1CTX A;  1V6P A;  1KL8 A;  1CDT A;  2FD6 U;  1CXN A;  3VTS A;  1S4Y A;  2LA1 A;  1CDR A;  3NEQ A;  1IDI A;  2BTX A;  2K3G A;  1TXB A;  4EY8 B;  2QJB C;  2NBT A;  1YWH A;  2CRT A;  2H62 C;  1LXH A;  2QC1 A;  2MFA A;  2UWR A;  3EVS C;  1ONJ A;  4QTI U;  1ERG A;  3NH7 A;  5DZ5 A;  1BXP A;  3U73 U;  3BT1 U;  2H64 B;  2ABX A;  1NOR A;  1NTX A;  2UX2 A;  1B41 B;  1IDL A;  1MAH F;  2QJ9 C;  1FSC A;  1H0J A;  4RUD A;  4KSN A;  1M9Z A;  1CVO A;  1UG4 A;  1TFS A;  4UY2 C;  2H62 D;  1VB0 A;  2ERA A;  1W6B A;  1JE9 A;  3U74 U;  1ABT A;  2PJY C;  1QKE A;  1ES7 B;  1COD A;  1PLO A;  1IK8 A;  4IYE A;  6EBX A;  1ZAD A;  1KC4 A;  1FRA A;  1IDG A;  1HC9 A;  1KBS A;  1FSS B;  1NYS A;  5DO6 A;  1COE A;  3PLC A;  1NTN A;  1JBD A;  2H5F A;  1QKD A;  1CB9 A;  4ZQY A;  2BHI A;  2HLR A;  2H7Z B;  5IMY C;  1KXI A;  2X8B B;  4XJJ A;  1ERA A;  1NXB A;  1F8U B;  1F94 A;  1MR6 A;  4P7U A;  1CCQ A;  2GOO C;  3EBX A;  1IQ9 A;  2OFS A;  1HAA A;  2LCR A;  1KFH A;  3FEV A;  4FAO E;  1TXA A;  1TGX A;  2N99 A;  1I02 A;  1IDH A;  1QM7 A;  2JVE A;  2MHY A;  4DO8 A;  2MJ0 A;  3KFD I;  5IMT D;  1HOY A;  2CDX A;  1REW C;  1LX5 B;  2I9B E;  1CXO A;  4OM5 A;  1XT3 A;  1CRE A;  3HH7 A;  2MJY A;  1KBA A;  1KTZ B;  2MUP A;  2L5S A;  1JGK A;  1CRF A;  5EBX A;  1FAS A;  2QJA C;  3KFD E;  2PJY B;  4HQP F;  1KBT A;  2JQP A;  2MJ4 A;  2VLW A;  1KU6 B;  3BT2 U;  5DU1 A;  1NEA A;  1RL5 A;  2CTX A;  2H64 C;  2H8U A;  1FFJ A;  1NYU A;  1HAJ A;  4AEA A;  1CHV S;  2CRS A;  2HLQ A; 
#chains in the Genus database with same CATH homology
 4LFT A;  1L4W A;  1DRS A;  4BDT B;  2CCX A;  4FAO C;  1IJC A;  1IKC A;  3ERA A;  1LXG A;  3NDS A;  2J8B A;  1RGJ A;  2GOO B;  1HC9 B;  1CDS A;  4BIK B;  3LAQ U;  3QB4 B;  1LJZ A;  2H7Z A;  1BTE A;  1KS6 A;  1CDQ A;  1LSI A;  4OM4 A;  1G6M A;  2L03 A;  2MUO A;  1FF4 A;  1CTX A;  1V6P A;  1KL8 A;  1CDT A;  2FD6 U;  1CXN A;  3VTS A;  1S4Y A;  2LA1 A;  1CDR A;  3NEQ A;  1IDI A;  2BTX A;  2K3G A;  1TXB A;  4EY8 B;  2QJB C;  2NBT A;  1YWH A;  2CRT A;  2H62 C;  1LXH A;  2QC1 A;  2MFA A;  2UWR A;  3EVS C;  1ONJ A;  4QTI U;  1ERG A;  3NH7 A;  5DZ5 A;  1BXP A;  3U73 U;  3BT1 U;  2H64 B;  2ABX A;  1NOR A;  1NTX A;  2UX2 A;  1B41 B;  1IDL A;  1MAH F;  2QJ9 C;  1FSC A;  1H0J A;  4RUD A;  4KSN A;  1M9Z A;  1CVO A;  1UG4 A;  1TFS A;  4UY2 C;  2H62 D;  1VB0 A;  2ERA A;  1W6B A;  1JE9 A;  3U74 U;  1ABT A;  2PJY C;  1QKE A;  1ES7 B;  1COD A;  1PLO A;  1IK8 A;  4IYE A;  6EBX A;  1ZAD A;  1KC4 A;  1FRA A;  1IDG A;  1HC9 A;  1KBS A;  1FSS B;  1NYS A;  5DO6 A;  1COE A;  3PLC A;  1NTN A;  1JBD A;  2H5F A;  1QKD A;  1CB9 A;  4ZQY A;  2BHI A;  2HLR A;  2H7Z B;  5IMY C;  1KXI A;  2X8B B;  4XJJ A;  1ERA A;  1NXB A;  1F8U B;  1F94 A;  1MR6 A;  4P7U A;  1CCQ A;  2GOO C;  3EBX A;  1IQ9 A;  2OFS A;  1HAA A;  2LCR A;  1KFH A;  3FEV A;  4FAO E;  1TXA A;  1TGX A;  2N99 A;  1I02 A;  1IDH A;  1QM7 A;  2JVE A;  2MHY A;  4DO8 A;  2MJ0 A;  3KFD I;  5IMT D;  1HOY A;  2CDX A;  1REW C;  1LX5 B;  2I9B E;  1CXO A;  4OM5 A;  1XT3 A;  1CRE A;  3HH7 A;  2MJY A;  1KBA A;  1KTZ B;  2MUP A;  2L5S A;  1JGK A;  1CRF A;  5EBX A;  1FAS A;  2QJA C;  3KFD E;  2PJY B;  4HQP F;  1KBT A;  2JQP A;  2MJ4 A;  2VLW A;  1KU6 B;  3BT2 U;  5DU1 A;  1NEA A;  1RL5 A;  2CTX A;  2H64 C;  2H8U A;  1FFJ A;  1NYU A;  1HAJ A;  4AEA A;  1CHV S;  2CRS A;  2HLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...