1I02A

Nmr structure of ctx a3 at neutral ph (20 structures)
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARDIOTOXIN-3
publication title Dynamic characterization of the water binding loop in the P-type cardiotoxin: implication for the role of the bound water molecule.
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 2001-01-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1i02A00
1TFSA 2I9BE 2JVEA 2L03A 2MHYA 4HQPF 1CRFA 1TGXA 1IDGA 1IDLA 1KTZB 1NXBA 1CREA 2QJ9C 2CTXA 3BT1U 5IMTD 1I02A 1IJCA 4FAOC 1ES7B 1BTEA 1CDTA 1W6BA 2MUPA 1QKEA 3NH7A 2ABXA 2LA1A 1ONJA 1CVOA 1B41B 6EBXA 4OM5A 2L5SA 2UX2A 4UY2C 4BIKB 1KBTA 2QJAC 1IQ9A 1M9ZA 1FF4A 1KBSA 1IDIA 1IK8A 2PJYB 4OM4A 4P7UA 1L4WA 1ERGA 4LFTA 2CRSA 2FD6U 1KXIA 2GOOB 2MJYA 1CB9A 3PLCA 2HLQA 1MR6A 2JQPA 3U74U 1COEA 3QB4B 2N99A 2BTXA 2MJ4A 4ZQYA 3LAQU 2H64C 1RL5A 2ERAA 1JE9A 1KU6B 1RGJA 1HC9A 1QKDA 2HLRA 1CHVS 3NDSA 2MUOA 1NTXA 2K3GA 1LX5B 1FSSB 1REWC 1VB0A 4XJJA 2H62C 1CXOA 3KFDE 3BT2U 1V6PA 1CXNA 1NEAA 2X8BB 2QC1A 1CODA 3EBXA 2CRTA 1JGKA 2OFSA 4FAOE 3ERAA 2J8BA 1HAJA 2H62D 3EVSC 1IDHA 2UWRA 1FRAA 1LJZA 2NBTA 3VTSA 4DO8A 1JBDA 2PJYC 5EBXA 1G6MA 1IKCA 3NEQA 2H8UA 1DRSA 2H5FA 1FASA 5DU1A 1NYUA 3KFDI 1MAHF 1FSCA 1HOYA 1LSIA 1UG4A 1F94A 2H64B 5IMYC 2H7ZA 2CDXA 1S4YA 1FFJA 1NORA 4EY8B 1KL8A 1ERAA 1KFHA 1KC4A 1KS6A 5DO6A 1F8UB 3HH7A 1KBAA 3FEVA 5DZ5A 1H0JA 1CCQA 1ZADA 1LXHA 2VLWA 4IYEA 1CDRA 3U73U 1TXAA 1ABTA 1NYSA 1NTNA 1BXPA 4RUDA 2MJ0A 1TXBA 2MFAA 2BHIA 2GOOC 4QTIU 1HC9B 1CTXA 2QJBC 1HAAA 4BDTB 1CDSA 1LXGA 1YWHA 2LCRA 2H7ZB 1PLOA 2CCXA 1CDQA 1XT3A 1QM7A 4AEAA
chains in the Genus database with same CATH superfamily
