2JVEA

Solution structure of the extracellular domain of prod1, a protein implicated in proximodistal identity during amphibian limb regeneration
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
MALKCFTRNGDDRTVTTCAEEQTRCLFVQLPYSEIQECKTVQQCAEVLEEVTAIGYPAKCCCEDLCNRSEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Prod 1
publication title Solution structure and phylogenetics of Prod1, a member of the three-finger protein superfamily implicated in salamander limb regeneration.
pubmed doi rcsb
source organism Notophthalmus viridescens
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2007-09-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2jveA00
2CTXA 1FF4A 1IDGA 1TFSA 2NBTA 1NYSA 1BXPA 1CREA 1FSSB 1ZADA 3NEQA 1LJZA 2K3GA 5IMTD 2CRSA 5DO6A 4AEAA 2MFAA 4EY8B 2MJYA 4OM4A 2JQPA 1IKCA 4OM5A 2X8BB 2MJ4A 1IQ9A 2H64C 3U74U 1CODA 1REWC 1F8UB 2MHYA 1NEAA 1W6BA 1VB0A 1QM7A 3QB4B 1F94A 1FRAA 2HLRA 1S4YA 1CHVS 1CDSA 1HAAA 2QC1A 2MUOA 5DU1A 3VTSA 1FFJA 2GOOC 1M9ZA 1H0JA 1KTZB 1COEA 1KFHA 1IDIA 5DZ5A 1FSCA 4P7UA 1ABTA 1KBSA 2OFSA 4XJJA 1JE9A 1TXBA 1NTNA 1HOYA 1V6PA 1PLOA 2LA1A 4UY2C 1BTEA 2UWRA 1IJCA 2BTXA 2QJ9C 3EBXA 3KFDI 5EBXA 2L03A 2PJYB 1CXNA 4FAOC 1LXHA 1TXAA 6EBXA 1MAHF 2H7ZA 3EVSC 1CCQA 1CRFA 2N99A 1RGJA 1YWHA 1KBTA 3PLCA 3LAQU 2FD6U 4QTIU 1KL8A 1B41B 2BHIA 1I02A 4ZQYA 4RUDA 1CDRA 1JBDA 1CXOA 1NXBA 1NTXA 1CVOA 3ERAA 1NORA 1KBAA 1MR6A 3KFDE 1HAJA 1FASA 1HC9A 2ABXA 2CDXA 2HLQA 2JVEA 1ONJA 1IDLA 4FAOE 1UG4A 4BIKB 2H8UA 1XT3A 2CRTA 1ERAA 3U73U 1CDQA 1LX5B 1RL5A 3BT2U 2I9BE 1KC4A 2H7ZB 1KU6B 2VLWA 3HH7A 4BDTB 1CDTA 1ERGA 2QJBC 1LXGA 2PJYC 1KS6A 1LSIA 1QKDA 2GOOB 3BT1U 1CTXA 2LCRA 2UX2A 1JGKA 2J8BA 2CCXA 4DO8A 2MUPA 1L4WA 2MJ0A 1QKEA 2L5SA 1CB9A 2QJAC 1NYUA 1HC9B 1G6MA 1DRSA 1ES7B 3FEVA 4IYEA 3NH7A 4LFTA 2H64B 5IMYC 1IDHA 2H62C 2H5FA 1TGXA 1IK8A 4HQPF 2H62D 2ERAA 3NDSA 1KXIA
chains in the Genus database with same CATH superfamily
