1CCQA

Nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTOTOXIN 2)
publication title Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules.
pubmed doi rcsb
molecule tags Toxin
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ccqA00
2MJ4A 3QB4B 1YWHA 2QJ9C 1KBAA 4QTIU 1CB9A 1CDSA 1ERGA 3BT1U 1LX5B 2X8BB 1LJZA 1ONJA 1CXOA 4FAOE 2ERAA 1KU6B 1XT3A 1ZADA 2CDXA 4IYEA 3FEVA 3U74U 2MJ0A 2UX2A 1RGJA 4FAOC 1IDGA 1IDHA 1TGXA 2PJYB 1CREA 1L4WA 2CRSA 1QM7A 2H7ZB 4XJJA 1V6PA 1HAAA 2CCXA 2I9BE 1KBTA 4HQPF 3EBXA 2FD6U 2HLRA 2H5FA 1CVOA 1G6MA 3VTSA 1QKDA 2LCRA 2BHIA 1JE9A 5IMTD 1KS6A 4OM4A 2HLQA 2CRTA 3BT2U 2MUOA 1BTEA 1KBSA 2H62C 1IDIA 2PJYC 1HC9B 4RUDA 1NORA 2NBTA 2MUPA 3PLCA 1COEA 1CODA 1FRAA 3NH7A 1JBDA 1HC9A 1PLOA 4BDTB 1F8UB 2MJYA 1TFSA 1BXPA 1IDLA 1DRSA 1ERAA 1HAJA 1CDTA 1RL5A 3NDSA 2QC1A 1W6BA 2H7ZA 3HH7A 2L5SA 5DU1A 1B41B 4UY2C 2JVEA 3EVSC 5DO6A 1IKCA 1F94A 6EBXA 2MHYA 1I02A 1NYSA 2H64B 1CDQA 3KFDE 2GOOB 2CTXA 2MFAA 1CTXA 1FSSB 2H8UA 5DZ5A 1FSCA 5IMYC 4AEAA 1CXNA 1KC4A 4BIKB 2ABXA 1NYUA 3LAQU 1QKEA 1LSIA 2BTXA 1FF4A 1ES7B 2L03A 1CCQA 1NTNA 2LA1A 3ERAA 3U73U 1KFHA 1MR6A 2H64C 1TXAA 3KFDI 2K3GA 1TXBA 1CDRA 1NXBA 2GOOC 2N99A 1JGKA 1FFJA 1NTXA 1MAHF 1FASA 1KXIA 1S4YA 1VB0A 2JQPA 3NEQA 2UWRA 1M9ZA 1IQ9A 2H62D 1KTZB 2QJAC 4P7UA 1REWC 1ABTA 4EY8B 1NEAA 1H0JA 4LFTA 1KL8A 2QJBC 1UG4A 1CRFA 4OM5A 2VLWA 1IK8A 1LXHA 1IJCA 2J8BA 2OFSA 4DO8A 1LXGA 1CHVS 1HOYA 5EBXA 4ZQYA
chains in the Genus database with same CATH superfamily
4KSNA 2MJ4A 3QB4B 1YWHA 2QJ9C 1KBAA 4QTIU 1CB9A 1CDSA 1ERGA 3BT1U 1LX5B 2X8BB 1LJZA 1ONJA 1CXOA 4FAOE 2ERAA 1KU6B 1XT3A 1ZADA 2CDXA 4IYEA 3FEVA 3U74U 2MJ0A 2UX2A 1RGJA 4FAOC 1IDGA 1IDHA 1TGXA 2PJYB 1CREA 1L4WA 2CRSA 1QM7A 2H7ZB 4XJJA 1V6PA 1HAAA 2CCXA 2I9BE 1KBTA 4HQPF 3EBXA 2FD6U 2HLRA 2H5FA 1CVOA 1G6MA 3VTSA 1QKDA 2LCRA 2BHIA 1JE9A 5IMTD 1KS6A 4OM4A 2HLQA 2CRTA 3BT2U 2MUOA 1BTEA 1KBSA 