1TFSA 2I9BE 2JVEA 2L03A 2MHYA 4HQPF 1CRFA 1TGXA 1IDGA 1IDLA 1KTZB 1NXBA 1CREA 2QJ9C 2CTXA 3BT1U 5IMTD 1I02A 1IJCA 4FAOC 1ES7B 1BTEA 1CDTA 1W6BA 2MUPA 1QKEA 3NH7A 2ABXA 2LA1A 1ONJA 1CVOA 1B41B 6EBXA 4OM5A 2L5SA 2UX2A 4UY2C 4BIKB 1KBTA 2QJAC 1IQ9A 1M9ZA 1FF4A 1KBSA 1IDIA 1IK8A 2PJYB 4OM4A 4P7UA 1L4WA 1ERGA 4LFTA 2CRSA 2FD6U 1KXIA 2GOOB 2MJYA 1CB9A 3PLCA 2HLQA 1MR6A 2JQPA 3U74U 1COEA 3QB4B 2N99A 2BTXA 2MJ4A 4ZQYA 3LAQU 2H64C 1RL5A 2ERAA 1JE9A 1KU6B 1RGJA 1HC9A 1QKDA 2HLRA 1CHVS 3NDSA 2MUOA 1NTXA 2K3GA 1LX5B 1FSSB 1REWC 1VB0A 4XJJA 2H62C 1CXOA 3KFDE 3BT2U 1V6PA 1CXNA 1NEAA 2X8BB 2QC1A 1CODA 3EBXA 2CRTA 4KSNA 1JGKA 2OFSA 4FAOE 3ERAA 2J8BA 1HAJA 2H62D 3EVSC 1IDHA 2UWRA 1FRAA 1LJZA 2NBTA 3VTSA 4DO8A 1JBDA 2PJYC 5EBXA 1G6MA 1IKCA 3NEQA 2H8UA 1DRSA 2H5FA 1FASA 5DU1A 1NYUA 3KFDI 1MAHF 1FSCA 1HOYA 1LSIA 1UG4A 1F94A 2H64B 5IMYC 2H7ZA 2CDXA 1S4YA 1FFJA 1NORA 4EY8B 1KL8A 1ERAA 1KFHA 1KC4A 1KS6A 5DO6A 1F8UB 3HH7A 1KBAA 3FEVA 5DZ5A 1H0JA 1CCQA 1ZADA 1LXHA 2VLWA 4IYEA 1CDRA 3U73U 1TXAA 1ABTA 1NYSA 1NTNA 1BXPA 4RUDA 2MJ0A 1TXBA 2MFAA 2BHIA 2GOOC 4QTIU 1HC9B 1CTXA 2QJBC 1HAAA 4BDTB 1CDSA 1LXGA 1YWHA 2LCRA 2H7ZB 1PLOA 2CCXA 1CDQA 1XT3A 1QM7A 4AEAA
chains in the Genus database with same CATH topology
1TFSA 2I9BE 2JVEA 2L03A 2MHYA 4HQPF 1CRFA 1TGXA 1IDGA 1IDLA 1KTZB 1NXBA 1CREA 2QJ9C 2CTXA 3BT1U 5IMTD 1I02A 1IJCA 4FAOC 1ES7B 1BTEA 1CDTA 1W6BA 2MUPA 1QKEA 3NH7A 2ABXA 2LA1A 1ONJA 1CVOA 1B41B 6EBXA 4OM5A 2L5SA 2UX2A 4UY2C 4BIKB 1KBTA 2QJAC 1IQ9A 1M9ZA 1FF4A 1KBSA 1IDIA 1IK8A 2PJYB 4OM4A 4P7UA 1L4WA 1ERGA 4LFTA 2CRSA 2FD6U 1KXIA 2GOOB 2MJYA 1CB9A 3PLCA 2HLQA 1MR6A 2JQPA 3U74U 1COEA 3QB4B 2N99A 2BTXA 2MJ4A 4ZQYA 3LAQU 2H64C 1RL5A 2ERAA 1JE9A 1KU6B 1RGJA 1HC9A 1QKDA 2HLRA 1CHVS 3NDSA 2MUOA 1NTXA 2K3GA 1LX5B 1FSSB 1REWC 1VB0A 4XJJA 2H62C 1CXOA 3KFDE 3BT2U 1V6PA 1CXNA 1NEAA 2X8BB 2QC1A 1CODA 3EBXA 2CRTA 4KSNA 1JGKA 2OFSA 4FAOE 3ERAA 2J8BA 1HAJA 2H62D 3EVSC 1IDHA 2UWRA 1FRAA 1LJZA 2NBTA 3VTSA 4DO8A 1JBDA 2PJYC 5EBXA 1G6MA 1IKCA 3NEQA 2H8UA 1DRSA 2H5FA 1FASA 5DU1A 1NYUA 3KFDI 1MAHF 1FSCA 1HOYA 1LSIA 1UG4A 1F94A 2H64B 5IMYC 2H7ZA 2CDXA 1S4YA 1FFJA 1NORA 4EY8B 1KL8A 1ERAA 1KFHA 1KC4A 1KS6A 5DO6A 1F8UB 3HH7A 1KBAA 3FEVA 