2PJYB

Structural basis for cooperative assembly of the tgf-beta signaling complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
108
structure length
108
Chain Sequence
AGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/cytokine receptor
molecule keywords Transforming growth factor beta-3
publication title Cooperative assembly of TGF-beta superfamily signaling complexes is mediated by two disparate mechanisms and distinct modes of receptor binding.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 108
sequence length 108
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-04-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2pjyB00
1KBAA 1FSCA 1HC9B 1KL8A 1FSSB 1CDTA 2ERAA 2GOOC 1V6PA 4XJJA 5DZ5A 1HAJA 2H62C 4FAOE 2BTXA 2J8BA 2NBTA 2QJBC 2OFSA 2CTXA 1KU6B 4AEAA 2K3GA 1FF4A 2H8UA 5EBXA 1I02A 3NDSA 2X8BB 2UX2A 4LFTA 1S4YA 1CDSA 1HC9A 1HOYA 1NYSA 2MJ0A 2PJYB 3ERAA 2H62D 2FD6U 2H64B 1LJZA 1QKDA 3VTSA 6EBXA 2QJAC 1QM7A 1CTXA 1COEA 2GOOB 1CRFA 4EY8B 1NTNA 4QTIU 1IQ9A 4ZQYA 1ZADA 2MHYA 1IDIA 1CXNA 2MUOA 1PLOA 2HLRA 3EBXA 4IYEA 2CDXA 4P7UA 2MJ4A 1FASA 3FEVA 3BT1U 2VLWA 1LXGA 1NTXA 2LCRA 1TGXA 1H0JA 1W6BA 1CB9A 1LX5B 2LA1A 1CDRA 3PLCA 1ERAA 4HQPF 2MJYA 1JBDA 1IKCA 2I9BE 1XT3A 4DO8A 1IDGA 1KTZB 2CRSA 1JGKA 2BHIA 1IJCA 1TXAA 5IMYC 1LSIA 1FRAA 1F94A 4UY2C 1YWHA 1IDLA 2N99A 2H7ZB 3EVSC 1ABTA 3KFDI 1NYUA 3NEQA 2H5FA 2MFAA 1FFJA 3KFDE 1F8UB 1MR6A 4OM5A 2MUPA 1UG4A 3HH7A 1NEAA 1KXIA 2QC1A 1LXHA 1VB0A 2CCXA 1G6MA 1CREA 2ABXA 1CXOA 3BT2U 1QKEA 5DU1A 1CVOA 1L4WA 1BXPA 1B41B 1CHVS 2UWRA 1BTEA 2H7ZA 4FAOC 1HAAA 1TXBA 5DO6A 1RGJA 3QB4B 1KS6A 1RL5A 2L03A 1M9ZA 1REWC 4BIKB 1DRSA 5IMTD 1KC4A 3U74U 1ES7B 1KFHA 1TFSA 2JVEA 1NXBA 2PJYC 4BDTB 1MAHF 4OM4A 1IK8A 1ERGA 2QJ9C 2HLQA 4RUDA 1KBTA 1CODA 2CRTA 3LAQU 2L5SA 3NH7A 3U73U 2H64C 2JQPA 1CCQA 1ONJA 1CDQA 1KBSA 1NORA 1JE9A 1IDHA
chains in the Genus database with same CATH superfamily
