1JBDA

Nmr structure of the complex between alpha-bungarotoxin and a mimotope of the nicotinic acetylcholine receptor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
74
structure length
74
Chain Sequence
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords LONG NEUROTOXIN 1
publication title NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
pubmed doi rcsb
total genus 9
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2001-06-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1jbdA00
4BDTB 2H64C 1LXGA 2K3GA 2X8BB 1ERGA 2MJ0A 2PJYB 1FRAA 2N99A 1IJCA 5DU1A 2QJ9C 1COEA 1ZADA 1ABTA 2MJ4A 2H7ZA 1LXHA 4OM4A 1DRSA 2OFSA 2CRSA 1CTXA 2HLRA 1TFSA 1CDQA 1JE9A 3U73U 2ERAA 1LJZA 1FASA 1TXBA 3LAQU 2FD6U 1NTXA 4AEAA 6EBXA 1CVOA 1IDIA 1NEAA 2CTXA 3BT2U 1JGKA 2QC1A 2UX2A 2H7ZB 4LFTA 1RL5A 1CCQA 1CXOA 2MHYA 1KTZB 3HH7A 1CODA 2GOOC 1MR6A 4OM5A 5EBXA 1HAJA 1KBAA 1VB0A 3U74U 3FEVA 1FSCA 1H0JA 3PLCA 5IMYC 1NYSA 4UY2C 1NORA 3EBXA 2QJAC 1QKDA 2LCRA 2NBTA 4P7UA 5IMTD 2BTXA 1KL8A 4EY8B 5DZ5A 1PLOA 1REWC 2QJBC 1CDRA 5DO6A 2H64B 1IDLA 1NYUA 2H5FA 1F8UB 1BXPA 4RUDA 2JVEA 1ERAA 3KFDE 1HOYA 1B41B 1TXAA 1HC9B 1W6BA 4HQPF 1CREA 2HLQA 3NEQA 1CXNA 2PJYC 1IKCA 1ES7B 1HC9A 1M9ZA 2J8BA 1BTEA 2CDXA 2LA1A 1TGXA 2CCXA 1KBSA 1RGJA 1JBDA 1I02A 1CDTA 1LX5B 2H62C 2H8UA 1MAHF 4ZQYA 2VLWA 3VTSA 1KFHA 1UG4A 1KC4A 1V6PA 1LSIA 2H62D 1CRFA 4IYEA 1S4YA 2I9BE 4XJJA 2CRTA 2GOOB 2ABXA 1IK8A 1KXIA 4FAOC 2MJYA 1YWHA 3EVSC 1L4WA 1G6MA 1QKEA 3ERAA 1CHVS 3NDSA 3BT1U 4FAOE 2MUPA 1QM7A 2L5SA 1IDGA 1IQ9A 3KFDI 1CDSA 2MFAA 2L03A 4QTIU 2JQPA 1KS6A 1FF4A 1KU6B 4DO8A 1NXBA 3NH7A 2MUOA 2BHIA 1IDHA 1CB9A 3QB4B 4BIKB 1XT3A 1FFJA 1FSSB 1NTNA 1HAAA 2UWRA 1F94A 1ONJA 1KBTA
chains in the Genus database with same CATH superfamily
