1CCQA

Nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules.
pubmed doi rcsb
molecule tags Toxin
molecule keywords PROTEIN (CYTOTOXIN 2)
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ccqA00
1MR6A 1DRSA 1CDQA 3BT1U 1LSIA 3NDSA 1ZADA 1CDSA 2K3GA 1HAAA 2L03A 2X8BB 5EBXA 1CDTA 5IMTD 1CHVS 1NTNA 2H7ZA 3U73U 2NBTA 1COEA 2UX2A 1CVOA 1IDIA 1NTXA 2BTXA 2QJBC 3VTSA 1JE9A 1ES7B 1IDGA 3NEQA 1CDRA 1HC9B 1CB9A 2FD6U 1CRFA 2ABXA 1VB0A 1BXPA 1LXGA 1CTXA 1FRAA 2HLQA 1NXBA 2CTXA 2LA1A 4DO8A 1HAJA 1KL8A 4UY2C 1ABTA 1QM7A 2CDXA 2OFSA 1G6MA 3KFDE 1KU6B 1IK8A 1JGKA 2LCRA 4EY8B 1W6BA 1M9ZA 2MHYA 4ZQYA 1FSSB 1HOYA 1I02A 2JVEA 1CXNA 1ERAA 2I9BE 4XJJA 5DZ5A 1KTZB 4QTIU 3PLCA 1CXOA 1BTEA 3NH7A 4AEAA 1QKDA 1CREA 2H62D 1CCQA 1B41B 3HH7A 1QKEA 2HLRA 1H0JA 3EBXA 1LXHA 1TFSA 3BT2U 3EVSC 2MUOA 2QJ9C 1XT3A 1CODA 1F94A 5DO6A 2GOOB 4BDTB 1KBSA 1RGJA 1TXBA 2N99A 2VLWA 3ERAA 1ONJA 1IJCA 1KFHA 1FASA 1FSCA 1S4YA 4LFTA 2MJ4A 1TXAA 4P7UA 5IMYC 2H64C 1RL5A 2ERAA 1NORA 2MJYA 2PJYB 1IQ9A 1ERGA 1KXIA 1TGXA 1LX5B 1FF4A 1REWC 3LAQU 1KBTA 2L5SA 4OM4A 4OM5A 2BHIA 2UWRA 1YWHA 1KBAA 1F8UB 1LJZA 2CRSA 1IKCA 2J8BA 3QB4B 1UG4A 1MAHF 2H7ZB 1L4WA 2QJAC 2H62C 1NEAA 2CCXA 2QC1A 1V6PA 1FFJA 1NYSA 4HQPF 1JBDA 1KC4A 4FAOE 2JQPA 2MJ0A 3KFDI 1IDHA 6EBXA 2GOOC 2CRTA 2H8UA 4IYEA 1NYUA 2MFAA 2MUPA 4RUDA 5DU1A 4FAOC 2PJYC 1KS6A 1IDLA 2H5FA 2H64B 3U74U 3FEVA 1PLOA 4BIKB 1HC9A
chains in the Genus database with same CATH superfamily
1MR6A 1DRSA 1CDQA 3BT1U 1LSIA 3NDSA 1ZADA 1CDSA 2K3GA 1HAAA 2L03A 2X8BB 5EBXA 1CDTA 5IMTD 1CHVS 1NTNA 2H7ZA 3U73U 2NBTA 1COEA 2UX2A 1CVOA 1IDIA 1NTXA 2BTXA 2QJBC 3VTSA 1JE9A 1ES7B 1IDGA 3NEQA 1CDRA 1HC9B 1CB9A 2FD6U 1CRFA 2ABXA 1VB0A 1BXPA 1LXGA 1CTXA 1FRAA 2HLQA 1NXBA 2CTXA 2LA1A 4DO8A 1HAJA 1KL8A 4UY2C 1ABTA 1QM7A 2CDXA 2OFSA 1G6MA 3KFDE 1KU6B 1IK8A 1JGKA 2LCRA 4EY8B 1W6BA 1M9ZA 2MHYA 4ZQYA 1FSSB 1HOYA 1I02A 2JVEA 