1JBDA

Nmr structure of the complex between alpha-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1jbdA00
4AEAA 1TXBA 1CREA 2HLQA 3LAQU 1ABTA 2N99A 2VLWA 4IYEA 2MJYA 5IMTD 2PJYB 1NORA 2ERAA 1MR6A 2JVEA 1KU6B 4QTIU 2LCRA 3NH7A 1PLOA 1XT3A 1NEAA 1UG4A 3U74U 1KXIA 1LJZA 4XJJA 2H5FA 1KTZB 4P7UA 1CDSA 4LFTA 5EBXA 2H62D 3NDSA 1ZADA 5IMYC 2L03A 1JGKA 1IDLA 2K3GA 4FAOE 1KC4A 2CTXA 3FEVA 2MFAA 2FD6U 2PJYC 3KFDI 3ERAA 1HC9A 1IDHA 1CB9A 1IDGA 5DZ5A 2UWRA 1CDQA 1CXNA 2OFSA 1QKEA 1HAAA 5DO6A 1NYUA 2HLRA 6EBXA 1KS6A 2LA1A 2H7ZA 1NYSA 2JQPA 4FAOC 1KBSA 2CRTA 1FSCA 1JE9A 1KBTA 1NXBA 4DO8A 1BTEA 1FFJA 1ERAA 1RL5A 2BHIA 1IKCA 5DU1A 1KBAA 3NEQA 4ZQYA 4BIKB 1REWC 1QKDA 1CODA 1KL8A 1ONJA 1TXAA 1KFHA 1IDIA 4HQPF 2MJ4A 1COEA 2QC1A 1LSIA 1M9ZA 1MAHF 1ERGA 3HH7A 1BXPA 2CCXA 1HAJA 4RUDA 1V6PA 3EBXA 1CVOA 2GOOB 1ES7B 2I9BE 2QJAC 1W6BA 2QJ9C 1JBDA 1CCQA 2MJ0A 3BT2U 1F8UB 1TGXA 1FRAA 1CHVS 2MUPA 3KFDE 1IQ9A 2H8UA 2MHYA 1I02A 3VTSA 2H64B 1LXHA 1HC9B 1CDRA 1CXOA 1NTNA 3BT1U 2ABXA 1L4WA 1H0JA 1S4YA 2L5SA 2CRSA 2H62C 1G6MA 1TFSA 1B41B 2NBTA 2GOOC 2CDXA 1FF4A 1QM7A 2H7ZB 4EY8B 1RGJA 1IJCA 2QJBC 2BTXA 3PLCA 1CRFA 3U73U 1FASA 4OM5A 1F94A 4BDTB 1YWHA 1DRSA 1LX5B 1CTXA 1HOYA 1LXGA 2MUOA 2H64C 2UX2A 3EVSC 1NTXA 4UY2C 1CDTA 2J8BA 1IK8A 1FSSB 4OM4A 2X8BB 3QB4B 1VB0A
chains in the Genus database with same CATH superfamily
4AEAA 1TXBA 1CREA 2HLQA 3LAQU 1ABTA 2N99A 2VLWA 4IYEA 2MJYA 5IMTD 2PJYB 1NORA 2ERAA 1MR6A 2JVEA 1KU6B 4QTIU 2LCRA 3NH7A 1PLOA 1XT3A 1NEAA 1UG4A 3U74U 1KXIA 1LJZA 4XJJA 2H5FA 1KTZB 4P7UA 1CDSA 4LFTA 5EBXA 2H62D 3NDSA 1ZADA 5IMYC 2L03A 1JGKA 1IDLA 2K3GA 4FAOE 1KC4A 2CTXA 3FEVA 2MFAA 2FD6U 2PJYC 3KFDI 3ERAA 1HC9A 1IDHA 1CB9A 1IDGA 5DZ5A 2UWRA 1CDQA 1CXNA 2OFSA 1QKEA 1HAAA 5DO6A 1NYUA 2HLRA 6EBXA 1KS6A 2LA1A 2H7ZA 1NYSA 2JQPA 4FAOC 1KBSA 2CRTA 1FSCA 1JE9A 1KBTA 1NXBA 4DO8A 1BTEA 1FFJA 1ERAA 