2QJBC

Crystal structure analysis of bmp-2 in complex with bmpr-ia variant ia/ib
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
TLPFLKCYCSHHCPEDAINNTCITNGHCFTMIEEDDQGETTLTSGCLGLEGSDFQCRDTPIPHQRRSIECCRTNLCNQYLQPTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine/receptor
molecule keywords Bone morphogenetic protein 2
publication title Structure analysis of bone morphogenetic protein-2 type I receptor complexes reveals a mechanism of receptor inactivation in juvenile polyposis syndrome.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qjbC00
1S4YA 1TXAA 4OM5A 2L5SA 4AEAA 3NH7A 2GOOB 2QJ9C 2H7ZA 3U74U 4LFTA 4FAOC 3VTSA 1NYSA 1TGXA 1ES7B 3EBXA 1QKEA 2QC1A 1F94A 3NDSA 4OM4A 5IMYC 1CCQA 2K3GA 2H7ZB 3BT2U 2H64C 1HAAA 2HLRA 4BIKB 1FSCA 2PJYB 2X8BB 2UX2A 4DO8A 2CDXA 1MR6A 2MJ0A 1FRAA 3BT1U 1NTXA 1KXIA 1JGKA 2GOOC 5IMTD 2MUPA 1MAHF 1L4WA 4IYEA 2MJYA 4XJJA 1FASA 5DO6A 1BXPA 1CREA 3NEQA 1IDHA 1F8UB 1KBSA 5DU1A 1CDRA 1CHVS 1CDQA 2PJYC 2UWRA 1PLOA 1B41B 1JBDA 1BTEA 2CTXA 1CB9A 1ONJA 1IDGA 1YWHA 1W6BA 2H8UA 1TXBA 2OFSA 1KBTA 2QJBC 1CXNA 1NYUA 1VB0A 4BDTB 2N99A 1I02A 3U73U 3FEVA 1ZADA 1V6PA 1IDLA 2NBTA 1NORA 5EBXA 1KFHA 1NXBA 1NTNA 1HOYA 1QM7A 1H0JA 1CODA 2MFAA 1TFSA 1IKCA 1IJCA 1RGJA 2MJ4A 3KFDI 3LAQU 4P7UA 1COEA 1G6MA 4FAOE 2L03A 1RL5A 1CVOA 3QB4B 1LX5B 1LJZA 4QTIU 1NEAA 2QJAC 1XT3A 2ERAA 2FD6U 3PLCA 1REWC 3ERAA 1DRSA 1ERAA 4UY2C 2CRTA 1CXOA 1HAJA 2H5FA 2ABXA 2JQPA 1QKDA 1LSIA 2HLQA 1IDIA 1ABTA 2VLWA 6EBXA 1M9ZA 1KU6B 1CDTA 2MUOA 2JVEA 1ERGA 2H62C 1HC9B 2BHIA 1LXGA 1FF4A 3KFDE 4ZQYA 1KBAA 4HQPF 1KTZB 4EY8B 2LA1A 1IK8A 1UG4A 2CCXA 2I9BE 3EVSC 1CRFA 1FFJA 1KL8A 1JE9A 2H64B 1FSSB 1CTXA 2LCRA 3HH7A 1CDSA 1IQ9A 4RUDA 1LXHA 1KS6A 5DZ5A 1KC4A 2H62D 2MHYA 2J8BA 1HC9A 2CRSA 2BTXA
chains in the Genus database with same CATH superfamily
