1ES7B

Complex between bmp-2 and two bmp receptor ia ectodomains
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
86
structure length
83
Chain Sequence
TLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords BONE MORPHOGENETIC PROTEIN-2
publication title Crystal structure of the BMP-2-BRIA ectodomain complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 83
sequence length 86
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2000-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1es7B00
1IDGA 4FAOC 1NTXA 1QM7A 2MJ4A 2N99A 1ONJA 1IK8A 1KXIA 3KFDI 1JGKA 1NYUA 1HAAA 2X8BB 1F94A 2QJAC 2PJYC 3NDSA 1FFJA 1IDHA 4BIKB 3NEQA 1CREA 2H7ZA 3LAQU 6EBXA 2HLQA 1CDSA 1KU6B 3U73U 1FASA 1FF4A 1L4WA 1KBSA 2H5FA 2MJ0A 3EVSC 4QTIU 1CB9A 2CTXA 2BHIA 1V6PA 1BXPA 2GOOC 5IMTD 4BDTB 2MUOA 3PLCA 4OM4A 4FAOE 1TXBA 1JBDA 2H62C 1JE9A 1BTEA 4P7UA 4AEAA 1COEA 1CXNA 3FEVA 3BT1U 1G6MA 1B41B 1LXGA 1IDIA 2ABXA 2J8BA 2OFSA 1NTNA 2FD6U 5DO6A 1MR6A 2H62D 1HC9B 1CODA 2CRTA 2CRSA 3BT2U 1W6BA 2LA1A 4EY8B 4HQPF 1KTZB 3QB4B 1CVOA 1HOYA 4XJJA 2PJYB 1IKCA 2UWRA 2LCRA 1FSCA 2MUPA 1RL5A 4RUDA 2HLRA 1YWHA 1LSIA 2JVEA 5EBXA 2JQPA 2K3GA 1QKDA 1ZADA 1CHVS 1DRSA 1TFSA 1CXOA 2QJBC 2UX2A 1XT3A 3VTSA 2H64C 1CCQA 1KBTA 2GOOB 1IDLA 1ABTA 1NYSA 1FRAA 1CDQA 3NH7A 1NXBA 2MFAA 2MJYA 1UG4A 2H8UA 1CRFA 4LFTA 1ES7B 1NEAA 1CTXA 1CDTA 1KFHA 2MHYA 3U74U 1KBAA 1LXHA 1ERGA 1RGJA 1REWC 1S4YA 2ERAA 2H7ZB 3HH7A 1KS6A 1ERAA 1TXAA 2L03A 1PLOA 1LX5B 5IMYC 4UY2C 1HC9A 2NBTA 1QKEA 2CDXA 1M9ZA 2BTXA 1F8UB 2QJ9C 3EBXA 1CDRA 2I9BE 5DU1A 2QC1A 1VB0A 1FSSB 4OM5A 1KL8A 1TGXA 1HAJA 1I02A 3KFDE 2VLWA 2H64B 2L5SA 1H0JA 4ZQYA 4IYEA 1NORA 1IJCA 1IQ9A 1LJZA 5DZ5A 4DO8A 2CCXA 1KC4A 3ERAA 1MAHF
chains in the Genus database with same CATH superfamily