4BDTB 2H64C 1LXGA 2K3GA 2X8BB 1ERGA 2MJ0A 2PJYB 1FRAA 2N99A 1IJCA 5DU1A 2QJ9C 1COEA 1ZADA 1ABTA 2MJ4A 2H7ZA 1LXHA 4OM4A 1DRSA 2OFSA 2CRSA 1CTXA 2HLRA 1TFSA 1CDQA 1JE9A 3U73U 2ERAA 1LJZA 1FASA 1TXBA 3LAQU 2FD6U 1NTXA 4AEAA 6EBXA 1CVOA 1IDIA 1NEAA 2CTXA 3BT2U 1JGKA 2QC1A 2UX2A 2H7ZB 4LFTA 1RL5A 1CCQA 1CXOA 2MHYA 1KTZB 3HH7A 1CODA 2GOOC 1MR6A 4OM5A 5EBXA 1HAJA 1KBAA 1VB0A 3U74U 3FEVA 1FSCA 1H0JA 3PLCA 5IMYC 1NYSA 4UY2C 1NORA 3EBXA 2QJAC 1QKDA 2LCRA 2NBTA 4P7UA 5IMTD 2BTXA 1KL8A 4EY8B 5DZ5A 1PLOA 1REWC 2QJBC 1CDRA 5DO6A 2H64B 4KSNA 1NYUA 2H5FA 1F8UB 1IDLA 1BXPA 4RUDA 2JVEA 1ERAA 3KFDE 1HOYA 1B41B 1TXAA 1HC9B 1W6BA 4HQPF 1CREA 2HLQA 3NEQA 1CXNA 2PJYC 1IKCA 1ES7B 1HC9A 1M9ZA 2J8BA 1BTEA 2CDXA 2LA1A 1TGXA 2CCXA 1KBSA 1RGJA 1JBDA 1I02A 1CDTA 1LX5B 2H62C 2H8UA 1MAHF 4ZQYA 2VLWA 3VTSA 1KFHA 1UG4A 1KC4A 1V6PA 1LSIA 2H62D 1CRFA 4IYEA 1S4YA 2I9BE 4XJJA 2CRTA 2GOOB 2ABXA 1IK8A 1KXIA 4FAOC 2MJYA 1YWHA 3EVSC 1L4WA 1G6MA 1QKEA 3ERAA 1CHVS 3NDSA 3BT1U 4FAOE 2MUPA 1QM7A 2L5SA 1IDGA 1IQ9A 3KFDI 1CDSA 2MFAA 2L03A 4QTIU 2JQPA 1KS6A 1FF4A 1KU6B 4DO8A 1NXBA 3NH7A 2MUOA 2BHIA 1IDHA 1CB9A 3QB4B 4BIKB 1XT3A 1FFJA 1FSSB 1NTNA 1HAAA 2UWRA 1F94A 1ONJA 1KBTA
chains in the Genus database with same CATH topology
4BDTB 2H64C 1LXGA 2K3GA 2X8BB 1ERGA 2MJ0A 2PJYB 1FRAA 2N99A 1IJCA 5DU1A 2QJ9C 1COEA 1ZADA 1ABTA 2MJ4A 2H7ZA 1LXHA 4OM4A 1DRSA 2OFSA 2CRSA 1CTXA 2HLRA 1TFSA 1CDQA 1JE9A 3U73U 2ERAA 1LJZA 1FASA 1TXBA 3LAQU 2FD6U 1NTXA 4AEAA 6EBXA 1CVOA 1IDIA 1NEAA 2CTXA 3BT2U 1JGKA 2QC1A 2UX2A 2H7ZB 4LFTA 1RL5A 1CCQA 1CXOA 2MHYA 1KTZB 3HH7A 1CODA 2GOOC 1MR6A 4OM5A 5EBXA 1HAJA 1KBAA 1VB0A 3U74U 3FEVA 1FSCA 1H0JA 3PLCA 5IMYC 1NYSA 4UY2C 1NORA 3EBXA 2QJAC 1QKDA 2LCRA 2NBTA 4P7UA 5IMTD 2BTXA 1KL8A 4EY8B 5DZ5A 1PLOA 1REWC 2QJBC 1CDRA 5DO6A 2H64B 4KSNA 1NYUA 2H5FA 1F8UB 1IDLA 1BXPA 4RUDA 2JVEA 1ERAA 3KFDE 1HOYA 1B41B 1TXAA 1HC9B 1W6BA 4HQPF 1CREA 2HLQA 3NEQA 1CXNA 2PJYC 1IKCA 1ES7B 1HC9A 1M9ZA 2J8BA 1BTEA 2CDXA 2LA1A 1TGXA 2CCXA 1KBSA 1RGJA 1JBDA 1I02A 1CDTA 1LX5B 2H62C 2H8UA 1MAHF 4ZQYA 2VLWA 3VTSA 1KFHA 1UG4A 1KC4A 1V6PA 1LSIA 2H62D 1CRFA 4IYEA 1S4YA 2I9BE 4XJJA 2CRTA 