1CXNA 1ERAA 2I9BE 4XJJA 5DZ5A 1KTZB 4QTIU 3PLCA 1CXOA 1BTEA 3NH7A 4AEAA 1QKDA 1CREA 2H62D 1CCQA 1B41B 3HH7A 1QKEA 2HLRA 1H0JA 3EBXA 1LXHA 1TFSA 3BT2U 3EVSC 2MUOA 2QJ9C 1XT3A 1CODA 1F94A 5DO6A 2GOOB 4BDTB 1KBSA 1RGJA 1TXBA 2N99A 2VLWA 3ERAA 1ONJA 1IJCA 1KFHA 1FASA 1FSCA 1S4YA 4LFTA 2MJ4A 1TXAA 4P7UA 5IMYC 2H64C 1RL5A 2ERAA 1NORA 2MJYA 2PJYB 1IQ9A 4KSNA 1ERGA 1KXIA 1TGXA 1LX5B 1FF4A 1REWC 3LAQU 1KBTA 2L5SA 4OM4A 4OM5A 2BHIA 2UWRA 1YWHA 1KBAA 1F8UB 1LJZA 2CRSA 1IKCA 2J8BA 3QB4B 1UG4A 1MAHF 2H7ZB 1L4WA 2QJAC 2H62C 1NEAA 2CCXA 2QC1A 1V6PA 1FFJA 1NYSA 4HQPF 1JBDA 1KC4A 4FAOE 2JQPA 2MJ0A 3KFDI 1IDHA 6EBXA 2GOOC 2CRTA 2H8UA 4IYEA 1NYUA 2MFAA 2MUPA 4RUDA 5DU1A 4FAOC 2PJYC 1KS6A 1IDLA 2H5FA 2H64B 3U74U 3FEVA 1PLOA 4BIKB 1HC9A
chains in the Genus database with same CATH topology
1MR6A 1DRSA 1CDQA 3BT1U 1LSIA 3NDSA 1ZADA 1CDSA 2K3GA 1HAAA 2L03A 2X8BB 5EBXA 1CDTA 5IMTD 1CHVS 1NTNA 2H7ZA 3U73U 2NBTA 1COEA 2UX2A 1CVOA 1IDIA 1NTXA 2BTXA 2QJBC 3VTSA 1JE9A 1ES7B 1IDGA 3NEQA 1CDRA 1HC9B 1CB9A 2FD6U 1CRFA 2ABXA 1VB0A 1BXPA 1LXGA 1CTXA 1FRAA 2HLQA 1NXBA 2CTXA 2LA1A 4DO8A 1HAJA 1KL8A 4UY2C 1ABTA 1QM7A 2CDXA 2OFSA 1G6MA 3KFDE 1KU6B 1IK8A 1JGKA 2LCRA 4EY8B 1W6BA 1M9ZA 2MHYA 4ZQYA 1FSSB 1HOYA 1I02A 2JVEA 1CXNA 1ERAA 2I9BE 4XJJA 5DZ5A 1KTZB 4QTIU 3PLCA 1CXOA 1BTEA 3NH7A 4AEAA 1QKDA 1CREA 2H62D 1CCQA 1B41B 3HH7A 1QKEA 2HLRA 1H0JA 3EBXA 1LXHA 1TFSA 3BT2U 3EVSC 2MUOA 2QJ9C 1XT3A 1CODA 1F94A 5DO6A 2GOOB 4BDTB 1KBSA 1RGJA 1TXBA 2N99A 2VLWA 3ERAA 1ONJA 1IJCA 1KFHA 1FASA 1FSCA 1S4YA 4LFTA 2MJ4A 1TXAA 4P7UA 5IMYC 2H64C 1RL5A 2ERAA 1NORA 2MJYA 2PJYB 1IQ9A 4KSNA 1ERGA 1KXIA 1TGXA 1LX5B 1FF4A 1REWC 3LAQU 1KBTA 2L5SA 4OM4A 4OM5A 2BHIA 2UWRA 1YWHA 1KBAA 1F8UB 1LJZA 2CRSA 1IKCA 2J8BA 3QB4B 1UG4A 1MAHF 2H7ZB 1L4WA 2QJAC 2H62C 1NEAA 2CCXA 2QC1A 1V6PA 1FFJA 1NYSA 4HQPF 1JBDA 1KC4A 4FAOE 2JQPA 2MJ0A 3KFDI 1IDHA 6EBXA 2GOOC 2CRTA 2H8UA 