1KBAA 1FSCA 1HC9B 1KL8A 1FSSB 1CDTA 2ERAA 2GOOC 1V6PA 4XJJA 5DZ5A 1HAJA 2H62C 4FAOE 2BTXA 2J8BA 2NBTA 4KSNA 2QJBC 2OFSA 2CTXA 1KU6B 4AEAA 2K3GA 1FF4A 2H8UA 5EBXA 1I02A 3NDSA 2X8BB 2UX2A 4LFTA 1S4YA 1CDSA 1HC9A 1HOYA 1NYSA 2MJ0A 2PJYB 3ERAA 2H62D 2FD6U 2H64B 1LJZA 1QKDA 3VTSA 6EBXA 2QJAC 1QM7A 1CTXA 1COEA 2GOOB 1CRFA 4EY8B 1NTNA 4QTIU 1IQ9A 4ZQYA 1ZADA 2MHYA 1IDIA 1CXNA 2MUOA 1PLOA 2HLRA 3EBXA 4IYEA 2CDXA 4P7UA 2MJ4A 1FASA 3FEVA 3BT1U 2VLWA 1LXGA 1NTXA 2LCRA 1TGXA 1H0JA 1W6BA 1CB9A 1LX5B 2LA1A 1CDRA 3PLCA 1ERAA 4HQPF 2MJYA 1JBDA 1IKCA 2I9BE 1XT3A 4DO8A 1IDGA 1KTZB 2CRSA 1JGKA 2BHIA 1IJCA 1TXAA 5IMYC 1LSIA 1FRAA 1F94A 4UY2C 1YWHA 1IDLA 2N99A 2H7ZB 3EVSC 1ABTA 3KFDI 1NYUA 3NEQA 2H5FA 2MFAA 1FFJA 3KFDE 1F8UB 1MR6A 4OM5A 2MUPA 1UG4A 3HH7A 1NEAA 1KXIA 2QC1A 1LXHA 1VB0A 2CCXA 1G6MA 1CREA 2ABXA 1CXOA 3BT2U 1QKEA 5DU1A 1CVOA 1L4WA 1BXPA 1B41B 1CHVS 2UWRA 1BTEA 2H7ZA 4FAOC 1HAAA 1TXBA 5DO6A 1RGJA 3QB4B 1KS6A 1RL5A 2L03A 1M9ZA 1REWC 4BIKB 1DRSA 5IMTD 1KC4A 3U74U 1ES7B 1KFHA 1TFSA 2JVEA 1NXBA 2PJYC 4BDTB 1MAHF 4OM4A 1IK8A 1ERGA 2QJ9C 2HLQA 4RUDA 1KBTA 1CODA 2CRTA 3LAQU 2L5SA 3NH7A 3U73U 2H64C 2JQPA 1CCQA 1ONJA 1CDQA 1KBSA 1NORA 1JE9A 1IDHA
chains in the Genus database with same CATH topology
1KBAA 1FSCA 1HC9B 1KL8A 1FSSB 1CDTA 2ERAA 2GOOC 1V6PA 4XJJA 5DZ5A 1HAJA 2H62C 4FAOE 2BTXA 2J8BA 2NBTA 4KSNA 2QJBC 2OFSA 2CTXA 1KU6B 4AEAA 2K3GA 1FF4A 2H8UA 5EBXA 1I02A 3NDSA 2X8BB 2UX2A 4LFTA 1S4YA 1CDSA 1HC9A 1HOYA 1NYSA 2MJ0A 2PJYB 3ERAA 2H62D 2FD6U 2H64B 1LJZA 1QKDA 3VTSA 6EBXA 2QJAC 1QM7A 1CTXA 1COEA 2GOOB 1CRFA 4EY8B 1NTNA 4QTIU 1IQ9A 4ZQYA 1ZADA 2MHYA 1IDIA 1CXNA 2MUOA 1PLOA 2HLRA 3EBXA 4IYEA 2CDXA 4P7UA 2MJ4A 1FASA 3FEVA 3BT1U 2VLWA 1LXGA 1NTXA 2LCRA 1TGXA 1H0JA 1W6BA 1CB9A 1LX5B 2LA1A 1CDRA 3PLCA 1ERAA 4HQPF 2MJYA 1JBDA 1IKCA 2I9BE 1XT3A 4DO8A 1IDGA 1KTZB 2CRSA 1JGKA 2BHIA 1IJCA 1TXAA 5IMYC 1LSIA 1FRAA 1F94A 4UY2C 1YWHA 1IDLA 2N99A 2H7ZB 3EVSC 1ABTA 3KFDI 1NYUA 3NEQA 2H5FA 2MFAA 1FFJA 3KFDE 1F8UB 1MR6A 4OM5A 2MUPA 1UG4A 3HH7A 1NEAA 1KXIA 2QC1A 1LXHA 