5DZ5A 1H0JA 1CCQA 1ZADA 1LXHA 2VLWA 4IYEA 1CDRA 3U73U 1TXAA 1ABTA 1NYSA 1NTNA 1BXPA 4RUDA 2MJ0A 1TXBA 2MFAA 2BHIA 2GOOC 4QTIU 1HC9B 1CTXA 2QJBC 1HAAA 4BDTB 1CDSA 1LXGA 1YWHA 2LCRA 2H7ZB 1PLOA 2CCXA 1CDQA 1XT3A 1QM7A 4AEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TFS A;  2I9B E;  2JVE A;  2L03 A;  2MHY A;  4HQP F;  1CRF A;  1TGX A;  1IDG A;  1IDL A;  1KTZ B;  1NXB A;  1CRE A;  2QJ9 C;  2CTX A;  3BT1 U;  5IMT D;  1I02 A;  1IJC A;  4FAO C;  1ES7 B;  1BTE A;  1CDT A;  1W6B A;  2MUP A;  1QKE A;  3NH7 A;  2ABX A;  2LA1 A;  1ONJ A;  1CVO A;  1B41 B;  6EBX A;  4OM5 A;  2L5S A;  2UX2 A;  4UY2 C;  4BIK B;  1KBT A;  2QJA C;  1IQ9 A;  1M9Z A;  1FF4 A;  1KBS A;  1IDI A;  1IK8 A;  2PJY B;  4OM4 A;  4P7U A;  1L4W A;  1ERG A;  4LFT A;  2CRS A;  2FD6 U;  1KXI A;  2GOO B;  2MJY A;  1CB9 A;  3PLC A;  2HLQ A;  1MR6 A;  2JQP A;  3U74 U;  1COE A;  3QB4 B;  2N99 A;  2BTX A;  2MJ4 A;  4ZQY A;  3LAQ U;  2H64 C;  1RL5 A;  2ERA A;  1JE9 A;  1KU6 B;  1RGJ A;  1HC9 A;  1QKD A;  2HLR A;  1CHV S;  3NDS A;  2MUO A;  1NTX A;  2K3G A;  1LX5 B;  1FSS B;  1REW C;  1VB0 A;  4XJJ A;  2H62 C;  1CXO A;  3KFD E;  3BT2 U;  1V6P A;  1CXN A;  1NEA A;  2X8B B;  2QC1 A;  1COD A;  3EBX A;  2CRT A;  1JGK A;  2OFS A;  4FAO E;  3ERA A;  2J8B A;  1HAJ A;  2H62 D;  3EVS C;  1IDH A;  2UWR A;  1FRA A;  1LJZ A;  2NBT A;  3VTS A;  4DO8 A;  1JBD A;  2PJY C;  5EBX A;  1G6M A;  1IKC A;  3NEQ A;  2H8U A;  1DRS A;  2H5F A;  1FAS A;  5DU1 A;  1NYU A;  3KFD I;  1MAH F;  1FSC A;  1HOY A;  1LSI A;  1UG4 A;  1F94 A;  2H64 B;  5IMY C;  2H7Z A;  2CDX A;  1S4Y A;  1FFJ A;  1NOR A;  4EY8 B;  1KL8 A;  1ERA A;  1KFH A;  1KC4 A;  1KS6 A;  5DO6 A;  1F8U B;  3HH7 A;  1KBA A;  3FEV A;  5DZ5 A;  1H0J A;  1CCQ A;  1ZAD A;  1LXH A;  2VLW A;  4IYE A;  1CDR A;  3U73 U;  1TXA A;  1ABT A;  1NYS A;  1NTN A;  1BXP A;  4RUD A;  2MJ0 A;  1TXB A;  2MFA A;  2BHI A;  2GOO C;  4QTI U;  1HC9 B;  1CTX A;  2QJB C;  1HAA A;  4BDT B;  1CDS A;  1LXG A;  1YWH A;  2LCR A;  2H7Z B;  1PLO A;  2CCX A;  1CDQ A;  1XT3 A;  1QM7 A;  4AEA A; 
