1CCQA

Nmr structure with tightly bound water molecules of cytotoxin ii (cardiotoxin) from naja naja oxiana in aqueous solution (minor form).
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
60
structure length
60
Chain Sequence
LKCKKLVPLFSKTCPAGKNLCYKMFMVAAPHVPVKRGCIDVCPKSSLLVKYVCCNTDKCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords PROTEIN (CYTOTOXIN 2)
publication title Two forms of cytotoxin II (cardiotoxin) from Naja naja oxiana in aqueous solution: spatial structures with tightly bound water molecules.
pubmed doi rcsb
total genus 7
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1999-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 1ccqA00
1QM7A 2PJYC 2QJ9C 1KC4A 1JGKA 2FD6U 1CODA 1CHVS 1KU6B 4UY2C 1G6MA 2H64B 4AEAA 1XT3A 2UX2A 2MUOA 3EVSC 1NORA 1ES7B 1LSIA 1KBSA 4FAOE 1QKEA 4FAOC 2GOOC 2LCRA 1KXIA 4DO8A 1TFSA 1CDRA 2L03A 3KFDE 4BDTB 2MJ0A 2L5SA 1F94A 3LAQU 6EBXA 1HOYA 2MHYA 2MJYA 1ERAA 1NTNA 3KFDI 2BHIA 2QJAC 5IMYC 1KFHA 2MUPA 2HLRA 3VTSA 2ERAA 2UWRA 1LX5B 3PLCA 5DO6A 1COEA 5IMTD 4P7UA 2PJYB 1CCQA 1KS6A 1TGXA 4RUDA 1ERGA 2H8UA 1BXPA 1CTXA 1FSSB 1CRFA 1KL8A 5DZ5A 1QKDA 2I9BE 1FFJA 1NXBA 1ABTA 2CTXA 1RL5A 2NBTA 2H62C 2CRSA 2ABXA 4LFTA 2BTXA 2JQPA 1CB9A 2CCXA 1IQ9A 1FSCA 4OM5A 1LXGA 3ERAA 3U73U 1IK8A 2H5FA 2GOOB 2JVEA 4ZQYA 1F8UB 1IJCA 1NYSA 1V6PA 1DRSA 3FEVA 1LJZA 1H0JA 1KTZB 5EBXA 1KBAA 1JBDA 1HC9B 3QB4B 2VLWA 1ONJA 4XJJA 1IKCA 1HC9A 2OFSA 1S4YA 1HAAA 1PLOA 2H64C 2MJ4A 4QTIU 4BIKB 1CDTA 1CVOA 2N99A 1NEAA 1TXBA 2H62D 1MAHF 3NDSA 1JE9A 2QC1A 2LA1A 1CXOA 1TXAA 3NH7A 1CDQA 1I02A 2MFAA 1KBTA 2CRTA 1IDGA 2K3GA 3HH7A 1HAJA 1NTXA 2HLQA 3U74U 1RGJA 1ZADA 4IYEA 4OM4A 2X8BB 1BTEA 2CDXA 3BT1U 1CREA 1CXNA 2H7ZB 1FRAA 1CDSA 1FASA 1UG4A 2QJBC 2J8BA 1IDLA 1REWC 2H7ZA 1NYUA 1M9ZA 1MR6A 1IDIA 3BT2U 1B41B 1VB0A 4HQPF 1YWHA 1FF4A 1W6BA 4EY8B 3NEQA 3EBXA 1IDHA 1LXHA 1L4WA 5DU1A
chains in the Genus database with same CATH superfamily