1IDGA 4FAOC 1NTXA 1QM7A 2MJ4A 2N99A 1ONJA 1IK8A 1KXIA 3KFDI 1JGKA 1NYUA 1HAAA 2X8BB 1F94A 2QJAC 2PJYC 3NDSA 1FFJA 1IDHA 4BIKB 3NEQA 1CREA 2H7ZA 3LAQU 6EBXA 2HLQA 1CDSA 1KU6B 3U73U 1FASA 1FF4A 1L4WA 1KBSA 2H5FA 2MJ0A 3EVSC 4QTIU 1CB9A 2CTXA 2BHIA 1V6PA 1BXPA 2GOOC 5IMTD 4BDTB 2MUOA 3PLCA 4OM4A 4FAOE 1TXBA 1JBDA 2H62C 1JE9A 1BTEA 4P7UA 4AEAA 1COEA 1CXNA 3FEVA 3BT1U 1G6MA 1B41B 1LXGA 1IDIA 2ABXA 2J8BA 2OFSA 1NTNA 2FD6U 5DO6A 1MR6A 2H62D 1HC9B 1CODA 2CRTA 2CRSA 3BT2U 1W6BA 2LA1A 4EY8B 4HQPF 1KTZB 3QB4B 4KSNA 1CVOA 1HOYA 4XJJA 2PJYB 1IKCA 2UWRA 2LCRA 1FSCA 2MUPA 1RL5A 4RUDA 2HLRA 1YWHA 1LSIA 2JVEA 5EBXA 2JQPA 2K3GA 1QKDA 1ZADA 1CHVS 1DRSA 1TFSA 1CXOA 2QJBC 2UX2A 1XT3A 3VTSA 2H64C 1CCQA 1KBTA 2GOOB 1IDLA 1ABTA 1NYSA 1FRAA 1CDQA 3NH7A 1NXBA 2MFAA 2MJYA 1UG4A 2H8UA 1CRFA 4LFTA 1ES7B 1NEAA 1CTXA 1CDTA 1KFHA 2MHYA 3U74U 1KBAA 1LXHA 1ERGA 1RGJA 1REWC 1S4YA 2ERAA 2H7ZB 3HH7A 1KS6A 1ERAA 1TXAA 2L03A 1PLOA 1LX5B 5IMYC 4UY2C 1HC9A 2NBTA 1QKEA 2CDXA 1M9ZA 2BTXA 1F8UB 2QJ9C 3EBXA 1CDRA 2I9BE 5DU1A 2QC1A 1VB0A 1FSSB 4OM5A 1KL8A 1TGXA 1HAJA 1I02A 3KFDE 2VLWA 2H64B 2L5SA 1H0JA 4ZQYA 4IYEA 1NORA 1IJCA 1IQ9A 1LJZA 5DZ5A 4DO8A 2CCXA 1KC4A 3ERAA 1MAHF
chains in the Genus database with same CATH topology
1IDGA 4FAOC 1NTXA 1QM7A 2MJ4A 2N99A 1ONJA 1IK8A 1KXIA 3KFDI 1JGKA 1NYUA 1HAAA 2X8BB 1F94A 2QJAC 2PJYC 3NDSA 1FFJA 1IDHA 4BIKB 3NEQA 1CREA 2H7ZA 3LAQU 6EBXA 2HLQA 1CDSA 1KU6B 3U73U 1FASA 1FF4A 1L4WA 1KBSA 2H5FA 2MJ0A 3EVSC 4QTIU 1CB9A 2CTXA 2BHIA 1V6PA 1BXPA 2GOOC 5IMTD 4BDTB 2MUOA 3PLCA 4OM4A 4FAOE 1TXBA 1JBDA 2H62C 1JE9A 1BTEA 4P7UA 4AEAA 1COEA 1CXNA 3FEVA 3BT1U 1G6MA 1B41B 1LXGA 1IDIA 2ABXA 2J8BA 2OFSA 1NTNA 2FD6U 5DO6A 1MR6A 2H62D 1HC9B 1CODA 2CRTA 2CRSA 3BT2U 1W6BA 2LA1A 4EY8B 4HQPF 1KTZB 3QB4B 4KSNA 1CVOA 1HOYA 4XJJA 2PJYB 1IKCA 2UWRA 2LCRA 1FSCA 2MUPA 1RL5A 4RUDA 2HLRA 1YWHA 1LSIA 2JVEA 5EBXA 2JQPA 2K3GA 1QKDA 1ZADA 1CHVS 1DRSA 1TFSA 1CXOA 2QJBC 2UX2A 1XT3A 3VTSA 2H64C 1CCQA 1KBTA 2GOOB 1IDLA 1ABTA 1NYSA 1FRAA 1CDQA 3NH7A 1NXBA 2MFAA 2MJYA 1UG4A 2H8UA 1CRFA 4LFTA 1ES7B 1NEAA 1CTXA 1CDTA 1KFHA 2MHYA 3U74U 1KBAA 1LXHA 1ERGA 1RGJA 1REWC 1S4YA 