1ERGA

Three-dimensional solution structure of the extracellular region of the complement regulatory protein, cd59, a new cell surface protein domain related to neurotoxins
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
70
structure length
70
Chain Sequence
LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complement factor
molecule keywords CD59
publication title Three-dimensional solution structure of the extracellular region of the complement regulatory protein CD59, a new cell-surface protein domain related to snake venom neurotoxins.
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1993-12-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00021 UPAR_LY6 u-PAR/Ly-6 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ergA00
1NTXA 1TXBA 1IKCA 1KL8A 4FAOC 3ERAA 2H64C 1HAAA 1KTZB 1H0JA 2H62D 2H7ZB 4HQPF 4BDTB 1JE9A 1CHVS 2H5FA 3U74U 2GOOB 1VB0A 1FF4A 4AEAA 1CDRA 1RGJA 1QKEA 2MJ4A 1F94A 2NBTA 1LXGA 4UY2C 1NYSA 2GOOC 4FAOE 2H7ZA 1LSIA 4OM4A 3KFDE 1CDTA 1HOYA 1L4WA 2BTXA 1FFJA 1LXHA 1KBTA 1G6MA 1QKDA 1KS6A 2CRTA 2X8BB 2HLRA 2JVEA 1CTXA 4ZQYA 4IYEA 2LCRA 1ONJA 1KBSA 1MR6A 1RL5A 2JQPA 1W6BA 3BT2U 2MFAA 1DRSA 1TGXA 5IMTD 1NXBA 2FD6U 1KU6B 4BIKB 1TXAA 2ERAA 1KBAA 1M9ZA 1JBDA 1IQ9A 1CODA 1MAHF 2MHYA 1NTNA 1CDSA 1ZADA 2OFSA 2CDXA 1UG4A 5EBXA 1HAJA 3NEQA 5DO6A 1I02A 6EBXA 2N99A 1IDHA 2QJ9C 2I9BE 5IMYC 2QJBC 1CB9A 2L03A 3VTSA 1CDQA 1YWHA 1F8UB 1CRFA 3NDSA 3PLCA 1FASA 1NEAA 2QC1A 1COEA 1IDLA 3BT1U 1CREA 1FSCA 1BTEA 1XT3A 4P7UA 2MUPA 5DU1A 1B41B 2PJYB 3NH7A 3EVSC 1S4YA 2BHIA 2VLWA 1QM7A 2ABXA 2MJ0A 1CXOA 1FRAA 1REWC 1IJCA 4XJJA 2CRSA 2H64B 3U73U 1IK8A 5DZ5A 4DO8A 2QJAC 1CVOA 2MJYA 1CXNA 2K3GA 1TFSA 1LX5B 3EBXA 2CCXA 2HLQA 2PJYC 3QB4B 1ABTA 1HC9B 1IDGA 2UWRA 2MUOA 1BXPA 1LJZA 4LFTA 1JGKA 3FEVA 1ES7B 2UX2A 3HH7A 4QTIU 2LA1A 1IDIA 1CCQA 1NYUA 2J8BA 2L5SA 4RUDA 1HC9A 4OM5A 2H62C 2H8UA 3LAQU 1KXIA 2CTXA 3KFDI 1ERGA 1KFHA 1PLOA 1V6PA 1NORA 4EY8B 1ERAA 1FSSB 1KC4A
chains in the Genus database with same CATH superfamily