2CTXA 1FF4A 1IDGA 1TFSA 2NBTA 1NYSA 1BXPA 1CREA 1FSSB 1ZADA 3NEQA 1LJZA 2K3GA 5IMTD 2CRSA 5DO6A 4AEAA 2MFAA 4EY8B 2MJYA 4OM4A 2JQPA 1IKCA 4OM5A 2X8BB 2MJ4A 1IQ9A 2H64C 3U74U 1CODA 1REWC 1F8UB 2MHYA 1NEAA 1W6BA 1VB0A 1QM7A 3QB4B 1F94A 1FRAA 2HLRA 1S4YA 1CHVS 1CDSA 1HAAA 2QC1A 2MUOA 5DU1A 3VTSA 1FFJA 2GOOC 1M9ZA 1H0JA 1KTZB 1COEA 1KFHA 1IDIA 5DZ5A 1FSCA 4P7UA 1ABTA 1KBSA 2OFSA 4XJJA 1JE9A 1TXBA 1NTNA 1HOYA 1V6PA 1PLOA 2LA1A 4UY2C 1BTEA 2UWRA 1IJCA 2BTXA 2QJ9C 3EBXA 3KFDI 5EBXA 2L03A 2PJYB 1CXNA 4FAOC 1LXHA 1TXAA 6EBXA 1MAHF 2H7ZA 3EVSC 1CCQA 1CRFA 2N99A 1RGJA 1YWHA 1KBTA 3PLCA 3LAQU 2FD6U 4QTIU 1KL8A 1B41B 2BHIA 1I02A 4ZQYA 4RUDA 1CDRA 1JBDA 1CXOA 1NXBA 1NTXA 1CVOA 3ERAA 1NORA 1KBAA 1MR6A 3KFDE 1HAJA 1FASA 1HC9A 2ABXA 2CDXA 2HLQA 2JVEA 4KSNA 1ONJA 1IDLA 4FAOE 1UG4A 4BIKB 2H8UA 1XT3A 2CRTA 1ERAA 3U73U 1CDQA 1LX5B 1RL5A 3BT2U 2I9BE 1KC4A 2H7ZB 1KU6B 2VLWA 3HH7A 4BDTB 1CDTA 1ERGA 2QJBC 1LXGA 2PJYC 1KS6A 1LSIA 1QKDA 2GOOB 3BT1U 1CTXA 2LCRA 2UX2A 1JGKA 2J8BA 2CCXA 4DO8A 2MUPA 1L4WA 2MJ0A 1QKEA 2L5SA 1CB9A 2QJAC 1NYUA 1HC9B 1G6MA 1DRSA 1ES7B 3FEVA 4IYEA 3NH7A 4LFTA 2H64B 5IMYC 1IDHA 2H62C 2H5FA 1TGXA 1IK8A 4HQPF 2H62D 2ERAA 3NDSA 1KXIA
chains in the Genus database with same CATH topology
2CTXA 1FF4A 1IDGA 1TFSA 2NBTA 1NYSA 1BXPA 1CREA 1FSSB 1ZADA 3NEQA 1LJZA 2K3GA 5IMTD 2CRSA 5DO6A 4AEAA 2MFAA 4EY8B 2MJYA 4OM4A 2JQPA 1IKCA 4OM5A 2X8BB 2MJ4A 1IQ9A 2H64C 3U74U 1CODA 1REWC 1F8UB 2MHYA 1NEAA 1W6BA 1VB0A 1QM7A 3QB4B 1F94A 1FRAA 2HLRA 1S4YA 1CHVS 1CDSA 1HAAA 2QC1A 2MUOA 5DU1A 3VTSA 1FFJA 2GOOC 1M9ZA 1H0JA 1KTZB 1COEA 1KFHA 1IDIA 5DZ5A 1FSCA 4P7UA 1ABTA 1KBSA 2OFSA 4XJJA 1JE9A 1TXBA 1NTNA 1HOYA 1V6PA 1PLOA 2LA1A 4UY2C 1BTEA 2UWRA 1IJCA 2BTXA 2QJ9C 3EBXA 3KFDI 5EBXA 2L03A 2PJYB 1CXNA 4FAOC 1LXHA 1TXAA 6EBXA 1MAHF 2H7ZA 3EVSC 1CCQA 1CRFA 2N99A 1RGJA 1YWHA 1KBTA 3PLCA 3LAQU 2FD6U 4QTIU 1KL8A 1B41B 2BHIA 1I02A 4ZQYA 4RUDA 1CDRA 1JBDA 1CXOA 1NXBA 1NTXA 1CVOA 3ERAA 1NORA 1KBAA 1MR6A 3KFDE 1HAJA 1FASA 1HC9A 2ABXA 2CDXA 2HLQA 2JVEA 4KSNA 1ONJA 1IDLA 