2GOOB 2ABXA 1IK8A 1KXIA 4FAOC 2MJYA 1YWHA 3EVSC 1L4WA 1G6MA 1QKEA 3ERAA 1CHVS 3NDSA 3BT1U 4FAOE 2MUPA 1QM7A 2L5SA 1IDGA 1IQ9A 3KFDI 1CDSA 2MFAA 2L03A 4QTIU 2JQPA 1KS6A 1FF4A 1KU6B 4DO8A 1NXBA 3NH7A 2MUOA 2BHIA 1IDHA 1CB9A 3QB4B 4BIKB 1XT3A 1FFJA 1FSSB 1NTNA 1HAAA 2UWRA 1F94A 1ONJA 1KBTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BDT B;  2H64 C;  1LXG A;  2K3G A;  2X8B B;  1ERG A;  2MJ0 A;  2PJY B;  1FRA A;  2N99 A;  1IJC A;  5DU1 A;  2QJ9 C;  1COE A;  1ZAD A;  1ABT A;  2MJ4 A;  2H7Z A;  1LXH A;  4OM4 A;  1DRS A;  2OFS A;  2CRS A;  1CTX A;  2HLR A;  1TFS A;  1CDQ A;  1JE9 A;  3U73 U;  2ERA A;  1LJZ A;  1FAS A;  1TXB A;  3LAQ U;  2FD6 U;  1NTX A;  4AEA A;  6EBX A;  1CVO A;  1IDI A;  1NEA A;  2CTX A;  3BT2 U;  1JGK A;  2QC1 A;  2UX2 A;  2H7Z B;  4LFT A;  1RL5 A;  1CCQ A;  1CXO A;  2MHY A;  1KTZ B;  3HH7 A;  1COD A;  2GOO C;  1MR6 A;  4OM5 A;  5EBX A;  1HAJ A;  1KBA A;  1VB0 A;  3U74 U;  3FEV A;  1FSC A;  1H0J A;  3PLC A;  5IMY C;  1NYS A;  4UY2 C;  1NOR A;  3EBX A;  2QJA C;  1QKD A;  2LCR A;  2NBT A;  4P7U A;  5IMT D;  2BTX A;  1KL8 A;  4EY8 B;  5DZ5 A;  1PLO A;  1REW C;  2QJB C;  1CDR A;  5DO6 A;  2H64 B;  1IDL A;  1NYU A;  2H5F A;  1F8U B;  1BXP A;  4RUD A;  2JVE A;  1ERA A;  3KFD E;  1HOY A;  1B41 B;  1TXA A;  1HC9 B;  1W6B A;  4HQP F;  1CRE A;  2HLQ A;  3NEQ A;  1CXN A;  2PJY C;  1IKC A;  1ES7 B;  1HC9 A;  1M9Z A;  2J8B A;  1BTE A;  2CDX A;  2LA1 A;  1TGX A;  2CCX A;  1KBS A;  1RGJ A;  1JBD A;  1I02 A;  1CDT A;  1LX5 B;  2H62 C;  2H8U A;  1MAH F;  4ZQY A;  2VLW A;  3VTS A;  1KFH A;  1UG4 A;  1KC4 A;  1V6P A;  1LSI A;  2H62 D;  1CRF A;  4IYE A;  1S4Y A;  2I9B E;  4XJJ A;  2CRT A;  2GOO B;  2ABX A;  1IK8 A;  1KXI A;  4FAO C;  2MJY A;  1YWH A;  3EVS C;  1L4W A;  1G6M A;  1QKE A;  3ERA A;  1CHV S;  3NDS A;  3BT1 U;  4FAO E;  2MUP A;  1QM7 A;  2L5S A;  1IDG A;  1IQ9 A;  3KFD I;  1CDS A;  2MFA A;  2L03 A;  4QTI U;  2JQP A;  1KS6 A;  1FF4 A;  1KU6 B;  4DO8 A;  1NXB A;  3NH7 A;  2MUO A;  2BHI A;  1IDH A;  1CB9 A;  3QB4 B;  4BIK B;  1XT3 A;  1FFJ A;  1FSS B;  1NTN A;  1HAA A;  2UWR A;  1F94 A;  1ONJ A;  1KBT A; 
