1ZADA

Structure of cytotoxin i (cti) from naja oxiana in complex with dpc micelle
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytotoxin 1
publication title Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins
pubmed rcsb
molecule tags Toxin
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1zadA00
3VTSA 5DU1A 2L03A 4FAOC 2JVEA 1B41B 1ABTA 2CTXA 1IKCA 1JBDA 1FSSB 1NYSA 3PLCA 4IYEA 2MJ0A 1F94A 4BDTB 2J8BA 2QJAC 1HC9B 3NH7A 1NTNA 1MAHF 1IDLA 1HAAA 3HH7A 5DZ5A 1CXNA 1FSCA 1IDIA 1MR6A 1RGJA 4OM5A 4FAOE 1CDSA 1CDTA 2H62D 2PJYB 2H5FA 1ONJA 1CRFA 2QJBC 1UG4A 5IMYC 2H64C 1KBAA 4AEAA 1QM7A 3QB4B 3NDSA 2BTXA 1KBSA 1CODA 2HLQA 2FD6U 1I02A 1IDGA 2GOOC 1PLOA 1IQ9A 1VB0A 1IDHA 1LX5B 3EBXA 2OFSA 5EBXA 2L5SA 4OM4A 2MUPA 2NBTA 1L4WA 1W6BA 2JQPA 1NEAA 3LAQU 2CRSA 1KFHA 1TXBA 2H8UA 1XT3A 2LCRA 2MJ4A 4QTIU 2BHIA 1CXOA 1BTEA 1QKDA 2H7ZB 3FEVA 1COEA 1NYUA 6EBXA 2MFAA 1REWC 1IJCA 1ERAA 1H0JA 2MHYA 2H64B 2N99A 2UWRA 3BT1U 1CVOA 2X8BB 3U74U 1ES7B 2H7ZA 2CRTA 4HQPF 1JE9A 1CB9A 4EY8B 2GOOB 2HLRA 1CHVS 4DO8A 1KS6A 2CDXA 2I9BE 2ERAA 1CTXA 4ZQYA 1FFJA 1ERGA 2QJ9C 2ABXA 3BT2U 1S4YA 1FRAA 4LFTA 2VLWA 1G6MA 2MUOA 3ERAA 1TGXA 3KFDI 1BXPA 1FF4A 1CDQA 1LJZA 2MJYA 1NORA 4RUDA 1FASA 1KBTA 1CDRA 3KFDE 2LA1A 1CCQA 1CREA 3U73U 1LXGA 4UY2C 1JGKA 5IMTD 1M9ZA 4XJJA 1QKEA 2UX2A 2CCXA 1KU6B 1V6PA 1NXBA 2K3GA 3EVSC 1RL5A 1KTZB 2QC1A 4BIKB 1KC4A 1LSIA 1TFSA 4P7UA 1NTXA 1KXIA 1F8UB 1YWHA 1KL8A 1LXHA 3NEQA 1ZADA 1HAJA 1HC9A 1HOYA 2H62C 1TXAA 1DRSA 5DO6A 2PJYC 1IK8A
chains in the Genus database with same CATH superfamily
3VTSA 5DU1A 2L03A 4FAOC 2JVEA 1B41B 1ABTA 2CTXA 1IKCA 1JBDA 1FSSB 1NYSA 3PLCA 4IYEA 2MJ0A 1F94A 4BDTB 2J8BA 2QJAC 1HC9B 3NH7A 1NTNA 1MAHF 1IDLA 1HAAA 3HH7A 5DZ5A 1CXNA 1FSCA 1IDIA 1MR6A 1RGJA 4OM5A 4FAOE 1CDSA 1CDTA 2H62D 2PJYB 2H5FA 1ONJA 1CRFA 2QJBC 1UG4A 5IMYC 2H64C 1KBAA 4AEAA 1QM7A 3QB4B 3NDSA 2BTXA 1KBSA 1CODA 2HLQA 2FD6U 