2QJBC

Crystal structure analysis of bmp-2 in complex with bmpr-ia variant ia/ib
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
85
structure length
85
Chain Sequence
b'TLPFLKCYCSHHCPEDAINNTCITNGHCFTMIEEDDQGETTLTSGCLGLEGSDFQCRDTPIPHQRRSIECCRTNLCNQYLQPTLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bone morphogenetic protein 2
publication title Structure analysis of bone morphogenetic protein-2 type I receptor complexes reveals a mechanism of receptor inactivation in juvenile polyposis syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine/receptor
total genus 15
structure length 85
sequence length 85
chains with identical sequence D
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2007-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01064 Activin_recp Activin types I and II receptor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2qjbC00
1KL8A 1S4YA 1CRFA 1MAHF 1CHVS 2MFAA 5DZ5A 4XJJA 2QJ9C 1ES7B 5DU1A 1IJCA 1RGJA 1NXBA 4LFTA 2PJYB 2CTXA 3BT2U 2CRTA 1ABTA 2NBTA 2LA1A 2L5SA 1IDIA 4IYEA 1FSSB 4UY2C 1NEAA 2ABXA 1TGXA 1HAJA 1XT3A 4BIKB 1HAAA 1KFHA 4QTIU 1HC9A 2J8BA 1FASA 2MJ4A 4RUDA 3QB4B 2ERAA 2CCXA 4AEAA 1KBSA 1NYUA 1CXOA 1LXGA 1KTZB 2JVEA 2JQPA 2H7ZA 1FF4A 3VTSA 1KBTA 3FEVA 1CDQA 2BTXA 1JBDA 3HH7A 1LX5B 4OM5A 1F94A 1UG4A 1IDLA 4DO8A 1YWHA 2MHYA 1VB0A 3BT1U 2QC1A 1LSIA 4ZQYA 1FFJA 1CCQA 1HOYA 1IQ9A 2H64C 1ZADA 5DO6A 3EVSC 1QM7A 1CDSA 1CVOA 1ERGA 1CODA 1RL5A 2L03A 1W6BA 2BHIA 1IKCA 1ONJA 2HLRA 1COEA 5EBXA 2H64B 5IMTD 2QJBC 2X8BB 1PLOA 2MJ0A 1B41B 3PLCA 2H7ZB 3ERAA 1QKDA 1JE9A 1ERAA 4BDTB 1KS6A 6EBXA 1NTNA 1V6PA 1TXBA 2H62D 2UWRA 1G6MA 1CTXA 1TXAA 1KC4A 4EY8B 4FAOE 2GOOC 1H0JA 2I9BE 1IK8A 1CDTA 1NORA 4FAOC 2K3GA 3U74U 1M9ZA 1FSCA 2OFSA 1FRAA 1KXIA 2H8UA 4P7UA 4HQPF 1REWC 2LCRA 1MR6A 1KU6B 4OM4A 3U73U 2GOOB 2MJYA 1CREA 2HLQA 3NH7A 1JGKA 1HC9B 2UX2A 2MUOA 2VLWA 3KFDE 1TFSA 2QJAC 2CRSA 1LJZA 1BXPA 1F8UB 3KFDI 1I02A 1CB9A 3LAQU 2H5FA 2N99A 1NYSA 1NTXA 2MUPA 2H62C 1QKEA 1CDRA 1L4WA 1LXHA 3NEQA 1BTEA 1DRSA 3EBXA 3NDSA 2CDXA 5IMYC 2FD6U 1IDHA 1CXNA 1IDGA 1KBAA 2PJYC