1S4YA 1TXAA 4OM5A 2L5SA 4AEAA 3NH7A 2GOOB 2QJ9C 2H7ZA 3U74U 4LFTA 4FAOC 3VTSA 1NYSA 1TGXA 1ES7B 3EBXA 1QKEA 2QC1A 1F94A 3NDSA 4OM4A 5IMYC 1CCQA 2K3GA 2H7ZB 3BT2U 2H64C 1HAAA 2HLRA 4BIKB 1FSCA 2PJYB 2X8BB 2UX2A 4DO8A 2CDXA 1MR6A 2MJ0A 1FRAA 3BT1U 1NTXA 1KXIA 1JGKA 2GOOC 5IMTD 2MUPA 1MAHF 1L4WA 4IYEA 2MJYA 4XJJA 1FASA 5DO6A 1BXPA 1CREA 3NEQA 1IDHA 1F8UB 1KBSA 5DU1A 1CDRA 1CHVS 1CDQA 2PJYC 2UWRA 1PLOA 1B41B 1JBDA 1BTEA 2CTXA 1CB9A 1ONJA 1IDGA 1YWHA 1W6BA 2H8UA 1TXBA 2OFSA 1KBTA 2QJBC 1CXNA 1NYUA 1VB0A 4BDTB 2N99A 1I02A 3U73U 3FEVA 1ZADA 1V6PA 1IDLA 2NBTA 1NORA 5EBXA 1KFHA 1NXBA 1NTNA 1HOYA 1QM7A 1H0JA 1CODA 2MFAA 1TFSA 1IKCA 1IJCA 1RGJA 2MJ4A 3KFDI 3LAQU 4P7UA 1COEA 1G6MA 4FAOE 2L03A 1RL5A 1CVOA 3QB4B 1LX5B 1LJZA 4QTIU 1NEAA 2QJAC 1XT3A 2ERAA 2FD6U 3PLCA 1REWC 3ERAA 1DRSA 1ERAA 4UY2C 2CRTA 1CXOA 1HAJA 2H5FA 2ABXA 2JQPA 1QKDA 1LSIA 2HLQA 1IDIA 1ABTA 2VLWA 6EBXA 1M9ZA 1KU6B 1CDTA 2MUOA 2JVEA 1ERGA 2H62C 1HC9B 2BHIA 1LXGA 1FF4A 3KFDE 4ZQYA 4KSNA 1KBAA 4HQPF 1KTZB 4EY8B 2LA1A 1IK8A 1UG4A 2CCXA 2I9BE 3EVSC 1CRFA 1FFJA 1KL8A 1JE9A 2H64B 1FSSB 1CTXA 2LCRA 3HH7A 1CDSA 1IQ9A 4RUDA 1LXHA 1KS6A 5DZ5A 1KC4A 2H62D 2MHYA 2J8BA 1HC9A 2CRSA 2BTXA
chains in the Genus database with same CATH topology
1S4YA 1TXAA 4OM5A 2L5SA 4AEAA 3NH7A 2GOOB 2QJ9C 2H7ZA 3U74U 4LFTA 4FAOC 3VTSA 1NYSA 1TGXA 1ES7B 3EBXA 1QKEA 2QC1A 1F94A 3NDSA 4OM4A 5IMYC 1CCQA 2K3GA 2H7ZB 3BT2U 2H64C 1HAAA 2HLRA 4BIKB 1FSCA 2PJYB 2X8BB 2UX2A 4DO8A 2CDXA 1MR6A 2MJ0A 1FRAA 3BT1U 1NTXA 1KXIA 1JGKA 2GOOC 5IMTD 2MUPA 1MAHF 1L4WA 4IYEA 2MJYA 4XJJA 1FASA 5DO6A 1BXPA 1CREA 3NEQA 1IDHA 1F8UB 1KBSA 5DU1A 1CDRA 1CHVS 1CDQA 2PJYC 2UWRA 1PLOA 1B41B 1JBDA 1BTEA 2CTXA 1CB9A 1ONJA 1IDGA 1YWHA 1W6BA 2H8UA 1TXBA 2OFSA 1KBTA 2QJBC 1CXNA 1NYUA 1VB0A 4BDTB 2N99A 1I02A 3U73U 3FEVA 1ZADA 1V6PA 1IDLA 2NBTA 1NORA 5EBXA 1KFHA 1NXBA 1NTNA 1HOYA 1QM7A 1H0JA 1CODA 2MFAA 1TFSA 1IKCA 1IJCA 1RGJA 2MJ4A 3KFDI 3LAQU 4P7UA 1COEA 1G6MA 4FAOE 2L03A 1RL5A 1CVOA 3QB4B 1LX5B 1LJZA 4QTIU 1NEAA 2QJAC 1XT3A 2ERAA 2FD6U 3PLCA 1REWC 3ERAA 1DRSA 1ERAA 4UY2C 2CRTA 1CXOA 1HAJA 2H5FA 2ABXA 2JQPA 