1QM7A 2PJYC 2QJ9C 1KC4A 1JGKA 2FD6U 1CODA 1CHVS 1KU6B 4UY2C 1G6MA 2H64B 4AEAA 1XT3A 2UX2A 2MUOA 3EVSC 1NORA 1ES7B 1LSIA 1KBSA 4FAOE 1QKEA 4FAOC 2GOOC 2LCRA 1KXIA 4DO8A 1TFSA 1CDRA 2L03A 3KFDE 4BDTB 2MJ0A 2L5SA 1F94A 3LAQU 6EBXA 1HOYA 2MHYA 2MJYA 1ERAA 1NTNA 3KFDI 2BHIA 2QJAC 5IMYC 1KFHA 2MUPA 2HLRA 3VTSA 2ERAA 2UWRA 1LX5B 3PLCA 5DO6A 1COEA 5IMTD 4P7UA 2PJYB 1CCQA 1KS6A 1TGXA 4RUDA 1ERGA 2H8UA 1BXPA 1CTXA 1FSSB 1CRFA 1KL8A 5DZ5A 1QKDA 2I9BE 1FFJA 1NXBA 1ABTA 2CTXA 1RL5A 2NBTA 2H62C 2CRSA 2ABXA 4LFTA 2BTXA 2JQPA 1CB9A 2CCXA 1IQ9A 1FSCA 4OM5A 1LXGA 3ERAA 3U73U 1IK8A 2H5FA 2GOOB 2JVEA 4ZQYA 1F8UB 1IJCA 1NYSA 1V6PA 1DRSA 3FEVA 1LJZA 1H0JA 1KTZB 5EBXA 1KBAA 1JBDA 1HC9B 3QB4B 2VLWA 1ONJA 4XJJA 1IKCA 1HC9A 2OFSA 1S4YA 1HAAA 1PLOA 2H64C 2MJ4A 4QTIU 4BIKB 1CDTA 1CVOA 2N99A 1NEAA 1TXBA 2H62D 1MAHF 3NDSA 1JE9A 2QC1A 2LA1A 1CXOA 1TXAA 3NH7A 1CDQA 1I02A 2MFAA 1KBTA 2CRTA 1IDGA 2K3GA 3HH7A 1HAJA 1NTXA 2HLQA 3U74U 1RGJA 4KSNA 1ZADA 4IYEA 4OM4A 2X8BB 1BTEA 2CDXA 3BT1U 1CREA 1CXNA 2H7ZB 1FRAA 1CDSA 1FASA 1UG4A 2QJBC 2J8BA 1IDLA 1REWC 2H7ZA 1NYUA 1M9ZA 1MR6A 1IDIA 3BT2U 1B41B 1VB0A 4HQPF 1YWHA 1FF4A 1W6BA 4EY8B 3NEQA 3EBXA 1IDHA 1LXHA 1L4WA 5DU1A
chains in the Genus database with same CATH topology
1QM7A 2PJYC 2QJ9C 1KC4A 1JGKA 2FD6U 1CODA 1CHVS 1KU6B 4UY2C 1G6MA 2H64B 4AEAA 1XT3A 2UX2A 2MUOA 3EVSC 1NORA 1ES7B 1LSIA 1KBSA 4FAOE 1QKEA 4FAOC 2GOOC 2LCRA 1KXIA 4DO8A 1TFSA 1CDRA 2L03A 3KFDE 4BDTB 2MJ0A 2L5SA 1F94A 3LAQU 6EBXA 1HOYA 2MHYA 2MJYA 1ERAA 1NTNA 3KFDI 2BHIA 2QJAC 5IMYC 1KFHA 2MUPA 2HLRA 3VTSA 2ERAA 2UWRA 1LX5B 3PLCA 5DO6A 1COEA 5IMTD 4P7UA 2PJYB 1CCQA 1KS6A 1TGXA 4RUDA 1ERGA 2H8UA 1BXPA 1CTXA 1FSSB 1CRFA 1KL8A 5DZ5A 1QKDA 2I9BE 1FFJA 1NXBA 1ABTA 2CTXA 1RL5A 2NBTA 2H62C 2CRSA 2ABXA 4LFTA 2BTXA 2JQPA 1CB9A 2CCXA 1IQ9A 1FSCA 4OM5A 1LXGA 3ERAA 3U73U 1IK8A 2H5FA 2GOOB 2JVEA 4ZQYA 1F8UB 1IJCA 1NYSA 1V6PA 1DRSA 3FEVA 1LJZA 1H0JA 1KTZB 5EBXA 1KBAA 1JBDA 1HC9B 3QB4B 2VLWA 1ONJA 4XJJA 1IKCA 1HC9A 2OFSA 1S4YA 1HAAA 1PLOA 2H64C 2MJ4A 4QTIU 4BIKB 