4IYEA 1NYUA 2MFAA 2MUPA 4RUDA 5DU1A 4FAOC 2PJYC 1KS6A 1IDLA 2H5FA 2H64B 3U74U 3FEVA 1PLOA 4BIKB 1HC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MR6 A;  1DRS A;  1CDQ A;  3BT1 U;  1LSI A;  3NDS A;  1ZAD A;  1CDS A;  2K3G A;  1HAA A;  2L03 A;  2X8B B;  5EBX A;  1CDT A;  5IMT D;  1CHV S;  1NTN A;  2H7Z A;  3U73 U;  2NBT A;  1COE A;  2UX2 A;  1CVO A;  1IDI A;  1NTX A;  2BTX A;  2QJB C;  3VTS A;  1JE9 A;  1ES7 B;  1IDG A;  3NEQ A;  1CDR A;  1HC9 B;  1CB9 A;  2FD6 U;  1CRF A;  2ABX A;  1VB0 A;  1BXP A;  1LXG A;  1CTX A;  1FRA A;  2HLQ A;  1NXB A;  2CTX A;  2LA1 A;  4DO8 A;  1HAJ A;  1KL8 A;  4UY2 C;  1ABT A;  1QM7 A;  2CDX A;  2OFS A;  1G6M A;  3KFD E;  1KU6 B;  1IK8 A;  1JGK A;  2LCR A;  4EY8 B;  1W6B A;  1M9Z A;  2MHY A;  4ZQY A;  1FSS B;  1HOY A;  1I02 A;  2JVE A;  1CXN A;  1ERA A;  2I9B E;  4XJJ A;  5DZ5 A;  1KTZ B;  4QTI U;  3PLC A;  1CXO A;  1BTE A;  3NH7 A;  4AEA A;  1QKD A;  1CRE A;  2H62 D;  1CCQ A;  1B41 B;  3HH7 A;  1QKE A;  2HLR A;  1H0J A;  3EBX A;  1LXH A;  1TFS A;  3BT2 U;  3EVS C;  2MUO A;  2QJ9 C;  1XT3 A;  1COD A;  1F94 A;  5DO6 A;  2GOO B;  4BDT B;  1KBS A;  1RGJ A;  1TXB A;  2N99 A;  2VLW A;  3ERA A;  1ONJ A;  1IJC A;  1KFH A;  1FAS A;  1FSC A;  1S4Y A;  4LFT A;  2MJ4 A;  1TXA A;  4P7U A;  5IMY C;  2H64 C;  1RL5 A;  2ERA A;  1NOR A;  2MJY A;  2PJY B;  1IQ9 A;  1ERG A;  1KXI A;  1TGX A;  1LX5 B;  1FF4 A;  1REW C;  3LAQ U;  1KBT A;  2L5S A;  4OM4 A;  4OM5 A;  2BHI A;  2UWR A;  1YWH A;  1KBA A;  1F8U B;  1LJZ A;  2CRS A;  1IKC A;  2J8B A;  3QB4 B;  1UG4 A;  1MAH F;  2H7Z B;  1L4W A;  2QJA C;  2H62 C;  1NEA A;  2CCX A;  2QC1 A;  1V6P A;  1FFJ A;  1NYS A;  4HQP F;  1JBD A;  1KC4 A;  4FAO E;  2JQP A;  2MJ0 A;  3KFD I;  1IDH A;  6EBX A;  2GOO C;  2CRT A;  2H8U A;  4IYE A;  1NYU A;  2MFA A;  2MUP A;  4RUD A;  5DU1 A;  4FAO C;  2PJY C;  1KS6 A;  1IDL A;  2H5F A;  2H64 B;  3U74 U;  3FEV A;  1PLO A;  4BIK B;  1HC9 A; 