#chains in the Genus database with same CATH topology
 1TFS A;  2I9B E;  2JVE A;  2L03 A;  2MHY A;  4HQP F;  1CRF A;  1TGX A;  1IDG A;  1IDL A;  1KTZ B;  1NXB A;  1CRE A;  2QJ9 C;  2CTX A;  3BT1 U;  5IMT D;  1I02 A;  1IJC A;  4FAO C;  1ES7 B;  1BTE A;  1CDT A;  1W6B A;  2MUP A;  1QKE A;  3NH7 A;  2ABX A;  2LA1 A;  1ONJ A;  1CVO A;  1B41 B;  6EBX A;  4OM5 A;  2L5S A;  2UX2 A;  4UY2 C;  4BIK B;  1KBT A;  2QJA C;  1IQ9 A;  1M9Z A;  1FF4 A;  1KBS A;  1IDI A;  1IK8 A;  2PJY B;  4OM4 A;  4P7U A;  1L4W A;  1ERG A;  4LFT A;  2CRS A;  2FD6 U;  1KXI A;  2GOO B;  2MJY A;  1CB9 A;  3PLC A;  2HLQ A;  1MR6 A;  2JQP A;  3U74 U;  1COE A;  3QB4 B;  2N99 A;  2BTX A;  2MJ4 A;  4ZQY A;  3LAQ U;  2H64 C;  1RL5 A;  2ERA A;  1JE9 A;  1KU6 B;  1RGJ A;  1HC9 A;  1QKD A;  2HLR A;  1CHV S;  3NDS A;  2MUO A;  1NTX A;  2K3G A;  1LX5 B;  1FSS B;  1REW C;  1VB0 A;  4XJJ A;  2H62 C;  1CXO A;  3KFD E;  3BT2 U;  1V6P A;  1CXN A;  1NEA A;  2X8B B;  2QC1 A;  1COD A;  3EBX A;  2CRT A;  4KSN A;  1JGK A;  2OFS A;  4FAO E;  3ERA A;  2J8B A;  1HAJ A;  2H62 D;  3EVS C;  1IDH A;  2UWR A;  1FRA A;  1LJZ A;  2NBT A;  3VTS A;  4DO8 A;  1JBD A;  2PJY C;  5EBX A;  1G6M A;  1IKC A;  3NEQ A;  2H8U A;  1DRS A;  2H5F A;  1FAS A;  5DU1 A;  1NYU A;  3KFD I;  1MAH F;  1FSC A;  1HOY A;  1LSI A;  1UG4 A;  1F94 A;  2H64 B;  5IMY C;  2H7Z A;  2CDX A;  1S4Y A;  1FFJ A;  1NOR A;  4EY8 B;  1KL8 A;  1ERA A;  1KFH A;  1KC4 A;  1KS6 A;  5DO6 A;  1F8U B;  3HH7 A;  1KBA A;  3FEV A;  5DZ5 A;  1H0J A;  1CCQ A;  1ZAD A;  1LXH A;  2VLW A;  4IYE A;  1CDR A;  3U73 U;  1TXA A;  1ABT A;  1NYS A;  1NTN A;  1BXP A;  4RUD A;  2MJ0 A;  1TXB A;  2MFA A;  2BHI A;  2GOO C;  4QTI U;  1HC9 B;  1CTX A;  2QJB C;  1HAA A;  4BDT B;  1CDS A;  1LXG A;  1YWH A;  2LCR A;  2H7Z B;  1PLO A;  2CCX A;  1CDQ A;  1XT3 A;  1QM7 A;  4AEA A; 