1QKDA 1LSIA 2HLQA 1IDIA 1ABTA 2VLWA 6EBXA 1M9ZA 1KU6B 1CDTA 2MUOA 2JVEA 1ERGA 2H62C 1HC9B 2BHIA 1LXGA 1FF4A 3KFDE 4ZQYA 4KSNA 1KBAA 4HQPF 1KTZB 4EY8B 2LA1A 1IK8A 1UG4A 2CCXA 2I9BE 3EVSC 1CRFA 1FFJA 1KL8A 1JE9A 2H64B 1FSSB 1CTXA 2LCRA 3HH7A 1CDSA 1IQ9A 4RUDA 1LXHA 1KS6A 5DZ5A 1KC4A 2H62D 2MHYA 2J8BA 1HC9A 2CRSA 2BTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Y A;  1TXA A;  4OM5 A;  2L5S A;  4AEA A;  3NH7 A;  2GOO B;  2QJ9 C;  2H7Z A;  3U74 U;  4LFT A;  4FAO C;  3VTS A;  1NYS A;  1TGX A;  1ES7 B;  3EBX A;  1QKE A;  2QC1 A;  1F94 A;  3NDS A;  4OM4 A;  5IMY C;  1CCQ A;  2K3G A;  2H7Z B;  3BT2 U;  2H64 C;  1HAA A;  2HLR A;  4BIK B;  1FSC A;  2PJY B;  2X8B B;  2UX2 A;  4DO8 A;  2CDX A;  1MR6 A;  2MJ0 A;  1FRA A;  3BT1 U;  1NTX A;  1KXI A;  1JGK A;  2GOO C;  5IMT D;  2MUP A;  1MAH F;  1L4W A;  4IYE A;  2MJY A;  4XJJ A;  1FAS A;  5DO6 A;  1BXP A;  1CRE A;  3NEQ A;  1IDH A;  1F8U B;  1KBS A;  5DU1 A;  1CDR A;  1CHV S;  1CDQ A;  2PJY C;  2UWR A;  1PLO A;  1B41 B;  1JBD A;  1BTE A;  2CTX A;  1CB9 A;  1ONJ A;  1IDG A;  1YWH A;  1W6B A;  2H8U A;  1TXB A;  2OFS A;  1KBT A;  2QJB C;  1CXN A;  1NYU A;  1VB0 A;  4BDT B;  2N99 A;  1I02 A;  3U73 U;  3FEV A;  1ZAD A;  1V6P A;  1IDL A;  2NBT A;  1NOR A;  5EBX A;  1KFH A;  1NXB A;  1NTN A;  1HOY A;  1QM7 A;  1H0J A;  1COD A;  2MFA A;  1TFS A;  1IKC A;  1IJC A;  1RGJ A;  2MJ4 A;  3KFD I;  3LAQ U;  4P7U A;  1COE A;  1G6M A;  4FAO E;  2L03 A;  1RL5 A;  1CVO A;  3QB4 B;  1LX5 B;  1LJZ A;  4QTI U;  1NEA A;  2QJA C;  1XT3 A;  2ERA A;  2FD6 U;  3PLC A;  1REW C;  3ERA A;  1DRS A;  1ERA A;  4UY2 C;  2CRT A;  1CXO A;  1HAJ A;  2H5F A;  2ABX A;  2JQP A;  1QKD A;  1LSI A;  2HLQ A;  1IDI A;  1ABT A;  2VLW A;  6EBX A;  1M9Z A;  1KU6 B;  1CDT A;  2MUO A;  2JVE A;  1ERG A;  2H62 C;  1HC9 B;  2BHI A;  1LXG A;  1FF4 A;  3KFD E;  4ZQY A;  1KBA A;  4HQP F;  1KTZ B;  4EY8 B;  2LA1 A;  1IK8 A;  1UG4 A;  2CCX A;  2I9B E;  3EVS C;  1CRF A;  1FFJ A;  1KL8 A;  1JE9 A;  2H64 B;  1FSS B;  1CTX A;  2LCR A;  3HH7 A;  1CDS A;  1IQ9 A;  4RUD A;  1LXH A;  1KS6 A;  5DZ5 A;  1KC4 A;  2H62 D;  2MHY A;  2J8B A;  1HC9 A;  2CRS A;  2BTX A; 