chains in the Genus database with same CATH superfamily
1KL8A 1S4YA 1CRFA 1MAHF 1CHVS 2MFAA 5DZ5A 4XJJA 2QJ9C 1ES7B 5DU1A 1IJCA 1RGJA 1NXBA 4LFTA 2PJYB 2CTXA 3BT2U 2CRTA 1ABTA 2NBTA 2LA1A 2L5SA 1IDIA 4IYEA 1FSSB 4UY2C 1NEAA 2ABXA 1TGXA 1HAJA 1XT3A 4BIKB 1HAAA 1KFHA 4KSNA 4QTIU 1HC9A 2J8BA 1FASA 2MJ4A 4RUDA 3QB4B 2ERAA 2CCXA 4AEAA 1KBSA 1NYUA 1CXOA 1LXGA 1KTZB 2JVEA 2JQPA 2H7ZA 1FF4A 3VTSA 1KBTA 3FEVA 1CDQA 2BTXA 1JBDA 3HH7A 1LX5B 4OM5A 1F94A 1UG4A 1IDLA 4DO8A 1YWHA 2MHYA 1VB0A 3BT1U 2QC1A 1LSIA 4ZQYA 1FFJA 1CCQA 1HOYA 1IQ9A 2H64C 1ZADA 5DO6A 3EVSC 1QM7A 1CDSA 1CVOA 1ERGA 1CODA 1RL5A 2L03A 1W6BA 2BHIA 1IKCA 1ONJA 2HLRA 1COEA 5EBXA 2H64B 5IMTD 2QJBC 2X8BB 1PLOA 2MJ0A 1B41B 3PLCA 2H7ZB 3ERAA 1QKDA 1JE9A 1ERAA 4BDTB 1KS6A 6EBXA 1NTNA 1V6PA 1TXBA 2H62D 2UWRA 1G6MA 1CTXA 1TXAA 1KC4A 4EY8B 4FAOE 2GOOC 1H0JA 2I9BE 1IK8A 1CDTA 1NORA 4FAOC 2K3GA 3U74U 1M9ZA 1FSCA 2OFSA 1FRAA 1KXIA 2H8UA 4P7UA 4HQPF 1REWC 2LCRA 1MR6A 1KU6B 4OM4A 3U73U 2GOOB 2MJYA 1CREA 2HLQA 3NH7A 1JGKA 1HC9B 2UX2A 2MUOA 2VLWA 3KFDE 1TFSA 2QJAC 2CRSA 1LJZA 1BXPA 1F8UB 3KFDI 1I02A 1CB9A 3LAQU 2H5FA 2N99A 1NYSA 1NTXA 2MUPA 2H62C 1QKEA 1CDRA 1L4WA 1LXHA 3NEQA 1BTEA 1DRSA 3EBXA 3NDSA 2CDXA 5IMYC 2FD6U 1IDHA 1CXNA 1IDGA 1KBAA 2PJYC
chains in the Genus database with same CATH topology
1KL8A 1S4YA 1CRFA 1MAHF 1CHVS 2MFAA 5DZ5A 4XJJA 2QJ9C 1ES7B 5DU1A 1IJCA 1RGJA 1NXBA 4LFTA 2PJYB 2CTXA 3BT2U 2CRTA 1ABTA 2NBTA 2LA1A 2L5SA 1IDIA 4IYEA 1FSSB 4UY2C 1NEAA 2ABXA 1TGXA 1HAJA 1XT3A 4BIKB 1HAAA 1KFHA 4KSNA 4QTIU 1HC9A 2J8BA 1FASA 2MJ4A 4RUDA 3QB4B 2ERAA 2CCXA 4AEAA 1KBSA 1NYUA 1CXOA 1LXGA 1KTZB 2JVEA 2JQPA 2H7ZA 1FF4A 3VTSA 1KBTA 3FEVA 1CDQA 2BTXA 1JBDA 3HH7A 1LX5B 4OM5A 1F94A 1UG4A 1IDLA 4DO8A 1YWHA 2MHYA 1VB0A 3BT1U 2QC1A 1LSIA 4ZQYA 1FFJA 1CCQA 1HOYA 1IQ9A 2H64C 1ZADA 5DO6A 3EVSC 1QM7A 1CDSA 1CVOA 1ERGA 1CODA 1RL5A 2L03A 1W6BA 2BHIA 1IKCA 1ONJA 2HLRA 1COEA 5EBXA 2H64B 5IMTD 2QJBC 2X8BB 1PLOA 2MJ0A 1B41B 3PLCA 2H7ZB 