1RL5A 2BHIA 1IKCA 5DU1A 1KBAA 3NEQA 4ZQYA 4BIKB 1REWC 1QKDA 1CODA 1KL8A 1ONJA 1TXAA 1KFHA 1IDIA 4HQPF 2MJ4A 1COEA 2QC1A 1LSIA 1M9ZA 1MAHF 1ERGA 3HH7A 1BXPA 2CCXA 1HAJA 4RUDA 1V6PA 3EBXA 1CVOA 2GOOB 1ES7B 2I9BE 2QJAC 1W6BA 2QJ9C 1JBDA 1CCQA 2MJ0A 3BT2U 1F8UB 1TGXA 1FRAA 1CHVS 2MUPA 3KFDE 1IQ9A 2H8UA 2MHYA 1I02A 3VTSA 2H64B 1LXHA 1HC9B 1CDRA 1CXOA 1NTNA 3BT1U 4KSNA 2ABXA 1L4WA 1H0JA 1S4YA 2L5SA 2CRSA 2H62C 1G6MA 1TFSA 1B41B 2NBTA 2GOOC 2CDXA 1FF4A 1QM7A 2H7ZB 4EY8B 1RGJA 1IJCA 2QJBC 2BTXA 3PLCA 1CRFA 3U73U 1FASA 4OM5A 1F94A 4BDTB 1YWHA 1DRSA 1LX5B 1CTXA 1HOYA 1LXGA 2MUOA 2H64C 2UX2A 3EVSC 1NTXA 4UY2C 1CDTA 2J8BA 1IK8A 1FSSB 4OM4A 2X8BB 3QB4B 1VB0A
chains in the Genus database with same CATH topology
4AEAA 1TXBA 1CREA 2HLQA 3LAQU 1ABTA 2N99A 2VLWA 4IYEA 2MJYA 5IMTD 2PJYB 1NORA 2ERAA 1MR6A 2JVEA 1KU6B 4QTIU 2LCRA 3NH7A 1PLOA 1XT3A 1NEAA 1UG4A 3U74U 1KXIA 1LJZA 4XJJA 2H5FA 1KTZB 4P7UA 1CDSA 4LFTA 5EBXA 2H62D 3NDSA 1ZADA 5IMYC 2L03A 1JGKA 1IDLA 2K3GA 4FAOE 1KC4A 2CTXA 3FEVA 2MFAA 2FD6U 2PJYC 3KFDI 3ERAA 1HC9A 1IDHA 1CB9A 1IDGA 5DZ5A 2UWRA 1CDQA 1CXNA 2OFSA 1QKEA 1HAAA 5DO6A 1NYUA 2HLRA 6EBXA 1KS6A 2LA1A 2H7ZA 1NYSA 2JQPA 4FAOC 1KBSA 2CRTA 1FSCA 1JE9A 1KBTA 1NXBA 4DO8A 1BTEA 1FFJA 1ERAA 1RL5A 2BHIA 1IKCA 5DU1A 1KBAA 3NEQA 4ZQYA 4BIKB 1REWC 1QKDA 1CODA 1KL8A 1ONJA 1TXAA 1KFHA 1IDIA 4HQPF 2MJ4A 1COEA 2QC1A 1LSIA 1M9ZA 1MAHF 1ERGA 3HH7A 1BXPA 2CCXA 1HAJA 4RUDA 1V6PA 3EBXA 1CVOA 2GOOB 1ES7B 2I9BE 2QJAC 1W6BA 2QJ9C 1JBDA 1CCQA 2MJ0A 3BT2U 1F8UB 1TGXA 1FRAA 1CHVS 2MUPA 3KFDE 1IQ9A 2H8UA 2MHYA 1I02A 3VTSA 2H64B 1LXHA 1HC9B 1CDRA 1CXOA 1NTNA 3BT1U 4KSNA 2ABXA 1L4WA 1H0JA 1S4YA 2L5SA 2CRSA 2H62C 1G6MA 1TFSA 1B41B 2NBTA 2GOOC 2CDXA 1FF4A 1QM7A 2H7ZB 4EY8B 1RGJA 1IJCA 2QJBC 2BTXA 3PLCA 1CRFA 3U73U 1FASA 4OM5A 1F94A 4BDTB 1YWHA 1DRSA 1LX5B 1CTXA 1HOYA 1LXGA 2MUOA 2H64C 2UX2A 3EVSC 1NTXA 4UY2C 