#chains in the Genus database with same CATH topology
 4BDT B;  2H64 C;  1LXG A;  2K3G A;  2X8B B;  1ERG A;  2MJ0 A;  2PJY B;  1FRA A;  2N99 A;  1IJC A;  5DU1 A;  2QJ9 C;  1COE A;  1ZAD A;  1ABT A;  2MJ4 A;  2H7Z A;  1LXH A;  4OM4 A;  1DRS A;  2OFS A;  2CRS A;  1CTX A;  2HLR A;  1TFS A;  1CDQ A;  1JE9 A;  3U73 U;  2ERA A;  1LJZ A;  1FAS A;  1TXB A;  3LAQ U;  2FD6 U;  1NTX A;  4AEA A;  6EBX A;  1CVO A;  1IDI A;  1NEA A;  2CTX A;  3BT2 U;  1JGK A;  2QC1 A;  2UX2 A;  2H7Z B;  4LFT A;  1RL5 A;  1CCQ A;  1CXO A;  2MHY A;  1KTZ B;  3HH7 A;  1COD A;  2GOO C;  1MR6 A;  4OM5 A;  5EBX A;  1HAJ A;  1KBA A;  1VB0 A;  3U74 U;  3FEV A;  1FSC A;  1H0J A;  3PLC A;  5IMY C;  1NYS A;  4UY2 C;  1NOR A;  3EBX A;  2QJA C;  1QKD A;  2LCR A;  2NBT A;  4P7U A;  5IMT D;  2BTX A;  1KL8 A;  4EY8 B;  5DZ5 A;  1PLO A;  1REW C;  2QJB C;  1CDR A;  5DO6 A;  2H64 B;  4KSN A;  1NYU A;  2H5F A;  1F8U B;  1IDL A;  1BXP A;  4RUD A;  2JVE A;  1ERA A;  3KFD E;  1HOY A;  1B41 B;  1TXA A;  1HC9 B;  1W6B A;  4HQP F;  1CRE A;  2HLQ A;  3NEQ A;  1CXN A;  2PJY C;  1IKC A;  1ES7 B;  1HC9 A;  1M9Z A;  2J8B A;  1BTE A;  2CDX A;  2LA1 A;  1TGX A;  2CCX A;  1KBS A;  1RGJ A;  1JBD A;  1I02 A;  1CDT A;  1LX5 B;  2H62 C;  2H8U A;  1MAH F;  4ZQY A;  2VLW A;  3VTS A;  1KFH A;  1UG4 A;  1KC4 A;  1V6P A;  1LSI A;  2H62 D;  1CRF A;  4IYE A;  1S4Y A;  2I9B E;  4XJJ A;  2CRT A;  2GOO B;  2ABX A;  1IK8 A;  1KXI A;  4FAO C;  2MJY A;  1YWH A;  3EVS C;  1L4W A;  1G6M A;  1QKE A;  3ERA A;  1CHV S;  3NDS A;  3BT1 U;  4FAO E;  2MUP A;  1QM7 A;  2L5S A;  1IDG A;  1IQ9 A;  3KFD I;  1CDS A;  2MFA A;  2L03 A;  4QTI U;  2JQP A;  1KS6 A;  1FF4 A;  1KU6 B;  4DO8 A;  1NXB A;  3NH7 A;  2MUO A;  2BHI A;  1IDH A;  1CB9 A;  3QB4 B;  4BIK B;  1XT3 A;  1FFJ A;  1FSS B;  1NTN A;  1HAA A;  2UWR A;  1F94 A;  1ONJ A;  1KBT A; 
