1ZADA

Structure of cytotoxin i (cti) from naja oxiana in complex with dpc micelle
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPIAYKTCPEGKNLCYKMFMMSDLTIPVKRGCIDVCPKNSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cytotoxin 1
publication title Interaction of three-finger toxins with phospholipid membranes: comparison of S- and P-type cytotoxins
pubmed rcsb
total genus 6
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2005-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1zadA00
2HLRA 2H62C 1NXBA 1LXGA 2JQPA 1KXIA 1FF4A 1YWHA 1G6MA 2H62D 2MFAA 3KFDI 3EVSC 1M9ZA 1IDGA 4XJJA 1CXOA 1NTXA 2J8BA 2H8UA 2H64B 2PJYB 1ABTA 1W6BA 1TXAA 4IYEA 1NYSA 1I02A 4AEAA 1ZADA 1FRAA 1MR6A 2CCXA 1ERAA 2LCRA 3FEVA 4OM5A 1DRSA 2OFSA 2UX2A 1CB9A 3QB4B 2MUOA 1LXHA 2MJ0A 1KS6A 1IQ9A 4OM4A 2CRTA 1BTEA 2X8BB 1KBAA 1ERGA 5EBXA 4DO8A 1IJCA 1LSIA 2GOOB 3ERAA 1JBDA 1HC9A 1FASA 4RUDA 1CXNA 3PLCA 4FAOC 4BIKB 1JE9A 2H5FA 2MUPA 1PLOA 1IDLA 1CCQA 1B41B 1JGKA 1KC4A 2ABXA 3U74U 2CDXA 1NEAA 4UY2C 1KFHA 5DO6A 1IK8A 2H64C 5DU1A 2PJYC 2JVEA 4FAOE 2QJAC 2UWRA 1BXPA 1NYUA 1ONJA 4ZQYA 1ES7B 1KBSA 1REWC 2LA1A 1LJZA 2H7ZB 1LX5B 2MJ4A 1HOYA 2H7ZA 2L03A 1S4YA 1KTZB 1HAJA 3BT2U 1QKEA 1KL8A 1F8UB 1TGXA 1HC9B 1NTNA 3NDSA 1CREA 1TXBA 1CRFA 1CTXA 1VB0A 4P7UA 2GOOC 1MAHF 3HH7A 1IKCA 1CVOA 2FD6U 2ERAA 5DZ5A 3U73U 1CDSA 1IDIA 1NORA 1CODA 4HQPF 1L4WA 1RL5A 3LAQU 3BT1U 5IMTD 2K3GA 1CDTA 1CDRA 6EBXA 1QKDA 3VTSA 2QJ9C 1V6PA 2CTXA 1KBTA 5IMYC 4LFTA 4QTIU 1COEA 1FSCA 1RGJA 2L5SA 2MHYA 3NEQA 2CRSA 1CHVS 1KU6B 1FSSB 4EY8B 1TFSA 1QM7A 2HLQA 2QJBC 1FFJA 2VLWA 2BHIA 1F94A 1UG4A 3KFDE 2BTXA 2QC1A 1HAAA 2MJYA 3NH7A 2NBTA 4BDTB 3EBXA 1IDHA 1XT3A 2N99A 1H0JA 2I9BE 1CDQA
chains in the Genus database with same CATH superfamily