4FAOE 1UG4A 4BIKB 2H8UA 1XT3A 2CRTA 1ERAA 3U73U 1CDQA 1LX5B 1RL5A 3BT2U 2I9BE 1KC4A 2H7ZB 1KU6B 2VLWA 3HH7A 4BDTB 1CDTA 1ERGA 2QJBC 1LXGA 2PJYC 1KS6A 1LSIA 1QKDA 2GOOB 3BT1U 1CTXA 2LCRA 2UX2A 1JGKA 2J8BA 2CCXA 4DO8A 2MUPA 1L4WA 2MJ0A 1QKEA 2L5SA 1CB9A 2QJAC 1NYUA 1HC9B 1G6MA 1DRSA 1ES7B 3FEVA 4IYEA 3NH7A 4LFTA 2H64B 5IMYC 1IDHA 2H62C 2H5FA 1TGXA 1IK8A 4HQPF 2H62D 2ERAA 3NDSA 1KXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTX A;  1FF4 A;  1IDG A;  1TFS A;  2NBT A;  1NYS A;  1BXP A;  1CRE A;  1FSS B;  1ZAD A;  3NEQ A;  1LJZ A;  2K3G A;  5IMT D;  2CRS A;  5DO6 A;  4AEA A;  2MFA A;  4EY8 B;  2MJY A;  4OM4 A;  2JQP A;  1IKC A;  4OM5 A;  2X8B B;  2MJ4 A;  1IQ9 A;  2H64 C;  3U74 U;  1COD A;  1REW C;  1F8U B;  2MHY A;  1NEA A;  1W6B A;  1VB0 A;  1QM7 A;  3QB4 B;  1F94 A;  1FRA A;  2HLR A;  1S4Y A;  1CHV S;  1CDS A;  1HAA A;  2QC1 A;  2MUO A;  5DU1 A;  3VTS A;  1FFJ A;  2GOO C;  1M9Z A;  1H0J A;  1KTZ B;  1COE A;  1KFH A;  1IDI A;  5DZ5 A;  1FSC A;  4P7U A;  1ABT A;  1KBS A;  2OFS A;  4XJJ A;  1JE9 A;  1TXB A;  1NTN A;  1HOY A;  1V6P A;  1PLO A;  2LA1 A;  4UY2 C;  1BTE A;  2UWR A;  1IJC A;  2BTX A;  2QJ9 C;  3EBX A;  3KFD I;  5EBX A;  2L03 A;  2PJY B;  1CXN A;  4FAO C;  1LXH A;  1TXA A;  6EBX A;  1MAH F;  2H7Z A;  3EVS C;  1CCQ A;  1CRF A;  2N99 A;  1RGJ A;  1YWH A;  1KBT A;  3PLC A;  3LAQ U;  2FD6 U;  4QTI U;  1KL8 A;  1B41 B;  2BHI A;  1I02 A;  4ZQY A;  4RUD A;  1CDR A;  1JBD A;  1CXO A;  1NXB A;  1NTX A;  1CVO A;  3ERA A;  1NOR A;  1KBA A;  1MR6 A;  3KFD E;  1HAJ A;  1FAS A;  1HC9 A;  2ABX A;  2CDX A;  2HLQ A;  2JVE A;  1ONJ A;  1IDL A;  4FAO E;  1UG4 A;  4BIK B;  2H8U A;  1XT3 A;  2CRT A;  1ERA A;  3U73 U;  1CDQ A;  1LX5 B;  1RL5 A;  3BT2 U;  2I9B E;  1KC4 A;  2H7Z B;  1KU6 B;  2VLW A;  3HH7 A;  4BDT B;  1CDT A;  1ERG A;  2QJB C;  1LXG A;  2PJY C;  1KS6 A;  1LSI A;  1QKD A;  2GOO B;  3BT1 U;  1CTX A;  2LCR A;  2UX2 A;  1JGK A;  2J8B A;  2CCX A;  4DO8 A;  2MUP A;  1L4W A;  2MJ0 A;  1QKE A;  2L5S A;  1CB9 A;  2QJA C;  1NYU A;  1HC9 B;  1G6M A;  1DRS A;  1ES7 B;  3FEV A;  4IYE A;  3NH7 A;  4LFT A;  2H64 B;  5IMY C;  1IDH A;  2H62 C;  2H5F A;  1TGX A;  1IK8 A;  4HQP F;  2H62 D;  2ERA A;  3NDS A;  1KXI A; 