#chains in the Genus database with same CATH homology
 4BDT B;  2H64 C;  1LXG A;  2K3G A;  2X8B B;  1ERG A;  2MJ0 A;  2PJY B;  1FRA A;  2N99 A;  1IJC A;  5DU1 A;  2QJ9 C;  1COE A;  1ZAD A;  1ABT A;  2MJ4 A;  2H7Z A;  1LXH A;  4OM4 A;  1DRS A;  2OFS A;  2CRS A;  1CTX A;  2HLR A;  1TFS A;  1CDQ A;  1JE9 A;  3U73 U;  2ERA A;  1LJZ A;  1FAS A;  1TXB A;  3LAQ U;  2FD6 U;  1NTX A;  4AEA A;  6EBX A;  1CVO A;  1IDI A;  1NEA A;  2CTX A;  3BT2 U;  1JGK A;  2QC1 A;  2UX2 A;  2H7Z B;  4LFT A;  1RL5 A;  1CCQ A;  1CXO A;  2MHY A;  1KTZ B;  3HH7 A;  1COD A;  2GOO C;  1MR6 A;  4OM5 A;  5EBX A;  1HAJ A;  1KBA A;  1VB0 A;  3U74 U;  3FEV A;  1FSC A;  1H0J A;  3PLC A;  5IMY C;  1NYS A;  4UY2 C;  1NOR A;  3EBX A;  2QJA C;  1QKD A;  2LCR A;  2NBT A;  4P7U A;  5IMT D;  2BTX A;  1KL8 A;  4EY8 B;  5DZ5 A;  1PLO A;  1REW C;  2QJB C;  1CDR A;  5DO6 A;  2H64 B;  4KSN A;  1NYU A;  2H5F A;  1F8U B;  1IDL A;  1BXP A;  4RUD A;  2JVE A;  1ERA A;  3KFD E;  1HOY A;  1B41 B;  1TXA A;  1HC9 B;  1W6B A;  4HQP F;  1CRE A;  2HLQ A;  3NEQ A;  1CXN A;  2PJY C;  1IKC A;  1ES7 B;  1HC9 A;  1M9Z A;  2J8B A;  1BTE A;  2CDX A;  2LA1 A;  1TGX A;  2CCX A;  1KBS A;  1RGJ A;  1JBD A;  1I02 A;  1CDT A;  1LX5 B;  2H62 C;  2H8U A;  1MAH F;  4ZQY A;  2VLW A;  3VTS A;  1KFH A;  1UG4 A;  1KC4 A;  1V6P A;  1LSI A;  2H62 D;  1CRF A;  4IYE A;  1S4Y A;  2I9B E;  4XJJ A;  2CRT A;  2GOO B;  2ABX A;  1IK8 A;  1KXI A;  4FAO C;  2MJY A;  1YWH A;  3EVS C;  1L4W A;  1G6M A;  1QKE A;  3ERA A;  1CHV S;  3NDS A;  3BT1 U;  4FAO E;  2MUP A;  1QM7 A;  2L5S A;  1IDG A;  1IQ9 A;  3KFD I;  1CDS A;  2MFA A;  2L03 A;  4QTI U;  2JQP A;  1KS6 A;  1FF4 A;  1KU6 B;  4DO8 A;  1NXB A;  3NH7 A;  2MUO A;  2BHI A;  1IDH A;  1CB9 A;  3QB4 B;  4BIK B;  1XT3 A;  1FFJ A;  1FSS B;  1NTN A;  1HAA A;  2UWR A;  1F94 A;  1ONJ A;  1KBT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...