2HLRA 2H62C 1NXBA 1LXGA 2JQPA 1KXIA 1FF4A 1YWHA 1G6MA 2H62D 2MFAA 3KFDI 3EVSC 1M9ZA 1IDGA 4XJJA 1CXOA 1NTXA 2J8BA 2H8UA 2H64B 2PJYB 1ABTA 1W6BA 1TXAA 4IYEA 1NYSA 1I02A 4AEAA 1ZADA 1FRAA 1MR6A 2CCXA 1ERAA 2LCRA 3FEVA 4OM5A 1DRSA 2OFSA 2UX2A 1CB9A 3QB4B 2MUOA 1LXHA 2MJ0A 1KS6A 1IQ9A 4OM4A 2CRTA 1BTEA 2X8BB 1KBAA 1ERGA 5EBXA 4DO8A 1IJCA 1LSIA 2GOOB 3ERAA 1JBDA 1HC9A 1FASA 4RUDA 1CXNA 3PLCA 4FAOC 4BIKB 1JE9A 2H5FA 2MUPA 1PLOA 1IDLA 1CCQA 1B41B 1JGKA 1KC4A 2ABXA 3U74U 2CDXA 1NEAA 4UY2C 1KFHA 5DO6A 1IK8A 2H64C 5DU1A 2PJYC 2JVEA 4FAOE 2QJAC 2UWRA 1BXPA 1NYUA 1ONJA 4ZQYA 1ES7B 1KBSA 1REWC 2LA1A 1LJZA 2H7ZB 1LX5B 2MJ4A 1HOYA 2H7ZA 2L03A 1S4YA 1KTZB 1HAJA 3BT2U 1QKEA 1KL8A 1F8UB 4KSNA 1TGXA 1HC9B 1NTNA 3NDSA 1CREA 1TXBA 1CRFA 1CTXA 1VB0A 4P7UA 2GOOC 1MAHF 3HH7A 1IKCA 1CVOA 2FD6U 2ERAA 5DZ5A 3U73U 1CDSA 1IDIA 1NORA 1CODA 4HQPF 1L4WA 1RL5A 3LAQU 3BT1U 5IMTD 2K3GA 1CDTA 1CDRA 6EBXA 1QKDA 3VTSA 2QJ9C 1V6PA 2CTXA 1KBTA 5IMYC 4LFTA 4QTIU 1COEA 1FSCA 1RGJA 2L5SA 2MHYA 3NEQA 2CRSA 1CHVS 1KU6B 1FSSB 4EY8B 1TFSA 1QM7A 2HLQA 2QJBC 1FFJA 2VLWA 2BHIA 1F94A 1UG4A 3KFDE 2BTXA 2QC1A 1HAAA 2MJYA 3NH7A 2NBTA 4BDTB 3EBXA 1IDHA 1XT3A 2N99A 1H0JA 2I9BE 1CDQA
chains in the Genus database with same CATH topology
2HLRA 2H62C 1NXBA 1LXGA 2JQPA 1KXIA 1FF4A 1YWHA 1G6MA 2H62D 2MFAA 3KFDI 3EVSC 1M9ZA 1IDGA 4XJJA 1CXOA 1NTXA 2J8BA 2H8UA 2H64B 2PJYB 1ABTA 1W6BA 1TXAA 4IYEA 1NYSA 1I02A 4AEAA 1ZADA 1FRAA 1MR6A 2CCXA 1ERAA 2LCRA 3FEVA 4OM5A 1DRSA 2OFSA 2UX2A 1CB9A 3QB4B 2MUOA 1LXHA 2MJ0A 1KS6A 1IQ9A 4OM4A 2CRTA 1BTEA 2X8BB 1KBAA 1ERGA 5EBXA 4DO8A 1IJCA 1LSIA 2GOOB 3ERAA 1JBDA 1HC9A 1FASA 4RUDA 1CXNA 3PLCA 4FAOC 4BIKB 1JE9A 2H5FA 2MUPA 1PLOA 1IDLA 1CCQA 1B41B 1JGKA 1KC4A 2ABXA 3U74U 2CDXA 1NEAA 4UY2C 1KFHA 5DO6A 1IK8A 2H64C 5DU1A 2PJYC 2JVEA 4FAOE 2QJAC 2UWRA 1BXPA 1NYUA 1ONJA 4ZQYA 1ES7B 1KBSA 1REWC 2LA1A 1LJZA 2H7ZB 1LX5B 2MJ4A 1HOYA 2H7ZA 2L03A 1S4YA 1KTZB 1HAJA 3BT2U 1QKEA 1KL8A 1F8UB 4KSNA 1TGXA 1HC9B 1NTNA 3NDSA 1CREA 1TXBA 1CRFA 1CTXA 1VB0A 4P7UA 2GOOC 1MAHF 3HH7A 1IKCA 1CVOA 2FD6U 2ERAA 5DZ5A 3U73U 1CDSA 1IDIA 1NORA 1CODA 4HQPF 1L4WA 1RL5A 3LAQU 3BT1U 5IMTD 