#chains in the Genus database with same CATH topology
 2CTX A;  1FF4 A;  1IDG A;  1TFS A;  2NBT A;  1NYS A;  1BXP A;  1CRE A;  1FSS B;  1ZAD A;  3NEQ A;  1LJZ A;  2K3G A;  5IMT D;  2CRS A;  5DO6 A;  4AEA A;  2MFA A;  4EY8 B;  2MJY A;  4OM4 A;  2JQP A;  1IKC A;  4OM5 A;  2X8B B;  2MJ4 A;  1IQ9 A;  2H64 C;  3U74 U;  1COD A;  1REW C;  1F8U B;  2MHY A;  1NEA A;  1W6B A;  1VB0 A;  1QM7 A;  3QB4 B;  1F94 A;  1FRA A;  2HLR A;  1S4Y A;  1CHV S;  1CDS A;  1HAA A;  2QC1 A;  2MUO A;  5DU1 A;  3VTS A;  1FFJ A;  2GOO C;  1M9Z A;  1H0J A;  1KTZ B;  1COE A;  1KFH A;  1IDI A;  5DZ5 A;  1FSC A;  4P7U A;  1ABT A;  1KBS A;  2OFS A;  4XJJ A;  1JE9 A;  1TXB A;  1NTN A;  1HOY A;  1V6P A;  1PLO A;  2LA1 A;  4UY2 C;  1BTE A;  2UWR A;  1IJC A;  2BTX A;  2QJ9 C;  3EBX A;  3KFD I;  5EBX A;  2L03 A;  2PJY B;  1CXN A;  4FAO C;  1LXH A;  1TXA A;  6EBX A;  1MAH F;  2H7Z A;  3EVS C;  1CCQ A;  1CRF A;  2N99 A;  1RGJ A;  1YWH A;  1KBT A;  3PLC A;  3LAQ U;  2FD6 U;  4QTI U;  1KL8 A;  1B41 B;  2BHI A;  1I02 A;  4ZQY A;  4RUD A;  1CDR A;  1JBD A;  1CXO A;  1NXB A;  1NTX A;  1CVO A;  3ERA A;  1NOR A;  1KBA A;  1MR6 A;  3KFD E;  1HAJ A;  1FAS A;  1HC9 A;  2ABX A;  2CDX A;  2HLQ A;  2JVE A;  4KSN A;  1ONJ A;  1IDL A;  4FAO E;  1UG4 A;  4BIK B;  2H8U A;  1XT3 A;  2CRT A;  1ERA A;  3U73 U;  1CDQ A;  1LX5 B;  1RL5 A;  3BT2 U;  2I9B E;  1KC4 A;  2H7Z B;  1KU6 B;  2VLW A;  3HH7 A;  4BDT B;  1CDT A;  1ERG A;  2QJB C;  1LXG A;  2PJY C;  1KS6 A;  1LSI A;  1QKD A;  2GOO B;  3BT1 U;  1CTX A;  2LCR A;  2UX2 A;  1JGK A;  2J8B A;  2CCX A;  4DO8 A;  2MUP A;  1L4W A;  2MJ0 A;  1QKE A;  2L5S A;  1CB9 A;  2QJA C;  1NYU A;  1HC9 B;  1G6M A;  1DRS A;  1ES7 B;  3FEV A;  4IYE A;  3NH7 A;  4LFT A;  2H64 B;  5IMY C;  1IDH A;  2H62 C;  2H5F A;  1TGX A;  1IK8 A;  4HQP F;  2H62 D;  2ERA A;  3NDS A;  1KXI A; 