#chains in the Genus database with same CATH topology
 1S4Y A;  1TXA A;  4OM5 A;  2L5S A;  4AEA A;  3NH7 A;  2GOO B;  2QJ9 C;  2H7Z A;  3U74 U;  4LFT A;  4FAO C;  3VTS A;  1NYS A;  1TGX A;  1ES7 B;  3EBX A;  1QKE A;  2QC1 A;  1F94 A;  3NDS A;  4OM4 A;  5IMY C;  1CCQ A;  2K3G A;  2H7Z B;  3BT2 U;  2H64 C;  1HAA A;  2HLR A;  4BIK B;  1FSC A;  2PJY B;  2X8B B;  2UX2 A;  4DO8 A;  2CDX A;  1MR6 A;  2MJ0 A;  1FRA A;  3BT1 U;  1NTX A;  1KXI A;  1JGK A;  2GOO C;  5IMT D;  2MUP A;  1MAH F;  1L4W A;  4IYE A;  2MJY A;  4XJJ A;  1FAS A;  5DO6 A;  1BXP A;  1CRE A;  3NEQ A;  1IDH A;  1F8U B;  1KBS A;  5DU1 A;  1CDR A;  1CHV S;  1CDQ A;  2PJY C;  2UWR A;  1PLO A;  1B41 B;  1JBD A;  1BTE A;  2CTX A;  1CB9 A;  1ONJ A;  1IDG A;  1YWH A;  1W6B A;  2H8U A;  1TXB A;  2OFS A;  1KBT A;  2QJB C;  1CXN A;  1NYU A;  1VB0 A;  4BDT B;  2N99 A;  1I02 A;  3U73 U;  3FEV A;  1ZAD A;  1V6P A;  1IDL A;  2NBT A;  1NOR A;  5EBX A;  1KFH A;  1NXB A;  1NTN A;  1HOY A;  1QM7 A;  1H0J A;  1COD A;  2MFA A;  1TFS A;  1IKC A;  1IJC A;  1RGJ A;  2MJ4 A;  3KFD I;  3LAQ U;  4P7U A;  1COE A;  1G6M A;  4FAO E;  2L03 A;  1RL5 A;  1CVO A;  3QB4 B;  1LX5 B;  1LJZ A;  4QTI U;  1NEA A;  2QJA C;  1XT3 A;  2ERA A;  2FD6 U;  3PLC A;  1REW C;  3ERA A;  1DRS A;  1ERA A;  4UY2 C;  2CRT A;  1CXO A;  1HAJ A;  2H5F A;  2ABX A;  2JQP A;  1QKD A;  1LSI A;  2HLQ A;  1IDI A;  1ABT A;  2VLW A;  6EBX A;  1M9Z A;  1KU6 B;  1CDT A;  2MUO A;  2JVE A;  1ERG A;  2H62 C;  1HC9 B;  2BHI A;  1LXG A;  1FF4 A;  3KFD E;  4ZQY A;  4KSN A;  1KBA A;  4HQP F;  1KTZ B;  4EY8 B;  2LA1 A;  1IK8 A;  1UG4 A;  2CCX A;  2I9B E;  3EVS C;  1CRF A;  1FFJ A;  1KL8 A;  1JE9 A;  2H64 B;  1FSS B;  1CTX A;  2LCR A;  3HH7 A;  1CDS A;  1IQ9 A;  4RUD A;  1LXH A;  1KS6 A;  5DZ5 A;  1KC4 A;  2H62 D;  2MHY A;  2J8B A;  1HC9 A;  2CRS A;  2BTX A; 