3ERAA 1QKDA 1JE9A 1ERAA 4BDTB 1KS6A 6EBXA 1NTNA 1V6PA 1TXBA 2H62D 2UWRA 1G6MA 1CTXA 1TXAA 1KC4A 4EY8B 4FAOE 2GOOC 1H0JA 2I9BE 1IK8A 1CDTA 1NORA 4FAOC 2K3GA 3U74U 1M9ZA 1FSCA 2OFSA 1FRAA 1KXIA 2H8UA 4P7UA 4HQPF 1REWC 2LCRA 1MR6A 1KU6B 4OM4A 3U73U 2GOOB 2MJYA 1CREA 2HLQA 3NH7A 1JGKA 1HC9B 2UX2A 2MUOA 2VLWA 3KFDE 1TFSA 2QJAC 2CRSA 1LJZA 1BXPA 1F8UB 3KFDI 1I02A 1CB9A 3LAQU 2H5FA 2N99A 1NYSA 1NTXA 2MUPA 2H62C 1QKEA 1CDRA 1L4WA 1LXHA 3NEQA 1BTEA 1DRSA 3EBXA 3NDSA 2CDXA 5IMYC 2FD6U 1IDHA 1CXNA 1IDGA 1KBAA 2PJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL8 A;  1S4Y A;  1CRF A;  1MAH F;  1CHV S;  2MFA A;  5DZ5 A;  4XJJ A;  2QJ9 C;  1ES7 B;  5DU1 A;  1IJC A;  1RGJ A;  1NXB A;  4LFT A;  2PJY B;  2CTX A;  3BT2 U;  2CRT A;  1ABT A;  2NBT A;  2LA1 A;  2L5S A;  1IDI A;  4IYE A;  1FSS B;  4UY2 C;  1NEA A;  2ABX A;  1TGX A;  1HAJ A;  1XT3 A;  4BIK B;  1HAA A;  1KFH A;  4QTI U;  1HC9 A;  2J8B A;  1FAS A;  2MJ4 A;  4RUD A;  3QB4 B;  2ERA A;  2CCX A;  4AEA A;  1KBS A;  1NYU A;  1CXO A;  1LXG A;  1KTZ B;  2JVE A;  2JQP A;  2H7Z A;  1FF4 A;  3VTS A;  1KBT A;  3FEV A;  1CDQ A;  2BTX A;  1JBD A;  3HH7 A;  1LX5 B;  4OM5 A;  1F94 A;  1UG4 A;  1IDL A;  4DO8 A;  1YWH A;  2MHY A;  1VB0 A;  3BT1 U;  2QC1 A;  1LSI A;  4ZQY A;  1FFJ A;  1CCQ A;  1HOY A;  1IQ9 A;  2H64 C;  1ZAD A;  5DO6 A;  3EVS C;  1QM7 A;  1CDS A;  1CVO A;  1ERG A;  1COD A;  1RL5 A;  2L03 A;  1W6B A;  2BHI A;  1IKC A;  1ONJ A;  2HLR A;  1COE A;  5EBX A;  2H64 B;  5IMT D;  2QJB C;  2X8B B;  1PLO A;  2MJ0 A;  1B41 B;  3PLC A;  2H7Z B;  3ERA A;  1QKD A;  1JE9 A;  1ERA A;  4BDT B;  1KS6 A;  6EBX A;  1NTN A;  1V6P A;  1TXB A;  2H62 D;  2UWR A;  1G6M A;  1CTX A;  1TXA A;  1KC4 A;  4EY8 B;  4FAO E;  2GOO C;  1H0J A;  2I9B E;  1IK8 A;  1CDT A;  1NOR A;  4FAO C;  2K3G A;  3U74 U;  1M9Z A;  1FSC A;  2OFS A;  1FRA A;  1KXI A;  2H8U A;  4P7U A;  4HQP F;  1REW C;  2LCR A;  1MR6 A;  1KU6 B;  4OM4 A;  3U73 U;  2GOO B;  2MJY A;  1CRE A;  2HLQ A;  3NH7 A;  1JGK A;  1HC9 B;  2UX2 A;  2MUO A;  