1CDTA 2J8BA 1IK8A 1FSSB 4OM4A 2X8BB 3QB4B 1VB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AEA A;  1TXB A;  1CRE A;  2HLQ A;  3LAQ U;  1ABT A;  2N99 A;  2VLW A;  4IYE A;  2MJY A;  5IMT D;  2PJY B;  1NOR A;  2ERA A;  1MR6 A;  2JVE A;  1KU6 B;  4QTI U;  2LCR A;  3NH7 A;  1PLO A;  1XT3 A;  1NEA A;  1UG4 A;  3U74 U;  1KXI A;  1LJZ A;  4XJJ A;  2H5F A;  1KTZ B;  4P7U A;  1CDS A;  4LFT A;  5EBX A;  2H62 D;  3NDS A;  1ZAD A;  5IMY C;  2L03 A;  1JGK A;  1IDL A;  2K3G A;  4FAO E;  1KC4 A;  2CTX A;  3FEV A;  2MFA A;  2FD6 U;  2PJY C;  3KFD I;  3ERA A;  1HC9 A;  1IDH A;  1CB9 A;  1IDG A;  5DZ5 A;  2UWR A;  1CDQ A;  1CXN A;  2OFS A;  1QKE A;  1HAA A;  5DO6 A;  1NYU A;  2HLR A;  6EBX A;  1KS6 A;  2LA1 A;  2H7Z A;  1NYS A;  2JQP A;  4FAO C;  1KBS A;  2CRT A;  1FSC A;  1JE9 A;  1KBT A;  1NXB A;  4DO8 A;  1BTE A;  1FFJ A;  1ERA A;  1RL5 A;  2BHI A;  1IKC A;  5DU1 A;  1KBA A;  3NEQ A;  4ZQY A;  4BIK B;  1REW C;  1QKD A;  1COD A;  1KL8 A;  1ONJ A;  1TXA A;  1KFH A;  1IDI A;  4HQP F;  2MJ4 A;  1COE A;  2QC1 A;  1LSI A;  1M9Z A;  1MAH F;  1ERG A;  3HH7 A;  1BXP A;  2CCX A;  1HAJ A;  4RUD A;  1V6P A;  3EBX A;  1CVO A;  2GOO B;  1ES7 B;  2I9B E;  2QJA C;  1W6B A;  2QJ9 C;  1JBD A;  1CCQ A;  2MJ0 A;  3BT2 U;  1F8U B;  1TGX A;  1FRA A;  1CHV S;  2MUP A;  3KFD E;  1IQ9 A;  2H8U A;  2MHY A;  1I02 A;  3VTS A;  2H64 B;  1LXH A;  1HC9 B;  1CDR A;  1CXO A;  1NTN A;  3BT1 U;  2ABX A;  1L4W A;  1H0J A;  1S4Y A;  2L5S A;  2CRS A;  2H62 C;  1G6M A;  1TFS A;  1B41 B;  2NBT A;  2GOO C;  2CDX A;  1FF4 A;  1QM7 A;  2H7Z B;  4EY8 B;  1RGJ A;  1IJC A;  2QJB C;  2BTX A;  3PLC A;  1CRF A;  3U73 U;  1FAS A;  4OM5 A;  1F94 A;  4BDT B;  1YWH A;  1DRS A;  1LX5 B;  1CTX A;  1HOY A;  1LXG A;  2MUO A;  2H64 C;  2UX2 A;  3EVS C;  1NTX A;  4UY2 C;  1CDT A;  2J8B A;  1IK8 A;  1FSS B;  4OM4 A;  2X8B B;  3QB4 B;  1VB0 A; 