#chains in the Genus database with same CATH homology
 1S4Y A;  1TXA A;  4OM5 A;  2L5S A;  4AEA A;  3NH7 A;  2GOO B;  2QJ9 C;  2H7Z A;  3U74 U;  4LFT A;  4FAO C;  3VTS A;  1NYS A;  1TGX A;  1ES7 B;  3EBX A;  1QKE A;  2QC1 A;  1F94 A;  3NDS A;  4OM4 A;  5IMY C;  1CCQ A;  2K3G A;  2H7Z B;  3BT2 U;  2H64 C;  1HAA A;  2HLR A;  4BIK B;  1FSC A;  2PJY B;  2X8B B;  2UX2 A;  4DO8 A;  2CDX A;  1MR6 A;  2MJ0 A;  1FRA A;  3BT1 U;  1NTX A;  1KXI A;  1JGK A;  2GOO C;  5IMT D;  2MUP A;  1MAH F;  1L4W A;  4IYE A;  2MJY A;  4XJJ A;  1FAS A;  5DO6 A;  1BXP A;  1CRE A;  3NEQ A;  1IDH A;  1F8U B;  1KBS A;  5DU1 A;  1CDR A;  1CHV S;  1CDQ A;  2PJY C;  2UWR A;  1PLO A;  1B41 B;  1JBD A;  1BTE A;  2CTX A;  1CB9 A;  1ONJ A;  1IDG A;  1YWH A;  1W6B A;  2H8U A;  1TXB A;  2OFS A;  1KBT A;  2QJB C;  1CXN A;  1NYU A;  1VB0 A;  4BDT B;  2N99 A;  1I02 A;  3U73 U;  3FEV A;  1ZAD A;  1V6P A;  1IDL A;  2NBT A;  1NOR A;  5EBX A;  1KFH A;  1NXB A;  1NTN A;  1HOY A;  1QM7 A;  1H0J A;  1COD A;  2MFA A;  1TFS A;  1IKC A;  1IJC A;  1RGJ A;  2MJ4 A;  3KFD I;  3LAQ U;  4P7U A;  1COE A;  1G6M A;  4FAO E;  2L03 A;  1RL5 A;  1CVO A;  3QB4 B;  1LX5 B;  1LJZ A;  4QTI U;  1NEA A;  2QJA C;  1XT3 A;  2ERA A;  2FD6 U;  3PLC A;  1REW C;  3ERA A;  1DRS A;  1ERA A;  4UY2 C;  2CRT A;  1CXO A;  1HAJ A;  2H5F A;  2ABX A;  2JQP A;  1QKD A;  1LSI A;  2HLQ A;  1IDI A;  1ABT A;  2VLW A;  6EBX A;  1M9Z A;  1KU6 B;  1CDT A;  2MUO A;  2JVE A;  1ERG A;  2H62 C;  1HC9 B;  2BHI A;  1LXG A;  1FF4 A;  3KFD E;  4ZQY A;  4KSN A;  1KBA A;  4HQP F;  1KTZ B;  4EY8 B;  2LA1 A;  1IK8 A;  1UG4 A;  2CCX A;  2I9B E;  3EVS C;  1CRF A;  1FFJ A;  1KL8 A;  1JE9 A;  2H64 B;  1FSS B;  1CTX A;  2LCR A;  3HH7 A;  1CDS A;  1IQ9 A;  4RUD A;  1LXH A;  1KS6 A;  5DZ5 A;  1KC4 A;  2H62 D;  2MHY A;  2J8B A;  1HC9 A;  2CRS A;  2BTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...