2VLW A;  3KFD E;  1TFS A;  2QJA C;  2CRS A;  1LJZ A;  1BXP A;  1F8U B;  3KFD I;  1I02 A;  1CB9 A;  3LAQ U;  2H5F A;  2N99 A;  1NYS A;  1NTX A;  2MUP A;  2H62 C;  1QKE A;  1CDR A;  1L4W A;  1LXH A;  3NEQ A;  1BTE A;  1DRS A;  3EBX A;  3NDS A;  2CDX A;  5IMY C;  2FD6 U;  1IDH A;  1CXN A;  1IDG A;  1KBA A;  2PJY C; 
#chains in the Genus database with same CATH topology
 1KL8 A;  1S4Y A;  1CRF A;  1MAH F;  1CHV S;  2MFA A;  5DZ5 A;  4XJJ A;  2QJ9 C;  1ES7 B;  5DU1 A;  1IJC A;  1RGJ A;  1NXB A;  4LFT A;  2PJY B;  2CTX A;  3BT2 U;  2CRT A;  1ABT A;  2NBT A;  2LA1 A;  2L5S A;  1IDI A;  4IYE A;  1FSS B;  4UY2 C;  1NEA A;  2ABX A;  1TGX A;  1HAJ A;  1XT3 A;  4BIK B;  1HAA A;  1KFH A;  4KSN A;  4QTI U;  1HC9 A;  2J8B A;  1FAS A;  2MJ4 A;  4RUD A;  3QB4 B;  2ERA A;  2CCX A;  4AEA A;  1KBS A;  1NYU A;  1CXO A;  1LXG A;  1KTZ B;  2JVE A;  2JQP A;  2H7Z A;  1FF4 A;  3VTS A;  1KBT A;  3FEV A;  1CDQ A;  2BTX A;  1JBD A;  3HH7 A;  1LX5 B;  4OM5 A;  1F94 A;  1UG4 A;  1IDL A;  4DO8 A;  1YWH A;  2MHY A;  1VB0 A;  3BT1 U;  2QC1 A;  1LSI A;  4ZQY A;  1FFJ A;  1CCQ A;  1HOY A;  1IQ9 A;  2H64 C;  1ZAD A;  5DO6 A;  3EVS C;  1QM7 A;  1CDS A;  1CVO A;  1ERG A;  1COD A;  1RL5 A;  2L03 A;  1W6B A;  2BHI A;  1IKC A;  1ONJ A;  2HLR A;  1COE A;  5EBX A;  2H64 B;  5IMT D;  2QJB C;  2X8B B;  1PLO A;  2MJ0 A;  1B41 B;  3PLC A;  2H7Z B;  3ERA A;  1QKD A;  1JE9 A;  1ERA A;  4BDT B;  1KS6 A;  6EBX A;  1NTN A;  1V6P A;  1TXB A;  2H62 D;  2UWR A;  1G6M A;  1CTX A;  1TXA A;  1KC4 A;  4EY8 B;  4FAO E;  2GOO C;  1H0J A;  2I9B E;  1IK8 A;  1CDT A;  1NOR A;  4FAO C;  2K3G A;  3U74 U;  1M9Z A;  1FSC A;  2OFS A;  1FRA A;  1KXI A;  2H8U A;  4P7U A;  4HQP F;  1REW C;  2LCR A;  1MR6 A;  1KU6 B;  4OM4 A;  3U73 U;  2GOO B;  2MJY A;  1CRE A;  2HLQ A;  3NH7 A;  1JGK A;  1HC9 B;  2UX2 A;  2MUO A;  2VLW A;  3KFD E;  1TFS A;  2QJA C;  2CRS A;  1LJZ A;  1BXP A;  1F8U B;  3KFD I;  1I02 A;  1CB9 A;  3LAQ U;  2H5F A;  2N99 A;  1NYS A;  1NTX A;  2MUP A;  2H62 C;  1QKE A;  1CDR A;  1L4W A;  1LXH A;  3NEQ A;  1BTE A;  1DRS A;  3EBX A;  3NDS A;  2CDX A;  5IMY C;  2FD6 U;  1IDH A;  1CXN A;  1IDG A;  1KBA A;  2PJY C; 