2ERAA 2H7ZB 3HH7A 1KS6A 1ERAA 1TXAA 2L03A 1PLOA 1LX5B 5IMYC 4UY2C 1HC9A 2NBTA 1QKEA 2CDXA 1M9ZA 2BTXA 1F8UB 2QJ9C 3EBXA 1CDRA 2I9BE 5DU1A 2QC1A 1VB0A 1FSSB 4OM5A 1KL8A 1TGXA 1HAJA 1I02A 3KFDE 2VLWA 2H64B 2L5SA 1H0JA 4ZQYA 4IYEA 1NORA 1IJCA 1IQ9A 1LJZA 5DZ5A 4DO8A 2CCXA 1KC4A 3ERAA 1MAHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDG A;  4FAO C;  1NTX A;  1QM7 A;  2MJ4 A;  2N99 A;  1ONJ A;  1IK8 A;  1KXI A;  3KFD I;  1JGK A;  1NYU A;  1HAA A;  2X8B B;  1F94 A;  2QJA C;  2PJY C;  3NDS A;  1FFJ A;  1IDH A;  4BIK B;  3NEQ A;  1CRE A;  2H7Z A;  3LAQ U;  6EBX A;  2HLQ A;  1CDS A;  1KU6 B;  3U73 U;  1FAS A;  1FF4 A;  1L4W A;  1KBS A;  2H5F A;  2MJ0 A;  3EVS C;  4QTI U;  1CB9 A;  2CTX A;  2BHI A;  1V6P A;  1BXP A;  2GOO C;  5IMT D;  4BDT B;  2MUO A;  3PLC A;  4OM4 A;  4FAO E;  1TXB A;  1JBD A;  2H62 C;  1JE9 A;  1BTE A;  4P7U A;  4AEA A;  1COE A;  1CXN A;  3FEV A;  3BT1 U;  1G6M A;  1B41 B;  1LXG A;  1IDI A;  2ABX A;  2J8B A;  2OFS A;  1NTN A;  2FD6 U;  5DO6 A;  1MR6 A;  2H62 D;  1HC9 B;  1COD A;  2CRT A;  2CRS A;  3BT2 U;  1W6B A;  2LA1 A;  4EY8 B;  4HQP F;  1KTZ B;  3QB4 B;  1CVO A;  1HOY A;  4XJJ A;  2PJY B;  1IKC A;  2UWR A;  2LCR A;  1FSC A;  2MUP A;  1RL5 A;  4RUD A;  2HLR A;  1YWH A;  1LSI A;  2JVE A;  5EBX A;  2JQP A;  2K3G A;  1QKD A;  1ZAD A;  1CHV S;  1DRS A;  1TFS A;  1CXO A;  2QJB C;  2UX2 A;  1XT3 A;  3VTS A;  2H64 C;  1CCQ A;  1KBT A;  2GOO B;  1IDL A;  1ABT A;  1NYS A;  1FRA A;  1CDQ A;  3NH7 A;  1NXB A;  2MFA A;  2MJY A;  1UG4 A;  2H8U A;  1CRF A;  4LFT A;  1ES7 B;  1NEA A;  1CTX A;  1CDT A;  1KFH A;  2MHY A;  3U74 U;  1KBA A;  1LXH A;  1ERG A;  1RGJ A;  1REW C;  1S4Y A;  2ERA A;  2H7Z B;  3HH7 A;  1KS6 A;  1ERA A;  1TXA A;  2L03 A;  1PLO A;  1LX5 B;  5IMY C;  4UY2 C;  1HC9 A;  2NBT A;  1QKE A;  2CDX A;  1M9Z A;  2BTX A;  1F8U B;  2QJ9 C;  3EBX A;  1CDR A;  2I9B E;  5DU1 A;  2QC1 A;  1VB0 A;  1FSS B;  4OM5 A;  1KL8 A;  1TGX A;  1HAJ A;  1I02 A;  3KFD E;  2VLW A;  2H64 B;  2L5S A;  1H0J A;  4ZQY A;  4IYE A;  1NOR A;  1IJC A;  1IQ9 A;  1LJZ A;  5DZ5 A;  4DO8 A;  2CCX A;  1KC4 A;  3ERA A;  1MAH F; 