#chains in the Genus database with same CATH topology
 4AEA A;  1TXB A;  1CRE A;  2HLQ A;  3LAQ U;  1ABT A;  2N99 A;  2VLW A;  4IYE A;  2MJY A;  5IMT D;  2PJY B;  1NOR A;  2ERA A;  1MR6 A;  2JVE A;  1KU6 B;  4QTI U;  2LCR A;  3NH7 A;  1PLO A;  1XT3 A;  1NEA A;  1UG4 A;  3U74 U;  1KXI A;  1LJZ A;  4XJJ A;  2H5F A;  1KTZ B;  4P7U A;  1CDS A;  4LFT A;  5EBX A;  2H62 D;  3NDS A;  1ZAD A;  5IMY C;  2L03 A;  1JGK A;  1IDL A;  2K3G A;  4FAO E;  1KC4 A;  2CTX A;  3FEV A;  2MFA A;  2FD6 U;  2PJY C;  3KFD I;  3ERA A;  1HC9 A;  1IDH A;  1CB9 A;  1IDG A;  5DZ5 A;  2UWR A;  1CDQ A;  1CXN A;  2OFS A;  1QKE A;  1HAA A;  5DO6 A;  1NYU A;  2HLR A;  6EBX A;  1KS6 A;  2LA1 A;  2H7Z A;  1NYS A;  2JQP A;  4FAO C;  1KBS A;  2CRT A;  1FSC A;  1JE9 A;  1KBT A;  1NXB A;  4DO8 A;  1BTE A;  1FFJ A;  1ERA A;  1RL5 A;  2BHI A;  1IKC A;  5DU1 A;  1KBA A;  3NEQ A;  4ZQY A;  4BIK B;  1REW C;  1QKD A;  1COD A;  1KL8 A;  1ONJ A;  1TXA A;  1KFH A;  1IDI A;  4HQP F;  2MJ4 A;  1COE A;  2QC1 A;  1LSI A;  1M9Z A;  1MAH F;  1ERG A;  3HH7 A;  1BXP A;  2CCX A;  1HAJ A;  4RUD A;  1V6P A;  3EBX A;  1CVO A;  2GOO B;  1ES7 B;  2I9B E;  2QJA C;  1W6B A;  2QJ9 C;  1JBD A;  1CCQ A;  2MJ0 A;  3BT2 U;  1F8U B;  1TGX A;  1FRA A;  1CHV S;  2MUP A;  3KFD E;  1IQ9 A;  2H8U A;  2MHY A;  1I02 A;  3VTS A;  2H64 B;  1LXH A;  1HC9 B;  1CDR A;  1CXO A;  1NTN A;  3BT1 U;  4KSN A;  2ABX A;  1L4W A;  1H0J A;  1S4Y A;  2L5S A;  2CRS A;  2H62 C;  1G6M A;  1TFS A;  1B41 B;  2NBT A;  2GOO C;  2CDX A;  1FF4 A;  1QM7 A;  2H7Z B;  4EY8 B;  1RGJ A;  1IJC A;  2QJB C;  2BTX A;  3PLC A;  1CRF A;  3U73 U;  1FAS A;  4OM5 A;  1F94 A;  4BDT B;  1YWH A;  1DRS A;  1LX5 B;  1CTX A;  1HOY A;  1LXG A;  2MUO A;  2H64 C;  2UX2 A;  3EVS C;  1NTX A;  4UY2 C;  1CDT A;  2J8B A;  1IK8 A;  1FSS B;  4OM4 A;  2X8B B;  3QB4 B;  1VB0 A; 