1I02A 1IDGA 2GOOC 1PLOA 1IQ9A 1VB0A 1IDHA 1LX5B 3EBXA 2OFSA 5EBXA 4KSNA 2L5SA 4OM4A 2MUPA 2NBTA 1L4WA 1W6BA 2JQPA 1NEAA 3LAQU 2CRSA 1KFHA 1TXBA 2H8UA 1XT3A 2LCRA 2MJ4A 4QTIU 2BHIA 1CXOA 1BTEA 1QKDA 2H7ZB 3FEVA 1COEA 1NYUA 6EBXA 2MFAA 1REWC 1IJCA 1ERAA 1H0JA 2MHYA 2H64B 2N99A 2UWRA 3BT1U 1CVOA 2X8BB 3U74U 1ES7B 2H7ZA 2CRTA 4HQPF 1JE9A 1CB9A 4EY8B 2GOOB 2HLRA 1CHVS 4DO8A 1KS6A 2CDXA 2I9BE 2ERAA 1CTXA 4ZQYA 1FFJA 1ERGA 2QJ9C 2ABXA 3BT2U 1S4YA 1FRAA 4LFTA 2VLWA 1G6MA 2MUOA 3ERAA 1TGXA 3KFDI 1BXPA 1FF4A 1CDQA 1LJZA 2MJYA 1NORA 4RUDA 1FASA 1KBTA 1CDRA 3KFDE 2LA1A 1CCQA 1CREA 3U73U 1LXGA 4UY2C 1JGKA 5IMTD 1M9ZA 4XJJA 1QKEA 2UX2A 2CCXA 1KU6B 1V6PA 1NXBA 2K3GA 3EVSC 1RL5A 1KTZB 2QC1A 4BIKB 1KC4A 1LSIA 1TFSA 4P7UA 1NTXA 1KXIA 1F8UB 1YWHA 1KL8A 1LXHA 3NEQA 1ZADA 1HAJA 1HC9A 1HOYA 2H62C 1TXAA 1DRSA 5DO6A 2PJYC 1IK8A
chains in the Genus database with same CATH topology
3VTSA 5DU1A 2L03A 4FAOC 2JVEA 1B41B 1ABTA 2CTXA 1IKCA 1JBDA 1FSSB 1NYSA 3PLCA 4IYEA 2MJ0A 1F94A 4BDTB 2J8BA 2QJAC 1HC9B 3NH7A 1NTNA 1MAHF 1IDLA 1HAAA 3HH7A 5DZ5A 1CXNA 1FSCA 1IDIA 1MR6A 1RGJA 4OM5A 4FAOE 1CDSA 1CDTA 2H62D 2PJYB 2H5FA 1ONJA 1CRFA 2QJBC 1UG4A 5IMYC 2H64C 1KBAA 4AEAA 1QM7A 3QB4B 3NDSA 2BTXA 1KBSA 1CODA 2HLQA 2FD6U 1I02A 1IDGA 2GOOC 1PLOA 1IQ9A 1VB0A 1IDHA 1LX5B 3EBXA 2OFSA 5EBXA 4KSNA 2L5SA 4OM4A 2MUPA 2NBTA 1L4WA 1W6BA 2JQPA 1NEAA 3LAQU 2CRSA 1KFHA 1TXBA 2H8UA 1XT3A 2LCRA 2MJ4A 4QTIU 2BHIA 1CXOA 1BTEA 1QKDA 2H7ZB 3FEVA 1COEA 1NYUA 6EBXA 2MFAA 1REWC 1IJCA 1ERAA 1H0JA 2MHYA 2H64B 2N99A 2UWRA 3BT1U 1CVOA 2X8BB 3U74U 1ES7B 2H7ZA 2CRTA 4HQPF 1JE9A 1CB9A 4EY8B 2GOOB 2HLRA 1CHVS 4DO8A 1KS6A 2CDXA 2I9BE 2ERAA 1CTXA 4ZQYA 1FFJA 1ERGA 2QJ9C 2ABXA 3BT2U 1S4YA 1FRAA 4LFTA 2VLWA 1G6MA 2MUOA 3ERAA 1TGXA 3KFDI 1BXPA 1FF4A 1CDQA 1LJZA 2MJYA 1NORA 4RUDA 1FASA 1KBTA 1CDRA 3KFDE 2LA1A 1CCQA 1CREA 3U73U 1LXGA 4UY2C 1JGKA 5IMTD 1M9ZA 4XJJA 1QKEA 2UX2A 2CCXA 1KU6B 1V6PA 