2K3GA 1CDTA 1CDRA 6EBXA 1QKDA 3VTSA 2QJ9C 1V6PA 2CTXA 1KBTA 5IMYC 4LFTA 4QTIU 1COEA 1FSCA 1RGJA 2L5SA 2MHYA 3NEQA 2CRSA 1CHVS 1KU6B 1FSSB 4EY8B 1TFSA 1QM7A 2HLQA 2QJBC 1FFJA 2VLWA 2BHIA 1F94A 1UG4A 3KFDE 2BTXA 2QC1A 1HAAA 2MJYA 3NH7A 2NBTA 4BDTB 3EBXA 1IDHA 1XT3A 2N99A 1H0JA 2I9BE 1CDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HLR A;  2H62 C;  1NXB A;  1LXG A;  2JQP A;  1KXI A;  1FF4 A;  1YWH A;  1G6M A;  2H62 D;  2MFA A;  3KFD I;  3EVS C;  1M9Z A;  1IDG A;  4XJJ A;  1CXO A;  1NTX A;  2J8B A;  2H8U A;  2H64 B;  2PJY B;  1ABT A;  1W6B A;  1TXA A;  4IYE A;  1NYS A;  1I02 A;  4AEA A;  1ZAD A;  1FRA A;  1MR6 A;  2CCX A;  1ERA A;  2LCR A;  3FEV A;  4OM5 A;  1DRS A;  2OFS A;  2UX2 A;  1CB9 A;  3QB4 B;  2MUO A;  1LXH A;  2MJ0 A;  1KS6 A;  1IQ9 A;  4OM4 A;  2CRT A;  1BTE A;  2X8B B;  1KBA A;  1ERG A;  5EBX A;  4DO8 A;  1IJC A;  1LSI A;  2GOO B;  3ERA A;  1JBD A;  1HC9 A;  1FAS A;  4RUD A;  1CXN A;  3PLC A;  4FAO C;  4BIK B;  1JE9 A;  2H5F A;  2MUP A;  1PLO A;  1IDL A;  1CCQ A;  1B41 B;  1JGK A;  1KC4 A;  2ABX A;  3U74 U;  2CDX A;  1NEA A;  4UY2 C;  1KFH A;  5DO6 A;  1IK8 A;  2H64 C;  5DU1 A;  2PJY C;  2JVE A;  4FAO E;  2QJA C;  2UWR A;  1BXP A;  1NYU A;  1ONJ A;  4ZQY A;  1ES7 B;  1KBS A;  1REW C;  2LA1 A;  1LJZ A;  2H7Z B;  1LX5 B;  2MJ4 A;  1HOY A;  2H7Z A;  2L03 A;  1S4Y A;  1KTZ B;  1HAJ A;  3BT2 U;  1QKE A;  1KL8 A;  1F8U B;  1TGX A;  1HC9 B;  1NTN A;  3NDS A;  1CRE A;  1TXB A;  1CRF A;  1CTX A;  1VB0 A;  4P7U A;  2GOO C;  1MAH F;  3HH7 A;  1IKC A;  1CVO A;  2FD6 U;  2ERA A;  5DZ5 A;  3U73 U;  1CDS A;  1IDI A;  1NOR A;  1COD A;  4HQP F;  1L4W A;  1RL5 A;  3LAQ U;  3BT1 U;  5IMT D;  2K3G A;  1CDT A;  1CDR A;  6EBX A;  1QKD A;  3VTS A;  2QJ9 C;  1V6P A;  2CTX A;  1KBT A;  5IMY C;  4LFT A;  4QTI U;  1COE A;  1FSC A;  1RGJ A;  2L5S A;  2MHY A;  3NEQ A;  2CRS A;  1CHV S;  1KU6 B;  1FSS B;  4EY8 B;  1TFS A;  1QM7 A;  2HLQ A;  2QJB C;  1FFJ A;  2VLW A;  2BHI A;  1F94 A;  1UG4 A;  3KFD E;  2BTX A;  2QC1 A;  1HAA A;  2MJY A;  3NH7 A;  2NBT A;  4BDT B;  3EBX A;  1IDH A;  1XT3 A;  2N99 A;  1H0J A;  2I9B E;  1CDQ A; 