#chains in the Genus database with same CATH homology
 4AEA A;  1TXB A;  1CRE A;  2HLQ A;  3LAQ U;  1ABT A;  2N99 A;  2VLW A;  4IYE A;  2MJY A;  5IMT D;  2PJY B;  1NOR A;  2ERA A;  1MR6 A;  2JVE A;  1KU6 B;  4QTI U;  2LCR A;  3NH7 A;  1PLO A;  1XT3 A;  1NEA A;  1UG4 A;  3U74 U;  1KXI A;  1LJZ A;  4XJJ A;  2H5F A;  1KTZ B;  4P7U A;  1CDS A;  4LFT A;  5EBX A;  2H62 D;  3NDS A;  1ZAD A;  5IMY C;  2L03 A;  1JGK A;  1IDL A;  2K3G A;  4FAO E;  1KC4 A;  2CTX A;  3FEV A;  2MFA A;  2FD6 U;  2PJY C;  3KFD I;  3ERA A;  1HC9 A;  1IDH A;  1CB9 A;  1IDG A;  5DZ5 A;  2UWR A;  1CDQ A;  1CXN A;  2OFS A;  1QKE A;  1HAA A;  5DO6 A;  1NYU A;  2HLR A;  6EBX A;  1KS6 A;  2LA1 A;  2H7Z A;  1NYS A;  2JQP A;  4FAO C;  1KBS A;  2CRT A;  1FSC A;  1JE9 A;  1KBT A;  1NXB A;  4DO8 A;  1BTE A;  1FFJ A;  1ERA A;  1RL5 A;  2BHI A;  1IKC A;  5DU1 A;  1KBA A;  3NEQ A;  4ZQY A;  4BIK B;  1REW C;  1QKD A;  1COD A;  1KL8 A;  1ONJ A;  1TXA A;  1KFH A;  1IDI A;  4HQP F;  2MJ4 A;  1COE A;  2QC1 A;  1LSI A;  1M9Z A;  1MAH F;  1ERG A;  3HH7 A;  1BXP A;  2CCX A;  1HAJ A;  4RUD A;  1V6P A;  3EBX A;  1CVO A;  2GOO B;  1ES7 B;  2I9B E;  2QJA C;  1W6B A;  2QJ9 C;  1JBD A;  1CCQ A;  2MJ0 A;  3BT2 U;  1F8U B;  1TGX A;  1FRA A;  1CHV S;  2MUP A;  3KFD E;  1IQ9 A;  2H8U A;  2MHY A;  1I02 A;  3VTS A;  2H64 B;  1LXH A;  1HC9 B;  1CDR A;  1CXO A;  1NTN A;  3BT1 U;  4KSN A;  2ABX A;  1L4W A;  1H0J A;  1S4Y A;  2L5S A;  2CRS A;  2H62 C;  1G6M A;  1TFS A;  1B41 B;  2NBT A;  2GOO C;  2CDX A;  1FF4 A;  1QM7 A;  2H7Z B;  4EY8 B;  1RGJ A;  1IJC A;  2QJB C;  2BTX A;  3PLC A;  1CRF A;  3U73 U;  1FAS A;  4OM5 A;  1F94 A;  4BDT B;  1YWH A;  1DRS A;  1LX5 B;  1CTX A;  1HOY A;  1LXG A;  2MUO A;  2H64 C;  2UX2 A;  3EVS C;  1NTX A;  4UY2 C;  1CDT A;  2J8B A;  1IK8 A;  1FSS B;  4OM4 A;  2X8B B;  3QB4 B;  1VB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...