1NXBA 2K3GA 3EVSC 1RL5A 1KTZB 2QC1A 4BIKB 1KC4A 1LSIA 1TFSA 4P7UA 1NTXA 1KXIA 1F8UB 1YWHA 1KL8A 1LXHA 3NEQA 1ZADA 1HAJA 1HC9A 1HOYA 2H62C 1TXAA 1DRSA 5DO6A 2PJYC 1IK8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTS A;  5DU1 A;  2L03 A;  4FAO C;  2JVE A;  1B41 B;  1ABT A;  2CTX A;  1IKC A;  1JBD A;  1FSS B;  1NYS A;  3PLC A;  4IYE A;  2MJ0 A;  1F94 A;  4BDT B;  2J8B A;  2QJA C;  1HC9 B;  3NH7 A;  1NTN A;  1MAH F;  1IDL A;  1HAA A;  3HH7 A;  5DZ5 A;  1CXN A;  1FSC A;  1IDI A;  1MR6 A;  1RGJ A;  4OM5 A;  4FAO E;  1CDS A;  1CDT A;  2H62 D;  2PJY B;  2H5F A;  1ONJ A;  1CRF A;  2QJB C;  1UG4 A;  5IMY C;  2H64 C;  1KBA A;  4AEA A;  1QM7 A;  3QB4 B;  3NDS A;  2BTX A;  1KBS A;  1COD A;  2HLQ A;  2FD6 U;  1I02 A;  1IDG A;  2GOO C;  1PLO A;  1IQ9 A;  1VB0 A;  1IDH A;  1LX5 B;  3EBX A;  2OFS A;  5EBX A;  2L5S A;  4OM4 A;  2MUP A;  2NBT A;  1L4W A;  1W6B A;  2JQP A;  1NEA A;  3LAQ U;  2CRS A;  1KFH A;  1TXB A;  2H8U A;  1XT3 A;  2LCR A;  2MJ4 A;  4QTI U;  2BHI A;  1CXO A;  1BTE A;  1QKD A;  2H7Z B;  3FEV A;  1COE A;  1NYU A;  6EBX A;  2MFA A;  1REW C;  1IJC A;  1ERA A;  1H0J A;  2MHY A;  2H64 B;  2N99 A;  2UWR A;  3BT1 U;  1CVO A;  2X8B B;  3U74 U;  1ES7 B;  2H7Z A;  2CRT A;  4HQP F;  1JE9 A;  1CB9 A;  4EY8 B;  2GOO B;  2HLR A;  1CHV S;  4DO8 A;  1KS6 A;  2CDX A;  2I9B E;  2ERA A;  1CTX A;  4ZQY A;  1FFJ A;  1ERG A;  2QJ9 C;  2ABX A;  3BT2 U;  1S4Y A;  1FRA A;  4LFT A;  2VLW A;  1G6M A;  2MUO A;  3ERA A;  1TGX A;  3KFD I;  1BXP A;  1FF4 A;  1CDQ A;  1LJZ A;  2MJY A;  1NOR A;  4RUD A;  1FAS A;  1KBT A;  1CDR A;  3KFD E;  2LA1 A;  1CCQ A;  1CRE A;  3U73 U;  1LXG A;  4UY2 C;  1JGK A;  5IMT D;  1M9Z A;  4XJJ A;  1QKE A;  2UX2 A;  2CCX A;  1KU6 B;  1V6P A;  1NXB A;  2K3G A;  3EVS C;  1RL5 A;  1KTZ B;  2QC1 A;  4BIK B;  1KC4 A;  1LSI A;  1TFS A;  4P7U A;  1NTX A;  1KXI A;  1F8U B;  1YWH A;  1KL8 A;  1LXH A;  3NEQ A;  1ZAD A;  1HAJ A;  1HC9 A;  1HOY A;  2H62 C;  1TXA A;  1DRS A;  5DO6 A;  2PJY C;  1IK8 A; 