2H62C 1IDIA 2PJYC 1HC9B 4RUDA 1NORA 2NBTA 2MUPA 3PLCA 1COEA 1CODA 1FRAA 3NH7A 1JBDA 1HC9A 1PLOA 4BDTB 1F8UB 2MJYA 1TFSA 1BXPA 1IDLA 1DRSA 1ERAA 1HAJA 1CDTA 1RL5A 3NDSA 2QC1A 1W6BA 2H7ZA 3HH7A 2L5SA 5DU1A 1B41B 4UY2C 2JVEA 3EVSC 5DO6A 1IKCA 1F94A 6EBXA 2MHYA 1I02A 1NYSA 2H64B 1CDQA 3KFDE 2GOOB 2CTXA 2MFAA 1CTXA 1FSSB 2H8UA 5DZ5A 1FSCA 5IMYC 4AEAA 1CXNA 1KC4A 4BIKB 2ABXA 1NYUA 3LAQU 1QKEA 1LSIA 2BTXA 1FF4A 1ES7B 2L03A 1CCQA 1NTNA 2LA1A 3ERAA 3U73U 1KFHA 1MR6A 2H64C 1TXAA 3KFDI 2K3GA 1TXBA 1CDRA 1NXBA 2GOOC 2N99A 1JGKA 1FFJA 1NTXA 1MAHF 1FASA 1KXIA 1S4YA 1VB0A 2JQPA 3NEQA 2UWRA 1M9ZA 1IQ9A 2H62D 1KTZB 2QJAC 4P7UA 1REWC 1ABTA 4EY8B 1NEAA 1H0JA 4LFTA 1KL8A 2QJBC 1UG4A 1CRFA 4OM5A 2VLWA 1IK8A 1LXHA 1IJCA 2J8BA 2OFSA 4DO8A 1LXGA 1CHVS 1HOYA 5EBXA 4ZQYA
chains in the Genus database with same CATH topology
4KSNA 2MJ4A 3QB4B 1YWHA 2QJ9C 1KBAA 4QTIU 1CB9A 1CDSA 1ERGA 3BT1U 1LX5B 2X8BB 1LJZA 1ONJA 1CXOA 4FAOE 2ERAA 1KU6B 1XT3A 1ZADA 2CDXA 4IYEA 3FEVA 3U74U 2MJ0A 2UX2A 1RGJA 4FAOC 1IDGA 1IDHA 1TGXA 2PJYB 1CREA 1L4WA 2CRSA 1QM7A 2H7ZB 4XJJA 1V6PA 1HAAA 2CCXA 2I9BE 1KBTA 4HQPF 3EBXA 2FD6U 2HLRA 2H5FA 1CVOA 1G6MA 3VTSA 1QKDA 2LCRA 2BHIA 1JE9A 5IMTD 1KS6A 4OM4A 2HLQA 2CRTA 3BT2U 2MUOA 1BTEA 1KBSA 2H62C 1IDIA 2PJYC 1HC9B 4RUDA 1NORA 2NBTA 2MUPA 3PLCA 1COEA 1CODA 1FRAA 3NH7A 1JBDA 1HC9A 1PLOA 4BDTB 1F8UB 2MJYA 1TFSA 1BXPA 1IDLA 1DRSA 1ERAA 1HAJA 1CDTA 1RL5A 3NDSA 2QC1A 1W6BA 2H7ZA 3HH7A 2L5SA 5DU1A 1B41B 4UY2C 2JVEA 3EVSC 5DO6A 1IKCA 1F94A 6EBXA 2MHYA 1I02A 1NYSA 2H64B 1CDQA 3KFDE 2GOOB 2CTXA 2MFAA 1CTXA 1FSSB 2H8UA 5DZ5A 1FSCA 5IMYC 4AEAA 1CXNA 1KC4A 4BIKB 2ABXA 1NYUA 3LAQU 1QKEA 1LSIA 2BTXA 1FF4A 1ES7B 2L03A 1CCQA 1NTNA 2LA1A 3ERAA 3U73U 1KFHA 1MR6A 2H64C 1TXAA 3KFDI 2K3GA 1TXBA 1CDRA 1NXBA 2GOOC 2N99A 1JGKA 1FFJA 1NTXA 1MAHF 1FASA 1KXIA 1S4YA 1VB0A 2JQPA 3NEQA 2UWRA 1M9ZA 1IQ9A 2H62D 1KTZB 2QJAC 4P7UA 1REWC 1ABTA 