#chains in the Genus database with same CATH topology
 1IDG A;  4FAO C;  1NTX A;  1QM7 A;  2MJ4 A;  2N99 A;  1ONJ A;  1IK8 A;  1KXI A;  3KFD I;  1JGK A;  1NYU A;  1HAA A;  2X8B B;  1F94 A;  2QJA C;  2PJY C;  3NDS A;  1FFJ A;  1IDH A;  4BIK B;  3NEQ A;  1CRE A;  2H7Z A;  3LAQ U;  6EBX A;  2HLQ A;  1CDS A;  1KU6 B;  3U73 U;  1FAS A;  1FF4 A;  1L4W A;  1KBS A;  2H5F A;  2MJ0 A;  3EVS C;  4QTI U;  1CB9 A;  2CTX A;  2BHI A;  1V6P A;  1BXP A;  2GOO C;  5IMT D;  4BDT B;  2MUO A;  3PLC A;  4OM4 A;  4FAO E;  1TXB A;  1JBD A;  2H62 C;  1JE9 A;  1BTE A;  4P7U A;  4AEA A;  1COE A;  1CXN A;  3FEV A;  3BT1 U;  1G6M A;  1B41 B;  1LXG A;  1IDI A;  2ABX A;  2J8B A;  2OFS A;  1NTN A;  2FD6 U;  5DO6 A;  1MR6 A;  2H62 D;  1HC9 B;  1COD A;  2CRT A;  2CRS A;  3BT2 U;  1W6B A;  2LA1 A;  4EY8 B;  4HQP F;  1KTZ B;  3QB4 B;  4KSN A;  1CVO A;  1HOY A;  4XJJ A;  2PJY B;  1IKC A;  2UWR A;  2LCR A;  1FSC A;  2MUP A;  1RL5 A;  4RUD A;  2HLR A;  1YWH A;  1LSI A;  2JVE A;  5EBX A;  2JQP A;  2K3G A;  1QKD A;  1ZAD A;  1CHV S;  1DRS A;  1TFS A;  1CXO A;  2QJB C;  2UX2 A;  1XT3 A;  3VTS A;  2H64 C;  1CCQ A;  1KBT A;  2GOO B;  1IDL A;  1ABT A;  1NYS A;  1FRA A;  1CDQ A;  3NH7 A;  1NXB A;  2MFA A;  2MJY A;  1UG4 A;  2H8U A;  1CRF A;  4LFT A;  1ES7 B;  1NEA A;  1CTX A;  1CDT A;  1KFH A;  2MHY A;  3U74 U;  1KBA A;  1LXH A;  1ERG A;  1RGJ A;  1REW C;  1S4Y A;  2ERA A;  2H7Z B;  3HH7 A;  1KS6 A;  1ERA A;  1TXA A;  2L03 A;  1PLO A;  1LX5 B;  5IMY C;  4UY2 C;  1HC9 A;  2NBT A;  1QKE A;  2CDX A;  1M9Z A;  2BTX A;  1F8U B;  2QJ9 C;  3EBX A;  1CDR A;  2I9B E;  5DU1 A;  2QC1 A;  1VB0 A;  1FSS B;  4OM5 A;  1KL8 A;  1TGX A;  1HAJ A;  1I02 A;  3KFD E;  2VLW A;  2H64 B;  2L5S A;  1H0J A;  4ZQY A;  4IYE A;  1NOR A;  1IJC A;  1IQ9 A;  1LJZ A;  5DZ5 A;  4DO8 A;  2CCX A;  1KC4 A;  3ERA A;  1MAH F; 