#chains in the Genus database with same CATH topology
 2HLR A;  2H62 C;  1NXB A;  1LXG A;  2JQP A;  1KXI A;  1FF4 A;  1YWH A;  1G6M A;  2H62 D;  2MFA A;  3KFD I;  3EVS C;  1M9Z A;  1IDG A;  4XJJ A;  1CXO A;  1NTX A;  2J8B A;  2H8U A;  2H64 B;  2PJY B;  1ABT A;  1W6B A;  1TXA A;  4IYE A;  1NYS A;  1I02 A;  4AEA A;  1ZAD A;  1FRA A;  1MR6 A;  2CCX A;  1ERA A;  2LCR A;  3FEV A;  4OM5 A;  1DRS A;  2OFS A;  2UX2 A;  1CB9 A;  3QB4 B;  2MUO A;  1LXH A;  2MJ0 A;  1KS6 A;  1IQ9 A;  4OM4 A;  2CRT A;  1BTE A;  2X8B B;  1KBA A;  1ERG A;  5EBX A;  4DO8 A;  1IJC A;  1LSI A;  2GOO B;  3ERA A;  1JBD A;  1HC9 A;  1FAS A;  4RUD A;  1CXN A;  3PLC A;  4FAO C;  4BIK B;  1JE9 A;  2H5F A;  2MUP A;  1PLO A;  1IDL A;  1CCQ A;  1B41 B;  1JGK A;  1KC4 A;  2ABX A;  3U74 U;  2CDX A;  1NEA A;  4UY2 C;  1KFH A;  5DO6 A;  1IK8 A;  2H64 C;  5DU1 A;  2PJY C;  2JVE A;  4FAO E;  2QJA C;  2UWR A;  1BXP A;  1NYU A;  1ONJ A;  4ZQY A;  1ES7 B;  1KBS A;  1REW C;  2LA1 A;  1LJZ A;  2H7Z B;  1LX5 B;  2MJ4 A;  1HOY A;  2H7Z A;  2L03 A;  1S4Y A;  1KTZ B;  1HAJ A;  3BT2 U;  1QKE A;  1KL8 A;  1F8U B;  4KSN A;  1TGX A;  1HC9 B;  1NTN A;  3NDS A;  1CRE A;  1TXB A;  1CRF A;  1CTX A;  1VB0 A;  4P7U A;  2GOO C;  1MAH F;  3HH7 A;  1IKC A;  1CVO A;  2FD6 U;  2ERA A;  5DZ5 A;  3U73 U;  1CDS A;  1IDI A;  1NOR A;  1COD A;  4HQP F;  1L4W A;  1RL5 A;  3LAQ U;  3BT1 U;  5IMT D;  2K3G A;  1CDT A;  1CDR A;  6EBX A;  1QKD A;  3VTS A;  2QJ9 C;  1V6P A;  2CTX A;  1KBT A;  5IMY C;  4LFT A;  4QTI U;  1COE A;  1FSC A;  1RGJ A;  2L5S A;  2MHY A;  3NEQ A;  2CRS A;  1CHV S;  1KU6 B;  1FSS B;  4EY8 B;  1TFS A;  1QM7 A;  2HLQ A;  2QJB C;  1FFJ A;  2VLW A;  2BHI A;  1F94 A;  1UG4 A;  3KFD E;  2BTX A;  2QC1 A;  1HAA A;  2MJY A;  3NH7 A;  2NBT A;  4BDT B;  3EBX A;  1IDH A;  1XT3 A;  2N99 A;  1H0J A;  2I9B E;  1CDQ A; 