1CDTA 1CVOA 2N99A 1NEAA 1TXBA 2H62D 1MAHF 3NDSA 1JE9A 2QC1A 2LA1A 1CXOA 1TXAA 3NH7A 1CDQA 1I02A 2MFAA 1KBTA 2CRTA 1IDGA 2K3GA 3HH7A 1HAJA 1NTXA 2HLQA 3U74U 1RGJA 4KSNA 1ZADA 4IYEA 4OM4A 2X8BB 1BTEA 2CDXA 3BT1U 1CREA 1CXNA 2H7ZB 1FRAA 1CDSA 1FASA 1UG4A 2QJBC 2J8BA 1IDLA 1REWC 2H7ZA 1NYUA 1M9ZA 1MR6A 1IDIA 3BT2U 1B41B 1VB0A 4HQPF 1YWHA 1FF4A 1W6BA 4EY8B 3NEQA 3EBXA 1IDHA 1LXHA 1L4WA 5DU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QM7 A;  2PJY C;  2QJ9 C;  1KC4 A;  1JGK A;  2FD6 U;  1COD A;  1CHV S;  1KU6 B;  4UY2 C;  1G6M A;  2H64 B;  4AEA A;  1XT3 A;  2UX2 A;  2MUO A;  3EVS C;  1NOR A;  1ES7 B;  1LSI A;  1KBS A;  4FAO E;  1QKE A;  4FAO C;  2GOO C;  2LCR A;  1KXI A;  4DO8 A;  1TFS A;  1CDR A;  2L03 A;  3KFD E;  4BDT B;  2MJ0 A;  2L5S A;  1F94 A;  3LAQ U;  6EBX A;  1HOY A;  2MHY A;  2MJY A;  1ERA A;  1NTN A;  3KFD I;  2BHI A;  2QJA C;  5IMY C;  1KFH A;  2MUP A;  2HLR A;  3VTS A;  2ERA A;  2UWR A;  1LX5 B;  3PLC A;  5DO6 A;  1COE A;  5IMT D;  4P7U A;  2PJY B;  1CCQ A;  1KS6 A;  1TGX A;  4RUD A;  1ERG A;  2H8U A;  1BXP A;  1CTX A;  1FSS B;  1CRF A;  1KL8 A;  5DZ5 A;  1QKD A;  2I9B E;  1FFJ A;  1NXB A;  1ABT A;  2CTX A;  1RL5 A;  2NBT A;  2H62 C;  2CRS A;  2ABX A;  4LFT A;  2BTX A;  2JQP A;  1CB9 A;  2CCX A;  1IQ9 A;  1FSC A;  4OM5 A;  1LXG A;  3ERA A;  3U73 U;  1IK8 A;  2H5F A;  2GOO B;  2JVE A;  4ZQY A;  1F8U B;  1IJC A;  1NYS A;  1V6P A;  1DRS A;  3FEV A;  1LJZ A;  1H0J A;  1KTZ B;  5EBX A;  1KBA A;  1JBD A;  1HC9 B;  3QB4 B;  2VLW A;  1ONJ A;  4XJJ A;  1IKC A;  1HC9 A;  2OFS A;  1S4Y A;  1HAA A;  1PLO A;  2H64 C;  2MJ4 A;  4QTI U;  4BIK B;  1CDT A;  1CVO A;  2N99 A;  1NEA A;  1TXB A;  2H62 D;  1MAH F;  3NDS A;  1JE9 A;  2QC1 A;  2LA1 A;  1CXO A;  1TXA A;  3NH7 A;  1CDQ A;  1I02 A;  2MFA A;  1KBT A;  2CRT A;  1IDG A;  2K3G A;  3HH7 A;  1HAJ A;  1NTX A;  2HLQ A;  3U74 U;  1RGJ A;  1ZAD A;  4IYE A;  4OM4 A;  2X8B B;  1BTE A;  2CDX A;  3BT1 U;  1CRE A;  1CXN A;  2H7Z B;  1FRA A;  1CDS A;  1FAS A;  1UG4 A;  2QJB C;  2J8B A;  1IDL A;  1REW C;  2H7Z A;  1NYU A;  1M9Z A;  1MR6 A;  1IDI A;  3BT2 U;  1B41 B;  1VB0 A;  4HQP F;  1YWH A;  1FF4 A;  1W6B A;  4EY8 B;  3NEQ A;  3EBX A;  1IDH A;  1LXH A;  1L4W A;  5DU1 A; 