1VB0A 2CCXA 1G6MA 1CREA 2ABXA 1CXOA 3BT2U 1QKEA 5DU1A 1CVOA 1L4WA 1BXPA 1B41B 1CHVS 2UWRA 1BTEA 2H7ZA 4FAOC 1HAAA 1TXBA 5DO6A 1RGJA 3QB4B 1KS6A 1RL5A 2L03A 1M9ZA 1REWC 4BIKB 1DRSA 5IMTD 1KC4A 3U74U 1ES7B 1KFHA 1TFSA 2JVEA 1NXBA 2PJYC 4BDTB 1MAHF 4OM4A 1IK8A 1ERGA 2QJ9C 2HLQA 4RUDA 1KBTA 1CODA 2CRTA 3LAQU 2L5SA 3NH7A 3U73U 2H64C 2JQPA 1CCQA 1ONJA 1CDQA 1KBSA 1NORA 1JE9A 1IDHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KBA A;  1FSC A;  1HC9 B;  1KL8 A;  1FSS B;  1CDT A;  2ERA A;  2GOO C;  1V6P A;  4XJJ A;  5DZ5 A;  1HAJ A;  2H62 C;  4FAO E;  2BTX A;  2J8B A;  2NBT A;  2QJB C;  2OFS A;  2CTX A;  1KU6 B;  4AEA A;  2K3G A;  1FF4 A;  2H8U A;  5EBX A;  1I02 A;  3NDS A;  2X8B B;  2UX2 A;  4LFT A;  1S4Y A;  1CDS A;  1HC9 A;  1HOY A;  1NYS A;  2MJ0 A;  2PJY B;  3ERA A;  2H62 D;  2FD6 U;  2H64 B;  1LJZ A;  1QKD A;  3VTS A;  6EBX A;  2QJA C;  1QM7 A;  1CTX A;  1COE A;  2GOO B;  1CRF A;  4EY8 B;  1NTN A;  4QTI U;  1IQ9 A;  4ZQY A;  1ZAD A;  2MHY A;  1IDI A;  1CXN A;  2MUO A;  1PLO A;  2HLR A;  3EBX A;  4IYE A;  2CDX A;  4P7U A;  2MJ4 A;  1FAS A;  3FEV A;  3BT1 U;  2VLW A;  1LXG A;  1NTX A;  2LCR A;  1TGX A;  1H0J A;  1W6B A;  1CB9 A;  1LX5 B;  2LA1 A;  1CDR A;  3PLC A;  1ERA A;  4HQP F;  2MJY A;  1JBD A;  1IKC A;  2I9B E;  1XT3 A;  4DO8 A;  1IDG A;  1KTZ B;  2CRS A;  1JGK A;  2BHI A;  1IJC A;  1TXA A;  5IMY C;  1LSI A;  1FRA A;  1F94 A;  4UY2 C;  1YWH A;  1IDL A;  2N99 A;  2H7Z B;  3EVS C;  1ABT A;  3KFD I;  1NYU A;  3NEQ A;  2H5F A;  2MFA A;  1FFJ A;  3KFD E;  1F8U B;  1MR6 A;  4OM5 A;  2MUP A;  1UG4 A;  3HH7 A;  1NEA A;  1KXI A;  2QC1 A;  1LXH A;  1VB0 A;  2CCX A;  1G6M A;  1CRE A;  2ABX A;  1CXO A;  3BT2 U;  1QKE A;  5DU1 A;  1CVO A;  1L4W A;  1BXP A;  1B41 B;  1CHV S;  2UWR A;  1BTE A;  2H7Z A;  4FAO C;  1HAA A;  1TXB A;  5DO6 A;  1RGJ A;  3QB4 B;  1KS6 A;  1RL5 A;  2L03 A;  1M9Z A;  1REW C;  4BIK B;  1DRS A;  5IMT D;  1KC4 A;  3U74 U;  1ES7 B;  1KFH A;  1TFS A;  2JVE A;  1NXB A;  2PJY C;  4BDT B;  1MAH F;  4OM4 A;  1IK8 A;  1ERG A;  2QJ9 C;  2HLQ A;  4RUD A;  1KBT A;  1COD A;  2CRT A;  3LAQ U;  2L5S A;  3NH7 A;  3U73 U;  2H64 C;  2JQP A;  1CCQ A;  1ONJ A;  1CDQ A;  1KBS A;  1NOR A;  1JE9 A;  1IDH A; 