#chains in the Genus database with same CATH homology
 2CTX A;  1FF4 A;  1IDG A;  1TFS A;  2NBT A;  1NYS A;  1BXP A;  1CRE A;  1FSS B;  1ZAD A;  3NEQ A;  1LJZ A;  2K3G A;  5IMT D;  2CRS A;  5DO6 A;  4AEA A;  2MFA A;  4EY8 B;  2MJY A;  4OM4 A;  2JQP A;  1IKC A;  4OM5 A;  2X8B B;  2MJ4 A;  1IQ9 A;  2H64 C;  3U74 U;  1COD A;  1REW C;  1F8U B;  2MHY A;  1NEA A;  1W6B A;  1VB0 A;  1QM7 A;  3QB4 B;  1F94 A;  1FRA A;  2HLR A;  1S4Y A;  1CHV S;  1CDS A;  1HAA A;  2QC1 A;  2MUO A;  5DU1 A;  3VTS A;  1FFJ A;  2GOO C;  1M9Z A;  1H0J A;  1KTZ B;  1COE A;  1KFH A;  1IDI A;  5DZ5 A;  1FSC A;  4P7U A;  1ABT A;  1KBS A;  2OFS A;  4XJJ A;  1JE9 A;  1TXB A;  1NTN A;  1HOY A;  1V6P A;  1PLO A;  2LA1 A;  4UY2 C;  1BTE A;  2UWR A;  1IJC A;  2BTX A;  2QJ9 C;  3EBX A;  3KFD I;  5EBX A;  2L03 A;  2PJY B;  1CXN A;  4FAO C;  1LXH A;  1TXA A;  6EBX A;  1MAH F;  2H7Z A;  3EVS C;  1CCQ A;  1CRF A;  2N99 A;  1RGJ A;  1YWH A;  1KBT A;  3PLC A;  3LAQ U;  2FD6 U;  4QTI U;  1KL8 A;  1B41 B;  2BHI A;  1I02 A;  4ZQY A;  4RUD A;  1CDR A;  1JBD A;  1CXO A;  1NXB A;  1NTX A;  1CVO A;  3ERA A;  1NOR A;  1KBA A;  1MR6 A;  3KFD E;  1HAJ A;  1FAS A;  1HC9 A;  2ABX A;  2CDX A;  2HLQ A;  2JVE A;  4KSN A;  1ONJ A;  1IDL A;  4FAO E;  1UG4 A;  4BIK B;  2H8U A;  1XT3 A;  2CRT A;  1ERA A;  3U73 U;  1CDQ A;  1LX5 B;  1RL5 A;  3BT2 U;  2I9B E;  1KC4 A;  2H7Z B;  1KU6 B;  2VLW A;  3HH7 A;  4BDT B;  1CDT A;  1ERG A;  2QJB C;  1LXG A;  2PJY C;  1KS6 A;  1LSI A;  1QKD A;  2GOO B;  3BT1 U;  1CTX A;  2LCR A;  2UX2 A;  1JGK A;  2J8B A;  2CCX A;  4DO8 A;  2MUP A;  1L4W A;  2MJ0 A;  1QKE A;  2L5S A;  1CB9 A;  2QJA C;  1NYU A;  1HC9 B;  1G6M A;  1DRS A;  1ES7 B;  3FEV A;  4IYE A;  3NH7 A;  4LFT A;  2H64 B;  5IMY C;  1IDH A;  2H62 C;  2H5F A;  1TGX A;  1IK8 A;  4HQP F;  2H62 D;  2ERA A;  3NDS A;  1KXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...