#chains in the Genus database with same CATH homology
 2HLR A;  2H62 C;  1NXB A;  1LXG A;  2JQP A;  1KXI A;  1FF4 A;  1YWH A;  1G6M A;  2H62 D;  2MFA A;  3KFD I;  3EVS C;  1M9Z A;  1IDG A;  4XJJ A;  1CXO A;  1NTX A;  2J8B A;  2H8U A;  2H64 B;  2PJY B;  1ABT A;  1W6B A;  1TXA A;  4IYE A;  1NYS A;  1I02 A;  4AEA A;  1ZAD A;  1FRA A;  1MR6 A;  2CCX A;  1ERA A;  2LCR A;  3FEV A;  4OM5 A;  1DRS A;  2OFS A;  2UX2 A;  1CB9 A;  3QB4 B;  2MUO A;  1LXH A;  2MJ0 A;  1KS6 A;  1IQ9 A;  4OM4 A;  2CRT A;  1BTE A;  2X8B B;  1KBA A;  1ERG A;  5EBX A;  4DO8 A;  1IJC A;  1LSI A;  2GOO B;  3ERA A;  1JBD A;  1HC9 A;  1FAS A;  4RUD A;  1CXN A;  3PLC A;  4FAO C;  4BIK B;  1JE9 A;  2H5F A;  2MUP A;  1PLO A;  1IDL A;  1CCQ A;  1B41 B;  1JGK A;  1KC4 A;  2ABX A;  3U74 U;  2CDX A;  1NEA A;  4UY2 C;  1KFH A;  5DO6 A;  1IK8 A;  2H64 C;  5DU1 A;  2PJY C;  2JVE A;  4FAO E;  2QJA C;  2UWR A;  1BXP A;  1NYU A;  1ONJ A;  4ZQY A;  1ES7 B;  1KBS A;  1REW C;  2LA1 A;  1LJZ A;  2H7Z B;  1LX5 B;  2MJ4 A;  1HOY A;  2H7Z A;  2L03 A;  1S4Y A;  1KTZ B;  1HAJ A;  3BT2 U;  1QKE A;  1KL8 A;  1F8U B;  4KSN A;  1TGX A;  1HC9 B;  1NTN A;  3NDS A;  1CRE A;  1TXB A;  1CRF A;  1CTX A;  1VB0 A;  4P7U A;  2GOO C;  1MAH F;  3HH7 A;  1IKC A;  1CVO A;  2FD6 U;  2ERA A;  5DZ5 A;  3U73 U;  1CDS A;  1IDI A;  1NOR A;  1COD A;  4HQP F;  1L4W A;  1RL5 A;  3LAQ U;  3BT1 U;  5IMT D;  2K3G A;  1CDT A;  1CDR A;  6EBX A;  1QKD A;  3VTS A;  2QJ9 C;  1V6P A;  2CTX A;  1KBT A;  5IMY C;  4LFT A;  4QTI U;  1COE A;  1FSC A;  1RGJ A;  2L5S A;  2MHY A;  3NEQ A;  2CRS A;  1CHV S;  1KU6 B;  1FSS B;  4EY8 B;  1TFS A;  1QM7 A;  2HLQ A;  2QJB C;  1FFJ A;  2VLW A;  2BHI A;  1F94 A;  1UG4 A;  3KFD E;  2BTX A;  2QC1 A;  1HAA A;  2MJY A;  3NH7 A;  2NBT A;  4BDT B;  3EBX A;  1IDH A;  1XT3 A;  2N99 A;  1H0J A;  2I9B E;  1CDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...