#chains in the Genus database with same CATH topology
 1KBA A;  1FSC A;  1HC9 B;  1KL8 A;  1FSS B;  1CDT A;  2ERA A;  2GOO C;  1V6P A;  4XJJ A;  5DZ5 A;  1HAJ A;  2H62 C;  4FAO E;  2BTX A;  2J8B A;  2NBT A;  4KSN A;  2QJB C;  2OFS A;  2CTX A;  1KU6 B;  4AEA A;  2K3G A;  1FF4 A;  2H8U A;  5EBX A;  1I02 A;  3NDS A;  2X8B B;  2UX2 A;  4LFT A;  1S4Y A;  1CDS A;  1HC9 A;  1HOY A;  1NYS A;  2MJ0 A;  2PJY B;  3ERA A;  2H62 D;  2FD6 U;  2H64 B;  1LJZ A;  1QKD A;  3VTS A;  6EBX A;  2QJA C;  1QM7 A;  1CTX A;  1COE A;  2GOO B;  1CRF A;  4EY8 B;  1NTN A;  4QTI U;  1IQ9 A;  4ZQY A;  1ZAD A;  2MHY A;  1IDI A;  1CXN A;  2MUO A;  1PLO A;  2HLR A;  3EBX A;  4IYE A;  2CDX A;  4P7U A;  2MJ4 A;  1FAS A;  3FEV A;  3BT1 U;  2VLW A;  1LXG A;  1NTX A;  2LCR A;  1TGX A;  1H0J A;  1W6B A;  1CB9 A;  1LX5 B;  2LA1 A;  1CDR A;  3PLC A;  1ERA A;  4HQP F;  2MJY A;  1JBD A;  1IKC A;  2I9B E;  1XT3 A;  4DO8 A;  1IDG A;  1KTZ B;  2CRS A;  1JGK A;  2BHI A;  1IJC A;  1TXA A;  5IMY C;  1LSI A;  1FRA A;  1F94 A;  4UY2 C;  1YWH A;  1IDL A;  2N99 A;  2H7Z B;  3EVS C;  1ABT A;  3KFD I;  1NYU A;  3NEQ A;  2H5F A;  2MFA A;  1FFJ A;  3KFD E;  1F8U B;  1MR6 A;  4OM5 A;  2MUP A;  1UG4 A;  3HH7 A;  1NEA A;  1KXI A;  2QC1 A;  1LXH A;  1VB0 A;  2CCX A;  1G6M A;  1CRE A;  2ABX A;  1CXO A;  3BT2 U;  1QKE A;  5DU1 A;  1CVO A;  1L4W A;  1BXP A;  1B41 B;  1CHV S;  2UWR A;  1BTE A;  2H7Z A;  4FAO C;  1HAA A;  1TXB A;  5DO6 A;  1RGJ A;  3QB4 B;  1KS6 A;  1RL5 A;  2L03 A;  1M9Z A;  1REW C;  4BIK B;  1DRS A;  5IMT D;  1KC4 A;  3U74 U;  1ES7 B;  1KFH A;  1TFS A;  2JVE A;  1NXB A;  2PJY C;  4BDT B;  1MAH F;  4OM4 A;  1IK8 A;  1ERG A;  2QJ9 C;  2HLQ A;  4RUD A;  1KBT A;  1COD A;  2CRT A;  3LAQ U;  2L5S A;  3NH7 A;  3U73 U;  2H64 C;  2JQP A;  1CCQ A;  1ONJ A;  1CDQ A;  1KBS A;  1NOR A;  1JE9 A;  1IDH A; 