#chains in the Genus database with same CATH homology
 1IDG A;  4FAO C;  1NTX A;  1QM7 A;  2MJ4 A;  2N99 A;  1ONJ A;  1IK8 A;  1KXI A;  3KFD I;  1JGK A;  1NYU A;  1HAA A;  2X8B B;  1F94 A;  2QJA C;  2PJY C;  3NDS A;  1FFJ A;  1IDH A;  4BIK B;  3NEQ A;  1CRE A;  2H7Z A;  3LAQ U;  6EBX A;  2HLQ A;  1CDS A;  1KU6 B;  3U73 U;  1FAS A;  1FF4 A;  1L4W A;  1KBS A;  2H5F A;  2MJ0 A;  3EVS C;  4QTI U;  1CB9 A;  2CTX A;  2BHI A;  1V6P A;  1BXP A;  2GOO C;  5IMT D;  4BDT B;  2MUO A;  3PLC A;  4OM4 A;  4FAO E;  1TXB A;  1JBD A;  2H62 C;  1JE9 A;  1BTE A;  4P7U A;  4AEA A;  1COE A;  1CXN A;  3FEV A;  3BT1 U;  1G6M A;  1B41 B;  1LXG A;  1IDI A;  2ABX A;  2J8B A;  2OFS A;  1NTN A;  2FD6 U;  5DO6 A;  1MR6 A;  2H62 D;  1HC9 B;  1COD A;  2CRT A;  2CRS A;  3BT2 U;  1W6B A;  2LA1 A;  4EY8 B;  4HQP F;  1KTZ B;  3QB4 B;  4KSN A;  1CVO A;  1HOY A;  4XJJ A;  2PJY B;  1IKC A;  2UWR A;  2LCR A;  1FSC A;  2MUP A;  1RL5 A;  4RUD A;  2HLR A;  1YWH A;  1LSI A;  2JVE A;  5EBX A;  2JQP A;  2K3G A;  1QKD A;  1ZAD A;  1CHV S;  1DRS A;  1TFS A;  1CXO A;  2QJB C;  2UX2 A;  1XT3 A;  3VTS A;  2H64 C;  1CCQ A;  1KBT A;  2GOO B;  1IDL A;  1ABT A;  1NYS A;  1FRA A;  1CDQ A;  3NH7 A;  1NXB A;  2MFA A;  2MJY A;  1UG4 A;  2H8U A;  1CRF A;  4LFT A;  1ES7 B;  1NEA A;  1CTX A;  1CDT A;  1KFH A;  2MHY A;  3U74 U;  1KBA A;  1LXH A;  1ERG A;  1RGJ A;  1REW C;  1S4Y A;  2ERA A;  2H7Z B;  3HH7 A;  1KS6 A;  1ERA A;  1TXA A;  2L03 A;  1PLO A;  1LX5 B;  5IMY C;  4UY2 C;  1HC9 A;  2NBT A;  1QKE A;  2CDX A;  1M9Z A;  2BTX A;  1F8U B;  2QJ9 C;  3EBX A;  1CDR A;  2I9B E;  5DU1 A;  2QC1 A;  1VB0 A;  1FSS B;  4OM5 A;  1KL8 A;  1TGX A;  1HAJ A;  1I02 A;  3KFD E;  2VLW A;  2H64 B;  2L5S A;  1H0J A;  4ZQY A;  4IYE A;  1NOR A;  1IJC A;  1IQ9 A;  1LJZ A;  5DZ5 A;  4DO8 A;  2CCX A;  1KC4 A;  3ERA A;  1MAH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...