#chains in the Genus database with same CATH topology
 1QM7 A;  2PJY C;  2QJ9 C;  1KC4 A;  1JGK A;  2FD6 U;  1COD A;  1CHV S;  1KU6 B;  4UY2 C;  1G6M A;  2H64 B;  4AEA A;  1XT3 A;  2UX2 A;  2MUO A;  3EVS C;  1NOR A;  1ES7 B;  1LSI A;  1KBS A;  4FAO E;  1QKE A;  4FAO C;  2GOO C;  2LCR A;  1KXI A;  4DO8 A;  1TFS A;  1CDR A;  2L03 A;  3KFD E;  4BDT B;  2MJ0 A;  2L5S A;  1F94 A;  3LAQ U;  6EBX A;  1HOY A;  2MHY A;  2MJY A;  1ERA A;  1NTN A;  3KFD I;  2BHI A;  2QJA C;  5IMY C;  1KFH A;  2MUP A;  2HLR A;  3VTS A;  2ERA A;  2UWR A;  1LX5 B;  3PLC A;  5DO6 A;  1COE A;  5IMT D;  4P7U A;  2PJY B;  1CCQ A;  1KS6 A;  1TGX A;  4RUD A;  1ERG A;  2H8U A;  1BXP A;  1CTX A;  1FSS B;  1CRF A;  1KL8 A;  5DZ5 A;  1QKD A;  2I9B E;  1FFJ A;  1NXB A;  1ABT A;  2CTX A;  1RL5 A;  2NBT A;  2H62 C;  2CRS A;  2ABX A;  4LFT A;  2BTX A;  2JQP A;  1CB9 A;  2CCX A;  1IQ9 A;  1FSC A;  4OM5 A;  1LXG A;  3ERA A;  3U73 U;  1IK8 A;  2H5F A;  2GOO B;  2JVE A;  4ZQY A;  1F8U B;  1IJC A;  1NYS A;  1V6P A;  1DRS A;  3FEV A;  1LJZ A;  1H0J A;  1KTZ B;  5EBX A;  1KBA A;  1JBD A;  1HC9 B;  3QB4 B;  2VLW A;  1ONJ A;  4XJJ A;  1IKC A;  1HC9 A;  2OFS A;  1S4Y A;  1HAA A;  1PLO A;  2H64 C;  2MJ4 A;  4QTI U;  4BIK B;  1CDT A;  1CVO A;  2N99 A;  1NEA A;  1TXB A;  2H62 D;  1MAH F;  3NDS A;  1JE9 A;  2QC1 A;  2LA1 A;  1CXO A;  1TXA A;  3NH7 A;  1CDQ A;  1I02 A;  2MFA A;  1KBT A;  2CRT A;  1IDG A;  2K3G A;  3HH7 A;  1HAJ A;  1NTX A;  2HLQ A;  3U74 U;  1RGJ A;  4KSN A;  1ZAD A;  4IYE A;  4OM4 A;  2X8B B;  1BTE A;  2CDX A;  3BT1 U;  1CRE A;  1CXN A;  2H7Z B;  1FRA A;  1CDS A;  1FAS A;  1UG4 A;  2QJB C;  2J8B A;  1IDL A;  1REW C;  2H7Z A;  1NYU A;  1M9Z A;  1MR6 A;  1IDI A;  3BT2 U;  1B41 B;  1VB0 A;  4HQP F;  1YWH A;  1FF4 A;  1W6B A;  4EY8 B;  3NEQ A;  3EBX A;  1IDH A;  1LXH A;  1L4W A;  5DU1 A; 