#chains in the Genus database with same CATH homology
 1KBA A;  1FSC A;  1HC9 B;  1KL8 A;  1FSS B;  1CDT A;  2ERA A;  2GOO C;  1V6P A;  4XJJ A;  5DZ5 A;  1HAJ A;  2H62 C;  4FAO E;  2BTX A;  2J8B A;  2NBT A;  4KSN A;  2QJB C;  2OFS A;  2CTX A;  1KU6 B;  4AEA A;  2K3G A;  1FF4 A;  2H8U A;  5EBX A;  1I02 A;  3NDS A;  2X8B B;  2UX2 A;  4LFT A;  1S4Y A;  1CDS A;  1HC9 A;  1HOY A;  1NYS A;  2MJ0 A;  2PJY B;  3ERA A;  2H62 D;  2FD6 U;  2H64 B;  1LJZ A;  1QKD A;  3VTS A;  6EBX A;  2QJA C;  1QM7 A;  1CTX A;  1COE A;  2GOO B;  1CRF A;  4EY8 B;  1NTN A;  4QTI U;  1IQ9 A;  4ZQY A;  1ZAD A;  2MHY A;  1IDI A;  1CXN A;  2MUO A;  1PLO A;  2HLR A;  3EBX A;  4IYE A;  2CDX A;  4P7U A;  2MJ4 A;  1FAS A;  3FEV A;  3BT1 U;  2VLW A;  1LXG A;  1NTX A;  2LCR A;  1TGX A;  1H0J A;  1W6B A;  1CB9 A;  1LX5 B;  2LA1 A;  1CDR A;  3PLC A;  1ERA A;  4HQP F;  2MJY A;  1JBD A;  1IKC A;  2I9B E;  1XT3 A;  4DO8 A;  1IDG A;  1KTZ B;  2CRS A;  1JGK A;  2BHI A;  1IJC A;  1TXA A;  5IMY C;  1LSI A;  1FRA A;  1F94 A;  4UY2 C;  1YWH A;  1IDL A;  2N99 A;  2H7Z B;  3EVS C;  1ABT A;  3KFD I;  1NYU A;  3NEQ A;  2H5F A;  2MFA A;  1FFJ A;  3KFD E;  1F8U B;  1MR6 A;  4OM5 A;  2MUP A;  1UG4 A;  3HH7 A;  1NEA A;  1KXI A;  2QC1 A;  1LXH A;  1VB0 A;  2CCX A;  1G6M A;  1CRE A;  2ABX A;  1CXO A;  3BT2 U;  1QKE A;  5DU1 A;  1CVO A;  1L4W A;  1BXP A;  1B41 B;  1CHV S;  2UWR A;  1BTE A;  2H7Z A;  4FAO C;  1HAA A;  1TXB A;  5DO6 A;  1RGJ A;  3QB4 B;  1KS6 A;  1RL5 A;  2L03 A;  1M9Z A;  1REW C;  4BIK B;  1DRS A;  5IMT D;  1KC4 A;  3U74 U;  1ES7 B;  1KFH A;  1TFS A;  2JVE A;  1NXB A;  2PJY C;  4BDT B;  1MAH F;  4OM4 A;  1IK8 A;  1ERG A;  2QJ9 C;  2HLQ A;  4RUD A;  1KBT A;  1COD A;  2CRT A;  3LAQ U;  2L5S A;  3NH7 A;  3U73 U;  2H64 C;  2JQP A;  1CCQ A;  1ONJ A;  1CDQ A;  1KBS A;  1NOR A;  1JE9 A;  1IDH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...