1NTXA 1TXBA 1IKCA 1KL8A 4FAOC 3ERAA 2H64C 1HAAA 1KTZB 1H0JA 2H62D 2H7ZB 4HQPF 4BDTB 1JE9A 1CHVS 2H5FA 3U74U 2GOOB 1VB0A 1FF4A 4AEAA 1CDRA 1RGJA 1QKEA 2MJ4A 1F94A 2NBTA 1LXGA 4KSNA 4UY2C 1NYSA 2GOOC 4FAOE 2H7ZA 1LSIA 4OM4A 3KFDE 1CDTA 1HOYA 1L4WA 2BTXA 1FFJA 1LXHA 1KBTA 1G6MA 1QKDA 1KS6A 2CRTA 2X8BB 2HLRA 2JVEA 1CTXA 4ZQYA 4IYEA 2LCRA 1ONJA 1KBSA 1MR6A 1RL5A 2JQPA 1W6BA 3BT2U 2MFAA 1DRSA 1TGXA 5IMTD 1NXBA 2FD6U 1KU6B 4BIKB 1TXAA 2ERAA 1KBAA 1M9ZA 1JBDA 1IQ9A 1CODA 1MAHF 2MHYA 1NTNA 1CDSA 1ZADA 2OFSA 2CDXA 1UG4A 5EBXA 1HAJA 3NEQA 5DO6A 1I02A 6EBXA 2N99A 1IDHA 2QJ9C 2I9BE 5IMYC 2QJBC 1CB9A 2L03A 3VTSA 1CDQA 1YWHA 1F8UB 1CRFA 3NDSA 3PLCA 1FASA 1NEAA 2QC1A 1COEA 1IDLA 3BT1U 1CREA 1FSCA 1BTEA 1XT3A 4P7UA 2MUPA 5DU1A 1B41B 2PJYB 3NH7A 3EVSC 1S4YA 2BHIA 2VLWA 1QM7A 2ABXA 2MJ0A 1CXOA 1FRAA 1REWC 1IJCA 4XJJA 2CRSA 2H64B 3U73U 1IK8A 5DZ5A 4DO8A 2QJAC 1CVOA 2MJYA 1CXNA 2K3GA 1TFSA 1LX5B 3EBXA 2CCXA 2HLQA 2PJYC 3QB4B 1ABTA 1HC9B 1IDGA 2UWRA 2MUOA 1BXPA 1LJZA 4LFTA 1JGKA 3FEVA 1ES7B 2UX2A 3HH7A 4QTIU 2LA1A 1IDIA 1CCQA 1NYUA 2J8BA 2L5SA 4RUDA 1HC9A 4OM5A 2H62C 2H8UA 3LAQU 1KXIA 2CTXA 3KFDI 1ERGA 1KFHA 1PLOA 1V6PA 1NORA 4EY8B 1ERAA 1FSSB 1KC4A
chains in the Genus database with same CATH topology
1NTXA 1TXBA 1IKCA 1KL8A 4FAOC 3ERAA 2H64C 1HAAA 1KTZB 1H0JA 2H62D 2H7ZB 4HQPF 4BDTB 1JE9A 1CHVS 2H5FA 3U74U 2GOOB 1VB0A 1FF4A 4AEAA 1CDRA 1RGJA 1QKEA 2MJ4A 1F94A 2NBTA 1LXGA 4KSNA 4UY2C 1NYSA 2GOOC 4FAOE 2H7ZA 1LSIA 4OM4A 3KFDE 1CDTA 1HOYA 1L4WA 2BTXA 1FFJA 1LXHA 1KBTA 1G6MA 1QKDA 1KS6A 2CRTA 2X8BB 2HLRA 2JVEA 1CTXA 4ZQYA 4IYEA 2LCRA 1ONJA 1KBSA 1MR6A 1RL5A 2JQPA 1W6BA 3BT2U 2MFAA 1DRSA 1TGXA 5IMTD 1NXBA 2FD6U 1KU6B 4BIKB 1TXAA 2ERAA 1KBAA 1M9ZA 1JBDA 1IQ9A 1CODA 1MAHF 2MHYA 1NTNA 1CDSA 1ZADA 2OFSA 2CDXA 1UG4A 5EBXA 1HAJA 3NEQA 5DO6A 1I02A 6EBXA 2N99A 1IDHA 2QJ9C 2I9BE 5IMYC 2QJBC 1CB9A 2L03A 3VTSA 1CDQA 1YWHA 1F8UB 1CRFA 3NDSA 3PLCA 1FASA 1NEAA 2QC1A 1COEA 1IDLA 3BT1U 1CREA 1FSCA 1BTEA 1XT3A 4P7UA 