4EY8B 1NEAA 1H0JA 4LFTA 1KL8A 2QJBC 1UG4A 1CRFA 4OM5A 2VLWA 1IK8A 1LXHA 1IJCA 2J8BA 2OFSA 4DO8A 1LXGA 1CHVS 1HOYA 5EBXA 4ZQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJ4 A;  3QB4 B;  1YWH A;  2QJ9 C;  1KBA A;  4QTI U;  1CB9 A;  1CDS A;  1ERG A;  3BT1 U;  1LX5 B;  2X8B B;  1LJZ A;  1ONJ A;  1CXO A;  4FAO E;  2ERA A;  1KU6 B;  1XT3 A;  1ZAD A;  2CDX A;  4IYE A;  3FEV A;  3U74 U;  2MJ0 A;  2UX2 A;  1RGJ A;  4FAO C;  1IDG A;  1IDH A;  1TGX A;  2PJY B;  1CRE A;  1L4W A;  2CRS A;  1QM7 A;  2H7Z B;  4XJJ A;  1V6P A;  1HAA A;  2CCX A;  2I9B E;  1KBT A;  4HQP F;  3EBX A;  2FD6 U;  2HLR A;  2H5F A;  1CVO A;  1G6M A;  3VTS A;  1QKD A;  2LCR A;  2BHI A;  1JE9 A;  5IMT D;  1KS6 A;  4OM4 A;  2HLQ A;  2CRT A;  3BT2 U;  2MUO A;  1BTE A;  1KBS A;  2H62 C;  1IDI A;  2PJY C;  1HC9 B;  4RUD A;  1NOR A;  2NBT A;  2MUP A;  3PLC A;  1COE A;  1COD A;  1FRA A;  3NH7 A;  1JBD A;  1HC9 A;  1PLO A;  4BDT B;  1F8U B;  2MJY A;  1TFS A;  1BXP A;  1IDL A;  1DRS A;  1ERA A;  1HAJ A;  1CDT A;  1RL5 A;  3NDS A;  2QC1 A;  1W6B A;  2H7Z A;  3HH7 A;  2L5S A;  5DU1 A;  1B41 B;  4UY2 C;  2JVE A;  3EVS C;  5DO6 A;  1IKC A;  1F94 A;  6EBX A;  2MHY A;  1I02 A;  1NYS A;  2H64 B;  1CDQ A;  3KFD E;  2GOO B;  2CTX A;  2MFA A;  1CTX A;  1FSS B;  2H8U A;  5DZ5 A;  1FSC A;  5IMY C;  4AEA A;  1CXN A;  1KC4 A;  4BIK B;  2ABX A;  1NYU A;  3LAQ U;  1QKE A;  1LSI A;  2BTX A;  1FF4 A;  1ES7 B;  2L03 A;  1CCQ A;  1NTN A;  2LA1 A;  3ERA A;  3U73 U;  1KFH A;  1MR6 A;  2H64 C;  1TXA A;  3KFD I;  2K3G A;  1TXB A;  1CDR A;  1NXB A;  2GOO C;  2N99 A;  1JGK A;  1FFJ A;  1NTX A;  1MAH F;  1FAS A;  1KXI A;  1S4Y A;  1VB0 A;  2JQP A;  3NEQ A;  2UWR A;  1M9Z A;  1IQ9 A;  2H62 D;  1KTZ B;  2QJA C;  4P7U A;  1REW C;  1ABT A;  4EY8 B;  1NEA A;  1H0J A;  4LFT A;  1KL8 A;  2QJB C;  1UG4 A;  1CRF A;  4OM5 A;  2VLW A;  1IK8 A;  1LXH A;  1IJC A;  2J8B A;  2OFS A;  4DO8 A;  1LXG A;  1CHV S;  1HOY A;  5EBX A;  4ZQY A; 