#chains in the Genus database with same CATH homology
 1KL8 A;  1S4Y A;  1CRF A;  1MAH F;  1CHV S;  2MFA A;  5DZ5 A;  4XJJ A;  2QJ9 C;  1ES7 B;  5DU1 A;  1IJC A;  1RGJ A;  1NXB A;  4LFT A;  2PJY B;  2CTX A;  3BT2 U;  2CRT A;  1ABT A;  2NBT A;  2LA1 A;  2L5S A;  1IDI A;  4IYE A;  1FSS B;  4UY2 C;  1NEA A;  2ABX A;  1TGX A;  1HAJ A;  1XT3 A;  4BIK B;  1HAA A;  1KFH A;  4KSN A;  4QTI U;  1HC9 A;  2J8B A;  1FAS A;  2MJ4 A;  4RUD A;  3QB4 B;  2ERA A;  2CCX A;  4AEA A;  1KBS A;  1NYU A;  1CXO A;  1LXG A;  1KTZ B;  2JVE A;  2JQP A;  2H7Z A;  1FF4 A;  3VTS A;  1KBT A;  3FEV A;  1CDQ A;  2BTX A;  1JBD A;  3HH7 A;  1LX5 B;  4OM5 A;  1F94 A;  1UG4 A;  1IDL A;  4DO8 A;  1YWH A;  2MHY A;  1VB0 A;  3BT1 U;  2QC1 A;  1LSI A;  4ZQY A;  1FFJ A;  1CCQ A;  1HOY A;  1IQ9 A;  2H64 C;  1ZAD A;  5DO6 A;  3EVS C;  1QM7 A;  1CDS A;  1CVO A;  1ERG A;  1COD A;  1RL5 A;  2L03 A;  1W6B A;  2BHI A;  1IKC A;  1ONJ A;  2HLR A;  1COE A;  5EBX A;  2H64 B;  5IMT D;  2QJB C;  2X8B B;  1PLO A;  2MJ0 A;  1B41 B;  3PLC A;  2H7Z B;  3ERA A;  1QKD A;  1JE9 A;  1ERA A;  4BDT B;  1KS6 A;  6EBX A;  1NTN A;  1V6P A;  1TXB A;  2H62 D;  2UWR A;  1G6M A;  1CTX A;  1TXA A;  1KC4 A;  4EY8 B;  4FAO E;  2GOO C;  1H0J A;  2I9B E;  1IK8 A;  1CDT A;  1NOR A;  4FAO C;  2K3G A;  3U74 U;  1M9Z A;  1FSC A;  2OFS A;  1FRA A;  1KXI A;  2H8U A;  4P7U A;  4HQP F;  1REW C;  2LCR A;  1MR6 A;  1KU6 B;  4OM4 A;  3U73 U;  2GOO B;  2MJY A;  1CRE A;  2HLQ A;  3NH7 A;  1JGK A;  1HC9 B;  2UX2 A;  2MUO A;  2VLW A;  3KFD E;  1TFS A;  2QJA C;  2CRS A;  1LJZ A;  1BXP A;  1F8U B;  3KFD I;  1I02 A;  1CB9 A;  3LAQ U;  2H5F A;  2N99 A;  1NYS A;  1NTX A;  2MUP A;  2H62 C;  1QKE A;  1CDR A;  1L4W A;  1LXH A;  3NEQ A;  1BTE A;  1DRS A;  3EBX A;  3NDS A;  2CDX A;  5IMY C;  2FD6 U;  1IDH A;  1CXN A;  1IDG A;  1KBA A;  2PJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...