2MUPA 5DU1A 1B41B 2PJYB 3NH7A 3EVSC 1S4YA 2BHIA 2VLWA 1QM7A 2ABXA 2MJ0A 1CXOA 1FRAA 1REWC 1IJCA 4XJJA 2CRSA 2H64B 3U73U 1IK8A 5DZ5A 4DO8A 2QJAC 1CVOA 2MJYA 1CXNA 2K3GA 1TFSA 1LX5B 3EBXA 2CCXA 2HLQA 2PJYC 3QB4B 1ABTA 1HC9B 1IDGA 2UWRA 2MUOA 1BXPA 1LJZA 4LFTA 1JGKA 3FEVA 1ES7B 2UX2A 3HH7A 4QTIU 2LA1A 1IDIA 1CCQA 1NYUA 2J8BA 2L5SA 4RUDA 1HC9A 4OM5A 2H62C 2H8UA 3LAQU 1KXIA 2CTXA 3KFDI 1ERGA 1KFHA 1PLOA 1V6PA 1NORA 4EY8B 1ERAA 1FSSB 1KC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTX A;  1TXB A;  1IKC A;  1KL8 A;  4FAO C;  3ERA A;  2H64 C;  1HAA A;  1KTZ B;  1H0J A;  2H62 D;  2H7Z B;  4HQP F;  4BDT B;  1JE9 A;  1CHV S;  2H5F A;  3U74 U;  2GOO B;  1VB0 A;  1FF4 A;  4AEA A;  1CDR A;  1RGJ A;  1QKE A;  2MJ4 A;  1F94 A;  2NBT A;  1LXG A;  4UY2 C;  1NYS A;  2GOO C;  4FAO E;  2H7Z A;  1LSI A;  4OM4 A;  3KFD E;  1CDT A;  1HOY A;  1L4W A;  2BTX A;  1FFJ A;  1LXH A;  1KBT A;  1G6M A;  1QKD A;  1KS6 A;  2CRT A;  2X8B B;  2HLR A;  2JVE A;  1CTX A;  4ZQY A;  4IYE A;  2LCR A;  1ONJ A;  1KBS A;  1MR6 A;  1RL5 A;  2JQP A;  1W6B A;  3BT2 U;  2MFA A;  1DRS A;  1TGX A;  5IMT D;  1NXB A;  2FD6 U;  1KU6 B;  4BIK B;  1TXA A;  2ERA A;  1KBA A;  1M9Z A;  1JBD A;  1IQ9 A;  1COD A;  1MAH F;  2MHY A;  1NTN A;  1CDS A;  1ZAD A;  2OFS A;  2CDX A;  1UG4 A;  5EBX A;  1HAJ A;  3NEQ A;  5DO6 A;  1I02 A;  6EBX A;  2N99 A;  1IDH A;  2QJ9 C;  2I9B E;  5IMY C;  2QJB C;  1CB9 A;  2L03 A;  3VTS A;  1CDQ A;  1YWH A;  1F8U B;  1CRF A;  3NDS A;  3PLC A;  1FAS A;  1NEA A;  2QC1 A;  1COE A;  1IDL A;  3BT1 U;  1CRE A;  1FSC A;  1BTE A;  1XT3 A;  4P7U A;  2MUP A;  5DU1 A;  1B41 B;  2PJY B;  3NH7 A;  3EVS C;  1S4Y A;  2BHI A;  2VLW A;  1QM7 A;  2ABX A;  2MJ0 A;  1CXO A;  1FRA A;  1REW C;  1IJC A;  4XJJ A;  2CRS A;  2H64 B;  3U73 U;  1IK8 A;  5DZ5 A;  4DO8 A;  2QJA C;  1CVO A;  2MJY A;  1CXN A;  2K3G A;  1TFS A;  1LX5 B;  3EBX A;  2CCX A;  2HLQ A;  2PJY C;  3QB4 B;  1ABT A;  1HC9 B;  1IDG A;  2UWR A;  2MUO A;  1BXP A;  1LJZ A;  4LFT A;  1JGK A;  3FEV A;  1ES7 B;  2UX2 A;  3HH7 A;  4QTI U;  2LA1 A;  1IDI A;  1CCQ A;  1NYU A;  2J8B A;  2L5S A;  4RUD A;  1HC9 A;  4OM5 A;  2H62 C;  2H8U A;  3LAQ U;  1KXI A;  2CTX A;  3KFD I;  1ERG A;  1KFH A;  1PLO A;  1V6P A;  1NOR A;  4EY8 B;  1ERA A;  1FSS B;  1KC4 A; 