#chains in the Genus database with same CATH topology
 4KSN A;  2MJ4 A;  3QB4 B;  1YWH A;  2QJ9 C;  1KBA A;  4QTI U;  1CB9 A;  1CDS A;  1ERG A;  3BT1 U;  1LX5 B;  2X8B B;  1LJZ A;  1ONJ A;  1CXO A;  4FAO E;  2ERA A;  1KU6 B;  1XT3 A;  1ZAD A;  2CDX A;  4IYE A;  3FEV A;  3U74 U;  2MJ0 A;  2UX2 A;  1RGJ A;  4FAO C;  1IDG A;  1IDH A;  1TGX A;  2PJY B;  1CRE A;  1L4W A;  2CRS A;  1QM7 A;  2H7Z B;  4XJJ A;  1V6P A;  1HAA A;  2CCX A;  2I9B E;  1KBT A;  4HQP F;  3EBX A;  2FD6 U;  2HLR A;  2H5F A;  1CVO A;  1G6M A;  3VTS A;  1QKD A;  2LCR A;  2BHI A;  1JE9 A;  5IMT D;  1KS6 A;  4OM4 A;  2HLQ A;  2CRT A;  3BT2 U;  2MUO A;  1BTE A;  1KBS A;  2H62 C;  1IDI A;  2PJY C;  1HC9 B;  4RUD A;  1NOR A;  2NBT A;  2MUP A;  3PLC A;  1COE A;  1COD A;  1FRA A;  3NH7 A;  1JBD A;  1HC9 A;  1PLO A;  4BDT B;  1F8U B;  2MJY A;  1TFS A;  1BXP A;  1IDL A;  1DRS A;  1ERA A;  1HAJ A;  1CDT A;  1RL5 A;  3NDS A;  2QC1 A;  1W6B A;  2H7Z A;  3HH7 A;  2L5S A;  5DU1 A;  1B41 B;  4UY2 C;  2JVE A;  3EVS C;  5DO6 A;  1IKC A;  1F94 A;  6EBX A;  2MHY A;  1I02 A;  1NYS A;  2H64 B;  1CDQ A;  3KFD E;  2GOO B;  2CTX A;  2MFA A;  1CTX A;  1FSS B;  2H8U A;  5DZ5 A;  1FSC A;  5IMY C;  4AEA A;  1CXN A;  1KC4 A;  4BIK B;  2ABX A;  1NYU A;  3LAQ U;  1QKE A;  1LSI A;  2BTX A;  1FF4 A;  1ES7 B;  2L03 A;  1CCQ A;  1NTN A;  2LA1 A;  3ERA A;  3U73 U;  1KFH A;  1MR6 A;  2H64 C;  1TXA A;  3KFD I;  2K3G A;  1TXB A;  1CDR A;  1NXB A;  2GOO C;  2N99 A;  1JGK A;  1FFJ A;  1NTX A;  1MAH F;  1FAS A;  1KXI A;  1S4Y A;  1VB0 A;  2JQP A;  3NEQ A;  2UWR A;  1M9Z A;  1IQ9 A;  2H62 D;  1KTZ B;  2QJA C;  4P7U A;  1REW C;  1ABT A;  4EY8 B;  1NEA A;  1H0J A;  4LFT A;  1KL8 A;  2QJB C;  1UG4 A;  1CRF A;  4OM5 A;  2VLW A;  1IK8 A;  1LXH A;  1IJC A;  2J8B A;  2OFS A;  4DO8 A;  1LXG A;  1CHV S;  1HOY A;  5EBX A;  4ZQY A; 