#chains in the Genus database with same CATH topology
 1MR6 A;  1DRS A;  1CDQ A;  3BT1 U;  1LSI A;  3NDS A;  1ZAD A;  1CDS A;  2K3G A;  1HAA A;  2L03 A;  2X8B B;  5EBX A;  1CDT A;  5IMT D;  1CHV S;  1NTN A;  2H7Z A;  3U73 U;  2NBT A;  1COE A;  2UX2 A;  1CVO A;  1IDI A;  1NTX A;  2BTX A;  2QJB C;  3VTS A;  1JE9 A;  1ES7 B;  1IDG A;  3NEQ A;  1CDR A;  1HC9 B;  1CB9 A;  2FD6 U;  1CRF A;  2ABX A;  1VB0 A;  1BXP A;  1LXG A;  1CTX A;  1FRA A;  2HLQ A;  1NXB A;  2CTX A;  2LA1 A;  4DO8 A;  1HAJ A;  1KL8 A;  4UY2 C;  1ABT A;  1QM7 A;  2CDX A;  2OFS A;  1G6M A;  3KFD E;  1KU6 B;  1IK8 A;  1JGK A;  2LCR A;  4EY8 B;  1W6B A;  1M9Z A;  2MHY A;  4ZQY A;  1FSS B;  1HOY A;  1I02 A;  2JVE A;  1CXN A;  1ERA A;  2I9B E;  4XJJ A;  5DZ5 A;  1KTZ B;  4QTI U;  3PLC A;  1CXO A;  1BTE A;  3NH7 A;  4AEA A;  1QKD A;  1CRE A;  2H62 D;  1CCQ A;  1B41 B;  3HH7 A;  1QKE A;  2HLR A;  1H0J A;  3EBX A;  1LXH A;  1TFS A;  3BT2 U;  3EVS C;  2MUO A;  2QJ9 C;  1XT3 A;  1COD A;  1F94 A;  5DO6 A;  2GOO B;  4BDT B;  1KBS A;  1RGJ A;  1TXB A;  2N99 A;  2VLW A;  3ERA A;  1ONJ A;  1IJC A;  1KFH A;  1FAS A;  1FSC A;  1S4Y A;  4LFT A;  2MJ4 A;  1TXA A;  4P7U A;  5IMY C;  2H64 C;  1RL5 A;  2ERA A;  1NOR A;  2MJY A;  2PJY B;  1IQ9 A;  4KSN A;  1ERG A;  1KXI A;  1TGX A;  1LX5 B;  1FF4 A;  1REW C;  3LAQ U;  1KBT A;  2L5S A;  4OM4 A;  4OM5 A;  2BHI A;  2UWR A;  1YWH A;  1KBA A;  1F8U B;  1LJZ A;  2CRS A;  1IKC A;  2J8B A;  3QB4 B;  1UG4 A;  1MAH F;  2H7Z B;  1L4W A;  2QJA C;  2H62 C;  1NEA A;  2CCX A;  2QC1 A;  1V6P A;  1FFJ A;  1NYS A;  4HQP F;  1JBD A;  1KC4 A;  4FAO E;  2JQP A;  2MJ0 A;  3KFD I;  1IDH A;  6EBX A;  2GOO C;  2CRT A;  2H8U A;  4IYE A;  1NYU A;  2MFA A;  2MUP A;  4RUD A;  5DU1 A;  4FAO C;  2PJY C;  1KS6 A;  1IDL A;  2H5F A;  2H64 B;  3U74 U;  3FEV A;  1PLO A;  4BIK B;  1HC9 A; 