#chains in the Genus database with same CATH topology
 1NTX A;  1TXB A;  1IKC A;  1KL8 A;  4FAO C;  3ERA A;  2H64 C;  1HAA A;  1KTZ B;  1H0J A;  2H62 D;  2H7Z B;  4HQP F;  4BDT B;  1JE9 A;  1CHV S;  2H5F A;  3U74 U;  2GOO B;  1VB0 A;  1FF4 A;  4AEA A;  1CDR A;  1RGJ A;  1QKE A;  2MJ4 A;  1F94 A;  2NBT A;  1LXG A;  4KSN A;  4UY2 C;  1NYS A;  2GOO C;  4FAO E;  2H7Z A;  1LSI A;  4OM4 A;  3KFD E;  1CDT A;  1HOY A;  1L4W A;  2BTX A;  1FFJ A;  1LXH A;  1KBT A;  1G6M A;  1QKD A;  1KS6 A;  2CRT A;  2X8B B;  2HLR A;  2JVE A;  1CTX A;  4ZQY A;  4IYE A;  2LCR A;  1ONJ A;  1KBS A;  1MR6 A;  1RL5 A;  2JQP A;  1W6B A;  3BT2 U;  2MFA A;  1DRS A;  1TGX A;  5IMT D;  1NXB A;  2FD6 U;  1KU6 B;  4BIK B;  1TXA A;  2ERA A;  1KBA A;  1M9Z A;  1JBD A;  1IQ9 A;  1COD A;  1MAH F;  2MHY A;  1NTN A;  1CDS A;  1ZAD A;  2OFS A;  2CDX A;  1UG4 A;  5EBX A;  1HAJ A;  3NEQ A;  5DO6 A;  1I02 A;  6EBX A;  2N99 A;  1IDH A;  2QJ9 C;  2I9B E;  5IMY C;  2QJB C;  1CB9 A;  2L03 A;  3VTS A;  1CDQ A;  1YWH A;  1F8U B;  1CRF A;  3NDS A;  3PLC A;  1FAS A;  1NEA A;  2QC1 A;  1COE A;  1IDL A;  3BT1 U;  1CRE A;  1FSC A;  1BTE A;  1XT3 A;  4P7U A;  2MUP A;  5DU1 A;  1B41 B;  2PJY B;  3NH7 A;  3EVS C;  1S4Y A;  2BHI A;  2VLW A;  1QM7 A;  2ABX A;  2MJ0 A;  1CXO A;  1FRA A;  1REW C;  1IJC A;  4XJJ A;  2CRS A;  2H64 B;  3U73 U;  1IK8 A;  5DZ5 A;  4DO8 A;  2QJA C;  1CVO A;  2MJY A;  1CXN A;  2K3G A;  1TFS A;  1LX5 B;  3EBX A;  2CCX A;  2HLQ A;  2PJY C;  3QB4 B;  1ABT A;  1HC9 B;  1IDG A;  2UWR A;  2MUO A;  1BXP A;  1LJZ A;  4LFT A;  1JGK A;  3FEV A;  1ES7 B;  2UX2 A;  3HH7 A;  4QTI U;  2LA1 A;  1IDI A;  1CCQ A;  1NYU A;  2J8B A;  2L5S A;  4RUD A;  1HC9 A;  4OM5 A;  2H62 C;  2H8U A;  3LAQ U;  1KXI A;  2CTX A;  3KFD I;  1ERG A;  1KFH A;  1PLO A;  1V6P A;  1NOR A;  4EY8 B;  1ERA A;  1FSS B;  1KC4 A; 