#chains in the Genus database with same CATH homology
 4KSN A;  2MJ4 A;  3QB4 B;  1YWH A;  2QJ9 C;  1KBA A;  4QTI U;  1CB9 A;  1CDS A;  1ERG A;  3BT1 U;  1LX5 B;  2X8B B;  1LJZ A;  1ONJ A;  1CXO A;  4FAO E;  2ERA A;  1KU6 B;  1XT3 A;  1ZAD A;  2CDX A;  4IYE A;  3FEV A;  3U74 U;  2MJ0 A;  2UX2 A;  1RGJ A;  4FAO C;  1IDG A;  1IDH A;  1TGX A;  2PJY B;  1CRE A;  1L4W A;  2CRS A;  1QM7 A;  2H7Z B;  4XJJ A;  1V6P A;  1HAA A;  2CCX A;  2I9B E;  1KBT A;  4HQP F;  3EBX A;  2FD6 U;  2HLR A;  2H5F A;  1CVO A;  1G6M A;  3VTS A;  1QKD A;  2LCR A;  2BHI A;  1JE9 A;  5IMT D;  1KS6 A;  4OM4 A;  2HLQ A;  2CRT A;  3BT2 U;  2MUO A;  1BTE A;  1KBS A;  2H62 C;  1IDI A;  2PJY C;  1HC9 B;  4RUD A;  1NOR A;  2NBT A;  2MUP A;  3PLC A;  1COE A;  1COD A;  1FRA A;  3NH7 A;  1JBD A;  1HC9 A;  1PLO A;  4BDT B;  1F8U B;  2MJY A;  1TFS A;  1BXP A;  1IDL A;  1DRS A;  1ERA A;  1HAJ A;  1CDT A;  1RL5 A;  3NDS A;  2QC1 A;  1W6B A;  2H7Z A;  3HH7 A;  2L5S A;  5DU1 A;  1B41 B;  4UY2 C;  2JVE A;  3EVS C;  5DO6 A;  1IKC A;  1F94 A;  6EBX A;  2MHY A;  1I02 A;  1NYS A;  2H64 B;  1CDQ A;  3KFD E;  2GOO B;  2CTX A;  2MFA A;  1CTX A;  1FSS B;  2H8U A;  5DZ5 A;  1FSC A;  5IMY C;  4AEA A;  1CXN A;  1KC4 A;  4BIK B;  2ABX A;  1NYU A;  3LAQ U;  1QKE A;  1LSI A;  2BTX A;  1FF4 A;  1ES7 B;  2L03 A;  1CCQ A;  1NTN A;  2LA1 A;  3ERA A;  3U73 U;  1KFH A;  1MR6 A;  2H64 C;  1TXA A;  3KFD I;  2K3G A;  1TXB A;  1CDR A;  1NXB A;  2GOO C;  2N99 A;  1JGK A;  1FFJ A;  1NTX A;  1MAH F;  1FAS A;  1KXI A;  1S4Y A;  1VB0 A;  2JQP A;  3NEQ A;  2UWR A;  1M9Z A;  1IQ9 A;  2H62 D;  1KTZ B;  2QJA C;  4P7U A;  1REW C;  1ABT A;  4EY8 B;  1NEA A;  1H0J A;  4LFT A;  1KL8 A;  2QJB C;  1UG4 A;  1CRF A;  4OM5 A;  2VLW A;  1IK8 A;  1LXH A;  1IJC A;  2J8B A;  2OFS A;  4DO8 A;  1LXG A;  1CHV S;  1HOY A;  5EBX A;  4ZQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...