#chains in the Genus database with same CATH topology
 3VTS A;  5DU1 A;  2L03 A;  4FAO C;  2JVE A;  1B41 B;  1ABT A;  2CTX A;  1IKC A;  1JBD A;  1FSS B;  1NYS A;  3PLC A;  4IYE A;  2MJ0 A;  1F94 A;  4BDT B;  2J8B A;  2QJA C;  1HC9 B;  3NH7 A;  1NTN A;  1MAH F;  1IDL A;  1HAA A;  3HH7 A;  5DZ5 A;  1CXN A;  1FSC A;  1IDI A;  1MR6 A;  1RGJ A;  4OM5 A;  4FAO E;  1CDS A;  1CDT A;  2H62 D;  2PJY B;  2H5F A;  1ONJ A;  1CRF A;  2QJB C;  1UG4 A;  5IMY C;  2H64 C;  1KBA A;  4AEA A;  1QM7 A;  3QB4 B;  3NDS A;  2BTX A;  1KBS A;  1COD A;  2HLQ A;  2FD6 U;  1I02 A;  1IDG A;  2GOO C;  1PLO A;  1IQ9 A;  1VB0 A;  1IDH A;  1LX5 B;  3EBX A;  2OFS A;  5EBX A;  4KSN A;  2L5S A;  4OM4 A;  2MUP A;  2NBT A;  1L4W A;  1W6B A;  2JQP A;  1NEA A;  3LAQ U;  2CRS A;  1KFH A;  1TXB A;  2H8U A;  1XT3 A;  2LCR A;  2MJ4 A;  4QTI U;  2BHI A;  1CXO A;  1BTE A;  1QKD A;  2H7Z B;  3FEV A;  1COE A;  1NYU A;  6EBX A;  2MFA A;  1REW C;  1IJC A;  1ERA A;  1H0J A;  2MHY A;  2H64 B;  2N99 A;  2UWR A;  3BT1 U;  1CVO A;  2X8B B;  3U74 U;  1ES7 B;  2H7Z A;  2CRT A;  4HQP F;  1JE9 A;  1CB9 A;  4EY8 B;  2GOO B;  2HLR A;  1CHV S;  4DO8 A;  1KS6 A;  2CDX A;  2I9B E;  2ERA A;  1CTX A;  4ZQY A;  1FFJ A;  1ERG A;  2QJ9 C;  2ABX A;  3BT2 U;  1S4Y A;  1FRA A;  4LFT A;  2VLW A;  1G6M A;  2MUO A;  3ERA A;  1TGX A;  3KFD I;  1BXP A;  1FF4 A;  1CDQ A;  1LJZ A;  2MJY A;  1NOR A;  4RUD A;  1FAS A;  1KBT A;  1CDR A;  3KFD E;  2LA1 A;  1CCQ A;  1CRE A;  3U73 U;  1LXG A;  4UY2 C;  1JGK A;  5IMT D;  1M9Z A;  4XJJ A;  1QKE A;  2UX2 A;  2CCX A;  1KU6 B;  1V6P A;  1NXB A;  2K3G A;  3EVS C;  1RL5 A;  1KTZ B;  2QC1 A;  4BIK B;  1KC4 A;  1LSI A;  1TFS A;  4P7U A;  1NTX A;  1KXI A;  1F8U B;  1YWH A;  1KL8 A;  1LXH A;  3NEQ A;  1ZAD A;  1HAJ A;  1HC9 A;  1HOY A;  2H62 C;  1TXA A;  1DRS A;  5DO6 A;  2PJY C;  1IK8 A; 