#chains in the Genus database with same CATH homology
 1NTX A;  1TXB A;  1IKC A;  1KL8 A;  4FAO C;  3ERA A;  2H64 C;  1HAA A;  1KTZ B;  1H0J A;  2H62 D;  2H7Z B;  4HQP F;  4BDT B;  1JE9 A;  1CHV S;  2H5F A;  3U74 U;  2GOO B;  1VB0 A;  1FF4 A;  4AEA A;  1CDR A;  1RGJ A;  1QKE A;  2MJ4 A;  1F94 A;  2NBT A;  1LXG A;  4KSN A;  4UY2 C;  1NYS A;  2GOO C;  4FAO E;  2H7Z A;  1LSI A;  4OM4 A;  3KFD E;  1CDT A;  1HOY A;  1L4W A;  2BTX A;  1FFJ A;  1LXH A;  1KBT A;  1G6M A;  1QKD A;  1KS6 A;  2CRT A;  2X8B B;  2HLR A;  2JVE A;  1CTX A;  4ZQY A;  4IYE A;  2LCR A;  1ONJ A;  1KBS A;  1MR6 A;  1RL5 A;  2JQP A;  1W6B A;  3BT2 U;  2MFA A;  1DRS A;  1TGX A;  5IMT D;  1NXB A;  2FD6 U;  1KU6 B;  4BIK B;  1TXA A;  2ERA A;  1KBA A;  1M9Z A;  1JBD A;  1IQ9 A;  1COD A;  1MAH F;  2MHY A;  1NTN A;  1CDS A;  1ZAD A;  2OFS A;  2CDX A;  1UG4 A;  5EBX A;  1HAJ A;  3NEQ A;  5DO6 A;  1I02 A;  6EBX A;  2N99 A;  1IDH A;  2QJ9 C;  2I9B E;  5IMY C;  2QJB C;  1CB9 A;  2L03 A;  3VTS A;  1CDQ A;  1YWH A;  1F8U B;  1CRF A;  3NDS A;  3PLC A;  1FAS A;  1NEA A;  2QC1 A;  1COE A;  1IDL A;  3BT1 U;  1CRE A;  1FSC A;  1BTE A;  1XT3 A;  4P7U A;  2MUP A;  5DU1 A;  1B41 B;  2PJY B;  3NH7 A;  3EVS C;  1S4Y A;  2BHI A;  2VLW A;  1QM7 A;  2ABX A;  2MJ0 A;  1CXO A;  1FRA A;  1REW C;  1IJC A;  4XJJ A;  2CRS A;  2H64 B;  3U73 U;  1IK8 A;  5DZ5 A;  4DO8 A;  2QJA C;  1CVO A;  2MJY A;  1CXN A;  2K3G A;  1TFS A;  1LX5 B;  3EBX A;  2CCX A;  2HLQ A;  2PJY C;  3QB4 B;  1ABT A;  1HC9 B;  1IDG A;  2UWR A;  2MUO A;  1BXP A;  1LJZ A;  4LFT A;  1JGK A;  3FEV A;  1ES7 B;  2UX2 A;  3HH7 A;  4QTI U;  2LA1 A;  1IDI A;  1CCQ A;  1NYU A;  2J8B A;  2L5S A;  4RUD A;  1HC9 A;  4OM5 A;  2H62 C;  2H8U A;  3LAQ U;  1KXI A;  2CTX A;  3KFD I;  1ERG A;  1KFH A;  1PLO A;  1V6P A;  1NOR A;  4EY8 B;  1ERA A;  1FSS B;  1KC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...