#chains in the Genus database with same CATH homology
 1MR6 A;  1DRS A;  1CDQ A;  3BT1 U;  1LSI A;  3NDS A;  1ZAD A;  1CDS A;  2K3G A;  1HAA A;  2L03 A;  2X8B B;  5EBX A;  1CDT A;  5IMT D;  1CHV S;  1NTN A;  2H7Z A;  3U73 U;  2NBT A;  1COE A;  2UX2 A;  1CVO A;  1IDI A;  1NTX A;  2BTX A;  2QJB C;  3VTS A;  1JE9 A;  1ES7 B;  1IDG A;  3NEQ A;  1CDR A;  1HC9 B;  1CB9 A;  2FD6 U;  1CRF A;  2ABX A;  1VB0 A;  1BXP A;  1LXG A;  1CTX A;  1FRA A;  2HLQ A;  1NXB A;  2CTX A;  2LA1 A;  4DO8 A;  1HAJ A;  1KL8 A;  4UY2 C;  1ABT A;  1QM7 A;  2CDX A;  2OFS A;  1G6M A;  3KFD E;  1KU6 B;  1IK8 A;  1JGK A;  2LCR A;  4EY8 B;  1W6B A;  1M9Z A;  2MHY A;  4ZQY A;  1FSS B;  1HOY A;  1I02 A;  2JVE A;  1CXN A;  1ERA A;  2I9B E;  4XJJ A;  5DZ5 A;  1KTZ B;  4QTI U;  3PLC A;  1CXO A;  1BTE A;  3NH7 A;  4AEA A;  1QKD A;  1CRE A;  2H62 D;  1CCQ A;  1B41 B;  3HH7 A;  1QKE A;  2HLR A;  1H0J A;  3EBX A;  1LXH A;  1TFS A;  3BT2 U;  3EVS C;  2MUO A;  2QJ9 C;  1XT3 A;  1COD A;  1F94 A;  5DO6 A;  2GOO B;  4BDT B;  1KBS A;  1RGJ A;  1TXB A;  2N99 A;  2VLW A;  3ERA A;  1ONJ A;  1IJC A;  1KFH A;  1FAS A;  1FSC A;  1S4Y A;  4LFT A;  2MJ4 A;  1TXA A;  4P7U A;  5IMY C;  2H64 C;  1RL5 A;  2ERA A;  1NOR A;  2MJY A;  2PJY B;  1IQ9 A;  4KSN A;  1ERG A;  1KXI A;  1TGX A;  1LX5 B;  1FF4 A;  1REW C;  3LAQ U;  1KBT A;  2L5S A;  4OM4 A;  4OM5 A;  2BHI A;  2UWR A;  1YWH A;  1KBA A;  1F8U B;  1LJZ A;  2CRS A;  1IKC A;  2J8B A;  3QB4 B;  1UG4 A;  1MAH F;  2H7Z B;  1L4W A;  2QJA C;  2H62 C;  1NEA A;  2CCX A;  2QC1 A;  1V6P A;  1FFJ A;  1NYS A;  4HQP F;  1JBD A;  1KC4 A;  4FAO E;  2JQP A;  2MJ0 A;  3KFD I;  1IDH A;  6EBX A;  2GOO C;  2CRT A;  2H8U A;  4IYE A;  1NYU A;  2MFA A;  2MUP A;  4RUD A;  5DU1 A;  4FAO C;  2PJY C;  1KS6 A;  1IDL A;  2H5F A;  2H64 B;  3U74 U;  3FEV A;  1PLO A;  4BIK B;  1HC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...