#chains in the Genus database with same CATH homology
 3VTS A;  5DU1 A;  2L03 A;  4FAO C;  2JVE A;  1B41 B;  1ABT A;  2CTX A;  1IKC A;  1JBD A;  1FSS B;  1NYS A;  3PLC A;  4IYE A;  2MJ0 A;  1F94 A;  4BDT B;  2J8B A;  2QJA C;  1HC9 B;  3NH7 A;  1NTN A;  1MAH F;  1IDL A;  1HAA A;  3HH7 A;  5DZ5 A;  1CXN A;  1FSC A;  1IDI A;  1MR6 A;  1RGJ A;  4OM5 A;  4FAO E;  1CDS A;  1CDT A;  2H62 D;  2PJY B;  2H5F A;  1ONJ A;  1CRF A;  2QJB C;  1UG4 A;  5IMY C;  2H64 C;  1KBA A;  4AEA A;  1QM7 A;  3QB4 B;  3NDS A;  2BTX A;  1KBS A;  1COD A;  2HLQ A;  2FD6 U;  1I02 A;  1IDG A;  2GOO C;  1PLO A;  1IQ9 A;  1VB0 A;  1IDH A;  1LX5 B;  3EBX A;  2OFS A;  5EBX A;  4KSN A;  2L5S A;  4OM4 A;  2MUP A;  2NBT A;  1L4W A;  1W6B A;  2JQP A;  1NEA A;  3LAQ U;  2CRS A;  1KFH A;  1TXB A;  2H8U A;  1XT3 A;  2LCR A;  2MJ4 A;  4QTI U;  2BHI A;  1CXO A;  1BTE A;  1QKD A;  2H7Z B;  3FEV A;  1COE A;  1NYU A;  6EBX A;  2MFA A;  1REW C;  1IJC A;  1ERA A;  1H0J A;  2MHY A;  2H64 B;  2N99 A;  2UWR A;  3BT1 U;  1CVO A;  2X8B B;  3U74 U;  1ES7 B;  2H7Z A;  2CRT A;  4HQP F;  1JE9 A;  1CB9 A;  4EY8 B;  2GOO B;  2HLR A;  1CHV S;  4DO8 A;  1KS6 A;  2CDX A;  2I9B E;  2ERA A;  1CTX A;  4ZQY A;  1FFJ A;  1ERG A;  2QJ9 C;  2ABX A;  3BT2 U;  1S4Y A;  1FRA A;  4LFT A;  2VLW A;  1G6M A;  2MUO A;  3ERA A;  1TGX A;  3KFD I;  1BXP A;  1FF4 A;  1CDQ A;  1LJZ A;  2MJY A;  1NOR A;  4RUD A;  1FAS A;  1KBT A;  1CDR A;  3KFD E;  2LA1 A;  1CCQ A;  1CRE A;  3U73 U;  1LXG A;  4UY2 C;  1JGK A;  5IMT D;  1M9Z A;  4XJJ A;  1QKE A;  2UX2 A;  2CCX A;  1KU6 B;  1V6P A;  1NXB A;  2K3G A;  3EVS C;  1RL5 A;  1KTZ B;  2QC1 A;  4BIK B;  1KC4 A;  1LSI A;  1TFS A;  4P7U A;  1NTX A;  1KXI A;  1F8U B;  1YWH A;  1KL8 A;  1LXH A;  3NEQ A;  1ZAD A;  1HAJ A;  1HC9 A;  1HOY A;  2H62 C;  1TXA A;  1DRS A;  5DO6 A;  2PJY C;  1IK8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...