#chains in the Genus database with same CATH homology
 1TFS A;  2I9B E;  2JVE A;  2L03 A;  2MHY A;  4HQP F;  1CRF A;  1TGX A;  1IDG A;  1IDL A;  1KTZ B;  1NXB A;  1CRE A;  2QJ9 C;  2CTX A;  3BT1 U;  5IMT D;  1I02 A;  1IJC A;  4FAO C;  1ES7 B;  1BTE A;  1CDT A;  1W6B A;  2MUP A;  1QKE A;  3NH7 A;  2ABX A;  2LA1 A;  1ONJ A;  1CVO A;  1B41 B;  6EBX A;  4OM5 A;  2L5S A;  2UX2 A;  4UY2 C;  4BIK B;  1KBT A;  2QJA C;  1IQ9 A;  1M9Z A;  1FF4 A;  1KBS A;  1IDI A;  1IK8 A;  2PJY B;  4OM4 A;  4P7U A;  1L4W A;  1ERG A;  4LFT A;  2CRS A;  2FD6 U;  1KXI A;  2GOO B;  2MJY A;  1CB9 A;  3PLC A;  2HLQ A;  1MR6 A;  2JQP A;  3U74 U;  1COE A;  3QB4 B;  2N99 A;  2BTX A;  2MJ4 A;  4ZQY A;  3LAQ U;  2H64 C;  1RL5 A;  2ERA A;  1JE9 A;  1KU6 B;  1RGJ A;  1HC9 A;  1QKD A;  2HLR A;  1CHV S;  3NDS A;  2MUO A;  1NTX A;  2K3G A;  1LX5 B;  1FSS B;  1REW C;  1VB0 A;  4XJJ A;  2H62 C;  1CXO A;  3KFD E;  3BT2 U;  1V6P A;  1CXN A;  1NEA A;  2X8B B;  2QC1 A;  1COD A;  3EBX A;  2CRT A;  4KSN A;  1JGK A;  2OFS A;  4FAO E;  3ERA A;  2J8B A;  1HAJ A;  2H62 D;  3EVS C;  1IDH A;  2UWR A;  1FRA A;  1LJZ A;  2NBT A;  3VTS A;  4DO8 A;  1JBD A;  2PJY C;  5EBX A;  1G6M A;  1IKC A;  3NEQ A;  2H8U A;  1DRS A;  2H5F A;  1FAS A;  5DU1 A;  1NYU A;  3KFD I;  1MAH F;  1FSC A;  1HOY A;  1LSI A;  1UG4 A;  1F94 A;  2H64 B;  5IMY C;  2H7Z A;  2CDX A;  1S4Y A;  1FFJ A;  1NOR A;  4EY8 B;  1KL8 A;  1ERA A;  1KFH A;  1KC4 A;  1KS6 A;  5DO6 A;  1F8U B;  3HH7 A;  1KBA A;  3FEV A;  5DZ5 A;  1H0J A;  1CCQ A;  1ZAD A;  1LXH A;  2VLW A;  4IYE A;  1CDR A;  3U73 U;  1TXA A;  1ABT A;  1NYS A;  1NTN A;  1BXP A;  4RUD A;  2MJ0 A;  1TXB A;  2MFA A;  2BHI A;  2GOO C;  4QTI U;  1HC9 B;  1CTX A;  2QJB C;  1HAA A;  4BDT B;  1CDS A;  1LXG A;  1YWH A;  2LCR A;  2H7Z B;  1PLO A;  2CCX A;  1CDQ A;  1XT3 A;  1QM7 A;  4AEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...