#chains in the Genus database with same CATH homology
 1QM7 A;  2PJY C;  2QJ9 C;  1KC4 A;  1JGK A;  2FD6 U;  1COD A;  1CHV S;  1KU6 B;  4UY2 C;  1G6M A;  2H64 B;  4AEA A;  1XT3 A;  2UX2 A;  2MUO A;  3EVS C;  1NOR A;  1ES7 B;  1LSI A;  1KBS A;  4FAO E;  1QKE A;  4FAO C;  2GOO C;  2LCR A;  1KXI A;  4DO8 A;  1TFS A;  1CDR A;  2L03 A;  3KFD E;  4BDT B;  2MJ0 A;  2L5S A;  1F94 A;  3LAQ U;  6EBX A;  1HOY A;  2MHY A;  2MJY A;  1ERA A;  1NTN A;  3KFD I;  2BHI A;  2QJA C;  5IMY C;  1KFH A;  2MUP A;  2HLR A;  3VTS A;  2ERA A;  2UWR A;  1LX5 B;  3PLC A;  5DO6 A;  1COE A;  5IMT D;  4P7U A;  2PJY B;  1CCQ A;  1KS6 A;  1TGX A;  4RUD A;  1ERG A;  2H8U A;  1BXP A;  1CTX A;  1FSS B;  1CRF A;  1KL8 A;  5DZ5 A;  1QKD A;  2I9B E;  1FFJ A;  1NXB A;  1ABT A;  2CTX A;  1RL5 A;  2NBT A;  2H62 C;  2CRS A;  2ABX A;  4LFT A;  2BTX A;  2JQP A;  1CB9 A;  2CCX A;  1IQ9 A;  1FSC A;  4OM5 A;  1LXG A;  3ERA A;  3U73 U;  1IK8 A;  2H5F A;  2GOO B;  2JVE A;  4ZQY A;  1F8U B;  1IJC A;  1NYS A;  1V6P A;  1DRS A;  3FEV A;  1LJZ A;  1H0J A;  1KTZ B;  5EBX A;  1KBA A;  1JBD A;  1HC9 B;  3QB4 B;  2VLW A;  1ONJ A;  4XJJ A;  1IKC A;  1HC9 A;  2OFS A;  1S4Y A;  1HAA A;  1PLO A;  2H64 C;  2MJ4 A;  4QTI U;  4BIK B;  1CDT A;  1CVO A;  2N99 A;  1NEA A;  1TXB A;  2H62 D;  1MAH F;  3NDS A;  1JE9 A;  2QC1 A;  2LA1 A;  1CXO A;  1TXA A;  3NH7 A;  1CDQ A;  1I02 A;  2MFA A;  1KBT A;  2CRT A;  1IDG A;  2K3G A;  3HH7 A;  1HAJ A;  1NTX A;  2HLQ A;  3U74 U;  1RGJ A;  4KSN A;  1ZAD A;  4IYE A;  4OM4 A;  2X8B B;  1BTE A;  2CDX A;  3BT1 U;  1CRE A;  1CXN A;  2H7Z B;  1FRA A;  1CDS A;  1FAS A;  1UG4 A;  2QJB C;  2J8B A;  1IDL A;  1REW C;  2H7Z A;  1NYU A;  1M9Z A;  1MR6 A;  1IDI A;  3BT2 U;  1B41 B;  1VB0 A;  4HQP F;  1YWH A;  1FF4 A;  1W6B A;  4EY8 B;  3NEQ A;  3EBX A;  1IDH A;  1LXH A;  1L4W A;  5DU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...